Skip to content

Regression Checklist

Jump to bottom
cpitman-11 edited this page Dec 13, 2024 · 16 revisions

Using the regression test checklist:

Copy the checklist below (select "edit", copy everything from "For each of the following, do the blobs change..." to the end of the page).

Paste the checklist into a new github issue titled "Pulling main into production". As items are completed on the checklist, check them off on the issue.

If and only if the checklist is complete, main can be pulled into production. Close the issue.

NOTE: If compute_blobs.py has been modified, the blobulator package needs to be reinstalled in order for any changes to propagate.

For each of the following, do blobs across all tracks change height and color as expected:

  • Set the hydropathy threshold to 0.0. (All tracks should show only an h-blob).

  • Set the length minimum to the length of the sequence. (All tracks should show only a p-blob).

  • When the mutation button is checked with a SNP

  • After adjusting the hydropathy slider

  • After adjusting the blob size slider

  • After adjusting the hydropathy numerical input

  • After adjusting the blob size numerical input

  • After clicking the hydropathy up and down buttons

  • After clicking the blob size up and down buttons

  • Check the download plots button

  • Check the download data button

  • Check that website links lead to the expected papers and websites

  • Check multiple SNP residues and make sure that they update correctly after selecting a new SNP

  • Run current regression tests with an introduced mutation.

  • Check uniprot and ensemble IDs for both a legitimate and false ID. Make sure that the expected protein is blobulated, and a valid error is shown in the case of a false ID

  • When the results page is loaded (on a non-full screen browser window) are all plots and “i” icons visible?

  • For each track, are all bars visible?

  • Load a large protein, does the browser load within 1 minute?

  • Check links for SNP triangles, make sure they lead to the expected website

  • Does everything on both the result and home pages look aligned?

  • When clickable elements are selected, do they look as expected?

  • Does the terminal output anything when blobulation occurs?

  • Are SNP triangles centered over the correct residue?

  • Does the skyline update around the correct residues?

  • Does the result controls panel stay at the top of the page when scrolling?

  • When zooming, check that all figures update, resid labels are legible, and the skyline updates correctly.

  • Is the control panel correctly sized?

  • Do all tabs contain their expected content?

  • Are the track legends completely covered?

  • Blobulate the sequence GSGPPGPPGPPGPPGARGQAGVMGFPGPPGPPGPPGRAPTDQHIKQVCMRVIQEHFAEMAASLKRPDSGAT, and check that the smoothed kyte-doolittle hydropathies match those given by https://www.ebi.ac.uk/Tools/seqstats/emboss_pepinfo/

  • Does the NCPR coloring match that of the production site?

Clone this wiki locally