diff --git a/go.mod b/go.mod index 24b4210be..97b3af1a7 100644 --- a/go.mod +++ b/go.mod @@ -1,6 +1,6 @@ module kubedb.dev/cli -go 1.23.6 +go 1.24.0 toolchain go1.24.5 @@ -29,9 +29,9 @@ require ( kmodules.xyz/client-go v0.32.7 kmodules.xyz/custom-resources v0.32.0 kmodules.xyz/monitoring-agent-api v0.32.1 - kubedb.dev/apimachinery v0.57.0 - kubedb.dev/db-client-go v0.12.0 - kubeops.dev/petset v0.0.11 + kubedb.dev/apimachinery v0.58.0 + kubedb.dev/db-client-go v0.13.0 + kubeops.dev/petset v0.0.12 sigs.k8s.io/controller-runtime v0.20.4 sigs.k8s.io/yaml v1.4.0 stash.appscode.dev/apimachinery v0.41.0 @@ -84,7 +84,7 @@ require ( github.com/josharian/intern v1.0.0 // indirect github.com/json-iterator/go v1.1.12 // indirect github.com/klauspost/compress v1.18.0 // indirect - github.com/klauspost/cpuid/v2 v2.0.9 // indirect + github.com/klauspost/cpuid/v2 v2.2.5 // indirect github.com/kubernetes-csi/external-snapshotter/client/v8 v8.2.0 // indirect github.com/liggitt/tabwriter v0.0.0-20181228230101-89fcab3d43de // indirect github.com/mailru/easyjson v0.9.0 // indirect diff --git a/go.sum b/go.sum index b4ba7239d..2055e8ad4 100644 --- a/go.sum +++ b/go.sum @@ -235,8 +235,8 @@ github.com/kisielk/errcheck v1.5.0/go.mod h1:pFxgyoBC7bSaBwPgfKdkLd5X25qrDl4LWUI github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck= github.com/klauspost/compress v1.18.0 h1:c/Cqfb0r+Yi+JtIEq73FWXVkRonBlf0CRNYc8Zttxdo= github.com/klauspost/compress v1.18.0/go.mod h1:2Pp+KzxcywXVXMr50+X0Q/Lsb43OQHYWRCY2AiWywWQ= -github.com/klauspost/cpuid/v2 v2.0.9 h1:lgaqFMSdTdQYdZ04uHyN2d/eKdOMyi2YLSvlQIBFYa4= -github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= +github.com/klauspost/cpuid/v2 v2.2.5 h1:0E5MSMDEoAulmXNFquVs//DdoomxaoTY1kUhbc/qbZg= +github.com/klauspost/cpuid/v2 v2.2.5/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= github.com/kmodules/apiserver v0.32.3-0.20250221062720-35dc674c7dd6 h1:U6BBc6uBT3jTlmTBTyXaIfNnp1WzUaX6Xz7ReV8qcaw= github.com/kmodules/apiserver v0.32.3-0.20250221062720-35dc674c7dd6/go.mod h1:PEwREHiHNU2oFdte7BjzA1ZyjWjuckORLIK/wLV5goM= github.com/kmodules/controller-runtime v0.20.3-0.20250221050548-8eabe54e7dda h1:sCYJ4MiAYXHjUT6mJSRPaCPbHosjHjyrdNita/ZFQLk= @@ -704,14 +704,14 @@ kmodules.xyz/prober v0.32.0 h1:8Z6pFRAu8kP0wwX2BooPCRy2SE6ZkUMHQmZDH5VUEGY= kmodules.xyz/prober v0.32.0/go.mod h1:h0fH4m9DaIwuNZq85zOlWUvBycyy4LvCPMUUhpS3iSE= kmodules.xyz/resource-metadata v0.32.1 h1:hWQbL0Xb+GaF7qn+rY0CNh7FUfKZw29VBUKTxjHFGYI= kmodules.xyz/resource-metadata v0.32.1/go.mod h1:wHC24BVzKb1gzkDCSI5l9CXK4AKD5gMamxEqVys50lI= -kubedb.dev/apimachinery v0.57.0 h1:Ia6LlkDxbK/NbUMhLGM92QqHQAHr4g0wWxdVtjXMvEU= -kubedb.dev/apimachinery v0.57.0/go.mod h1:STmyKaUgTJ3mspOrb9xjwhYyj68c6v6R1kjpPyNu9KY= -kubedb.dev/db-client-go v0.12.0 h1:ZUtp5b4+nG7r4R/9Y/lRZjrRu9X+BZ1+TDcch87a/oI= -kubedb.dev/db-client-go v0.12.0/go.mod h1:xy2v8aTVniTGJN5ko5NNruxp5gpxQBRRypVEyibCgOs= +kubedb.dev/apimachinery v0.58.0 h1:bsDqWcYsfjbZ6Ca4PyXbKr7jj3dhzzlPBS5NfQ9CD+I= +kubedb.dev/apimachinery v0.58.0/go.mod h1:t6BwVURkvyLKpx7teRZ20hBkjAgF8JB1CCLSjBbbPqo= +kubedb.dev/db-client-go v0.13.0 h1:qxyqhCxHj48zzX/Gc1RzfpabzOCUb2VM2Sq7c8+MSYY= +kubedb.dev/db-client-go v0.13.0/go.mod h1:agK2zOLzI19YR9f0P2gt9FoU2KOgitCpI93VheE93Bo= kubeops.dev/csi-driver-cacerts v0.1.0 h1:WDgKNo5QAiMoVy4c/4ARWeCXJbqdcXdcn8VLImV4VZU= kubeops.dev/csi-driver-cacerts v0.1.0/go.mod h1:5a/ZOn5LFw26PPBpTKvsivBjcvVArOrJX24C+k+przk= -kubeops.dev/petset v0.0.11 h1:tlcGhGN+9wMYHXvGkSNz48ziozJFEknWaDj5YUws3kQ= -kubeops.dev/petset v0.0.11/go.mod h1:veOaOzhp1GVKeI1QAV0z6p0WDtCShwkFXiqgxwYNoBo= +kubeops.dev/petset v0.0.12 h1:NSFEeuckBVm44f3cAL4HhcQWvnfOE4qgbfug7+FEyaY= +kubeops.dev/petset v0.0.12/go.mod h1:akG9QH1JaOZQcuQKEKWvkVWI8P3im/5O554aTRvB6Y0= kubeops.dev/sidekick v0.0.11 h1:OydXdIH6cYSiWxKIWvrywk95WhhHSERkc7RNPOmTekc= kubeops.dev/sidekick v0.0.11/go.mod h1:90KMNmJOPoMKHbrdC1cpEsMx+1KjTea/lHDAbGRDzHc= kubestash.dev/apimachinery v0.20.0 h1:X4v7u/4N+RT3bP17VlSVXwvCZ69JLZtBUNiyhyV1bfo= diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index 465f4b77c..accd7abaf 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -16,10 +16,23 @@ Package home: https://github.com/klauspost/cpuid ## installing -`go get -u github.com/klauspost/cpuid/v2` using modules. - +`go get -u github.com/klauspost/cpuid/v2` using modules. Drop `v2` for others. +Installing binary: + +`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest` + +Or download binaries from release page: https://github.com/klauspost/cpuid/releases + +### Homebrew + +For macOS/Linux users, you can install via [brew](https://brew.sh/) + +```sh +$ brew install cpuid +``` + ## example ```Go @@ -39,10 +52,10 @@ func main() { fmt.Println("ThreadsPerCore:", CPU.ThreadsPerCore) fmt.Println("LogicalCores:", CPU.LogicalCores) fmt.Println("Family", CPU.Family, "Model:", CPU.Model, "Vendor ID:", CPU.VendorID) - fmt.Println("Features:", fmt.Sprintf(strings.Join(CPU.FeatureSet(), ","))) + fmt.Println("Features:", strings.Join(CPU.FeatureSet(), ",")) fmt.Println("Cacheline bytes:", CPU.CacheLine) fmt.Println("L1 Data Cache:", CPU.Cache.L1D, "bytes") - fmt.Println("L1 Instruction Cache:", CPU.Cache.L1D, "bytes") + fmt.Println("L1 Instruction Cache:", CPU.Cache.L1I, "bytes") fmt.Println("L2 Cache:", CPU.Cache.L2, "bytes") fmt.Println("L3 Cache:", CPU.Cache.L3, "bytes") fmt.Println("Frequency", CPU.Hz, "hz") @@ -77,10 +90,14 @@ We have Streaming SIMD 2 Extensions The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features. A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler. +To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc. +This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported. + Note that for some cpu/os combinations some features will not be detected. `amd64` has rather good support and should work reliably on all platforms. -Note that hypervisors may not pass through all CPU features. +Note that hypervisors may not pass through all CPU features through to the guest OS, +so even if your host supports a feature it may not be visible on guests. ## arm64 feature detection @@ -132,6 +149,345 @@ func main() { } ``` +## commandline + +Download as binary from: https://github.com/klauspost/cpuid/releases + +Install from source: + +`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest` + +### Example + +``` +λ cpuid +Name: AMD Ryzen 9 3950X 16-Core Processor +Vendor String: AuthenticAMD +Vendor ID: AMD +PhysicalCores: 16 +Threads Per Core: 2 +Logical Cores: 32 +CPU Family 23 Model: 113 +Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE +Microarchitecture level: 3 +Cacheline bytes: 64 +L1 Instruction Cache: 32768 bytes +L1 Data Cache: 32768 bytes +L2 Cache: 524288 bytes +L3 Cache: 16777216 bytes + +``` +### JSON Output: + +``` +λ cpuid --json +{ + "BrandName": "AMD Ryzen 9 3950X 16-Core Processor", + "VendorID": 2, + "VendorString": "AuthenticAMD", + "PhysicalCores": 16, + "ThreadsPerCore": 2, + "LogicalCores": 32, + "Family": 23, + "Model": 113, + "CacheLine": 64, + "Hz": 0, + "BoostFreq": 0, + "Cache": { + "L1I": 32768, + "L1D": 32768, + "L2": 524288, + "L3": 16777216 + }, + "SGX": { + "Available": false, + "LaunchControl": false, + "SGX1Supported": false, + "SGX2Supported": false, + "MaxEnclaveSizeNot64": 0, + "MaxEnclaveSize64": 0, + "EPCSections": null + }, + "Features": [ + "ADX", + "AESNI", + "AVX", + "AVX2", + "BMI1", + "BMI2", + "CLMUL", + "CLZERO", + "CMOV", + "CMPXCHG8", + "CPBOOST", + "CX16", + "F16C", + "FMA3", + "FXSR", + "FXSROPT", + "HTT", + "HYPERVISOR", + "LAHF", + "LZCNT", + "MCAOVERFLOW", + "MMX", + "MMXEXT", + "MOVBE", + "NX", + "OSXSAVE", + "POPCNT", + "RDRAND", + "RDSEED", + "RDTSCP", + "SCE", + "SHA", + "SSE", + "SSE2", + "SSE3", + "SSE4", + "SSE42", + "SSE4A", + "SSSE3", + "SUCCOR", + "X87", + "XSAVE" + ], + "X64Level": 3 +} +``` + +### Check CPU microarch level + +``` +λ cpuid --check-level=3 +2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor +2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3. +Exit Code 0 + +λ cpuid --check-level=4 +2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor +2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3. +Exit Code 1 +``` + + +## Available flags + +### x86 & amd64 + +| Feature Flag | Description | +|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------| +| ADX | Intel ADX (Multi-Precision Add-Carry Instruction Extensions) | +| AESNI | Advanced Encryption Standard New Instructions | +| AMD3DNOW | AMD 3DNOW | +| AMD3DNOWEXT | AMD 3DNowExt | +| AMXBF16 | Tile computational operations on BFLOAT16 numbers | +| AMXINT8 | Tile computational operations on 8-bit integers | +| AMXFP16 | Tile computational operations on FP16 numbers | +| AMXTILE | Tile architecture | +| AVX | AVX functions | +| AVX2 | AVX2 functions | +| AVX512BF16 | AVX-512 BFLOAT16 Instructions | +| AVX512BITALG | AVX-512 Bit Algorithms | +| AVX512BW | AVX-512 Byte and Word Instructions | +| AVX512CD | AVX-512 Conflict Detection Instructions | +| AVX512DQ | AVX-512 Doubleword and Quadword Instructions | +| AVX512ER | AVX-512 Exponential and Reciprocal Instructions | +| AVX512F | AVX-512 Foundation | +| AVX512FP16 | AVX-512 FP16 Instructions | +| AVX512IFMA | AVX-512 Integer Fused Multiply-Add Instructions | +| AVX512PF | AVX-512 Prefetch Instructions | +| AVX512VBMI | AVX-512 Vector Bit Manipulation Instructions | +| AVX512VBMI2 | AVX-512 Vector Bit Manipulation Instructions, Version 2 | +| AVX512VL | AVX-512 Vector Length Extensions | +| AVX512VNNI | AVX-512 Vector Neural Network Instructions | +| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q | +| AVX512VPOPCNTDQ | AVX-512 Vector Population Count Doubleword and Quadword | +| AVXIFMA | AVX-IFMA instructions | +| AVXNECONVERT | AVX-NE-CONVERT instructions | +| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one | +| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions | +| AVXVNNIINT8 | AVX-VNNI-INT8 instructions | +| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 | +| BMI1 | Bit Manipulation Instruction Set 1 | +| BMI2 | Bit Manipulation Instruction Set 2 | +| CETIBT | Intel CET Indirect Branch Tracking | +| CETSS | Intel CET Shadow Stack | +| CLDEMOTE | Cache Line Demote | +| CLMUL | Carry-less Multiplication | +| CLZERO | CLZERO instruction supported | +| CMOV | i686 CMOV | +| CMPCCXADD | CMPCCXADD instructions | +| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB | +| CMPXCHG8 | CMPXCHG8 instruction | +| CPBOOST | Core Performance Boost | +| CPPC | AMD: Collaborative Processor Performance Control | +| CX16 | CMPXCHG16B Instruction | +| EFER_LMSLE_UNS | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ | +| ENQCMD | Enqueue Command | +| ERMS | Enhanced REP MOVSB/STOSB | +| F16C | Half-precision floating-point conversion | +| FLUSH_L1D | Flush L1D cache | +| FMA3 | Intel FMA 3. Does not imply AVX. | +| FMA4 | Bulldozer FMA4 functions | +| FP128 | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide | +| FP256 | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide | +| FSRM | Fast Short Rep Mov | +| FXSR | FXSAVE, FXRESTOR instructions, CR4 bit 9 | +| FXSROPT | FXSAVE/FXRSTOR optimizations | +| GFNI | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. | +| HLE | Hardware Lock Elision | +| HRESET | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR | +| HTT | Hyperthreading (enabled) | +| HWA | Hardware assert supported. Indicates support for MSRC001_10 | +| HYBRID_CPU | This part has CPUs of more than one type. | +| HYPERVISOR | This bit has been reserved by Intel & AMD for use by hypervisors | +| IA32_ARCH_CAP | IA32_ARCH_CAPABILITIES MSR (Intel) | +| IA32_CORE_CAP | IA32_CORE_CAPABILITIES MSR | +| IBPB | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) | +| IBRS | AMD: Indirect Branch Restricted Speculation | +| IBRS_PREFERRED | AMD: IBRS is preferred over software solution | +| IBRS_PROVIDES_SMP | AMD: IBRS provides Same Mode Protection | +| IBS | Instruction Based Sampling (AMD) | +| IBSBRNTRGT | Instruction Based Sampling Feature (AMD) | +| IBSFETCHSAM | Instruction Based Sampling Feature (AMD) | +| IBSFFV | Instruction Based Sampling Feature (AMD) | +| IBSOPCNT | Instruction Based Sampling Feature (AMD) | +| IBSOPCNTEXT | Instruction Based Sampling Feature (AMD) | +| IBSOPSAM | Instruction Based Sampling Feature (AMD) | +| IBSRDWROPCNT | Instruction Based Sampling Feature (AMD) | +| IBSRIPINVALIDCHK | Instruction Based Sampling Feature (AMD) | +| IBS_FETCH_CTLX | AMD: IBS fetch control extended MSR supported | +| IBS_OPDATA4 | AMD: IBS op data 4 MSR supported | +| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse | +| IBS_PREVENTHOST | Disallowing IBS use by the host supported | +| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 | +| IDPRED_CTRL | IPRED_DIS | +| INT_WBINVD | WBINVD/WBNOINVD are interruptible. | +| INVLPGB | NVLPGB and TLBSYNC instruction supported | +| LAHF | LAHF/SAHF in long mode | +| LAM | If set, CPU supports Linear Address Masking | +| LBRVIRT | LBR virtualization | +| LZCNT | LZCNT instruction | +| MCAOVERFLOW | MCA overflow recovery support. | +| MCDT_NO | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. | +| MCOMMIT | MCOMMIT instruction supported | +| MD_CLEAR | VERW clears CPU buffers | +| MMX | standard MMX | +| MMXEXT | SSE integer functions or AMD MMX ext | +| MOVBE | MOVBE instruction (big-endian) | +| MOVDIR64B | Move 64 Bytes as Direct Store | +| MOVDIRI | Move Doubleword as Direct Store | +| MOVSB_ZL | Fast Zero-Length MOVSB | +| MPX | Intel MPX (Memory Protection Extensions) | +| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD | +| MSRIRC | Instruction Retired Counter MSR available | +| MSRLIST | Read/Write List of Model Specific Registers | +| MSR_PAGEFLUSH | Page Flush MSR available | +| NRIPS | Indicates support for NRIP save on VMEXIT | +| NX | NX (No-Execute) bit | +| OSXSAVE | XSAVE enabled by OS | +| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption | +| POPCNT | POPCNT instruction | +| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled | +| PREFETCHI | PREFETCHIT0/1 instructions | +| PSFD | Predictive Store Forward Disable | +| RDPRU | RDPRU instruction supported | +| RDRAND | RDRAND instruction is available | +| RDSEED | RDSEED instruction is available | +| RDTSCP | RDTSCP Instruction | +| RRSBA_CTRL | Restricted RSB Alternate | +| RTM | Restricted Transactional Memory | +| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. | +| SERIALIZE | Serialize Instruction Execution | +| SEV | AMD Secure Encrypted Virtualization supported | +| SEV_64BIT | AMD SEV guest execution only allowed from a 64-bit host | +| SEV_ALTERNATIVE | AMD SEV Alternate Injection supported | +| SEV_DEBUGSWAP | Full debug state swap supported for SEV-ES guests | +| SEV_ES | AMD SEV Encrypted State supported | +| SEV_RESTRICTED | AMD SEV Restricted Injection supported | +| SEV_SNP | AMD SEV Secure Nested Paging supported | +| SGX | Software Guard Extensions | +| SGXLC | Software Guard Extensions Launch Control | +| SHA | Intel SHA Extensions | +| SME | AMD Secure Memory Encryption supported | +| SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced | +| SPEC_CTRL_SSBD | Speculative Store Bypass Disable | +| SRBDS_CTRL | SRBDS mitigation MSR available | +| SSE | SSE functions | +| SSE2 | P4 SSE functions | +| SSE3 | Prescott SSE3 functions | +| SSE4 | Penryn SSE4.1 functions | +| SSE42 | Nehalem SSE4.2 functions | +| SSE4A | AMD Barcelona microarchitecture SSE4a instructions | +| SSSE3 | Conroe SSSE3 functions | +| STIBP | Single Thread Indirect Branch Predictors | +| STIBP_ALWAYSON | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On | +| STOSB_SHORT | Fast short STOSB | +| SUCCOR | Software uncorrectable error containment and recovery capability. | +| SVM | AMD Secure Virtual Machine | +| SVMDA | Indicates support for the SVM decode assists. | +| SVMFBASID | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control | +| SVML | AMD SVM lock. Indicates support for SVM-Lock. | +| SVMNP | AMD SVM nested paging | +| SVMPF | SVM pause intercept filter. Indicates support for the pause intercept filter | +| SVMPFT | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold | +| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. | +| SYSEE | SYSENTER and SYSEXIT instructions | +| TBM | AMD Trailing Bit Manipulation | +| TDX_GUEST | Intel Trust Domain Extensions Guest | +| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations | +| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. | +| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. | +| TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 | +| TSXLDTRK | Intel TSX Suspend Load Address Tracking | +| VAES | Vector AES. AVX(512) versions requires additional checks. | +| VMCBCLEAN | VMCB clean bits. Indicates support for VMCB clean bits. | +| VMPL | AMD VM Permission Levels supported | +| VMSA_REGPROT | AMD VMSA Register Protection supported | +| VMX | Virtual Machine Extensions | +| VPCLMULQDQ | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. | +| VTE | AMD Virtual Transparent Encryption supported | +| WAITPKG | TPAUSE, UMONITOR, UMWAIT | +| WBNOINVD | Write Back and Do Not Invalidate Cache | +| WRMSRNS | Non-Serializing Write to Model Specific Register | +| X87 | FPU | +| XGETBV1 | Supports XGETBV with ECX = 1 | +| XOP | Bulldozer XOP functions | +| XSAVE | XSAVE, XRESTOR, XSETBV, XGETBV | +| XSAVEC | Supports XSAVEC and the compacted form of XRSTOR. | +| XSAVEOPT | XSAVEOPT available | +| XSAVES | Supports XSAVES/XRSTORS and IA32_XSS | + +# ARM features: + +| Feature Flag | Description | +|--------------|------------------------------------------------------------------| +| AESARM | AES instructions | +| ARMCPUID | Some CPU ID registers readable at user-level | +| ASIMD | Advanced SIMD | +| ASIMDDP | SIMD Dot Product | +| ASIMDHP | Advanced SIMD half-precision floating point | +| ASIMDRDM | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) | +| ATOMICS | Large System Extensions (LSE) | +| CRC32 | CRC32/CRC32C instructions | +| DCPOP | Data cache clean to Point of Persistence (DC CVAP) | +| EVTSTRM | Generic timer | +| FCMA | Floatin point complex number addition and multiplication | +| FP | Single-precision and double-precision floating point | +| FPHP | Half-precision floating point | +| GPA | Generic Pointer Authentication | +| JSCVT | Javascript-style double->int convert (FJCVTZS) | +| LRCPC | Weaker release consistency (LDAPR, etc) | +| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) | +| SHA1 | SHA-1 instructions (SHA1C, etc) | +| SHA2 | SHA-2 instructions (SHA256H, etc) | +| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) | +| SHA512 | SHA512 instructions | +| SM3 | SM3 instructions | +| SM4 | SM4 instructions | +| SVE | Scalable Vector Extension | + # license This code is published under an MIT license. See LICENSE file for more information. diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index 1d88736b6..d015c744e 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -14,6 +14,7 @@ import ( "flag" "fmt" "math" + "math/bits" "os" "runtime" "strings" @@ -72,6 +73,7 @@ const ( AMD3DNOW // AMD 3DNOW AMD3DNOWEXT // AMD 3DNowExt AMXBF16 // Tile computational operations on BFLOAT16 numbers + AMXFP16 // Tile computational operations on FP16 numbers AMXINT8 // Tile computational operations on 8-bit integers AMXTILE // Tile architecture AVX // AVX functions @@ -92,26 +94,51 @@ const ( AVX512VNNI // AVX-512 Vector Neural Network Instructions AVX512VP2INTERSECT // AVX-512 Intersect for D/Q AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword - AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one. + AVXIFMA // AVX-IFMA instructions + AVXNECONVERT // AVX-NE-CONVERT instructions + AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one + AVXVNNI // AVX (VEX encoded) VNNI neural network instructions + AVXVNNIINT8 // AVX-VNNI-INT8 instructions + BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 BMI1 // Bit Manipulation Instruction Set 1 BMI2 // Bit Manipulation Instruction Set 2 + CETIBT // Intel CET Indirect Branch Tracking + CETSS // Intel CET Shadow Stack CLDEMOTE // Cache Line Demote CLMUL // Carry-less Multiplication CLZERO // CLZERO instruction supported CMOV // i686 CMOV + CMPCCXADD // CMPCCXADD instructions + CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB + CMPXCHG8 // CMPXCHG8 instruction CPBOOST // Core Performance Boost + CPPC // AMD: Collaborative Processor Performance Control CX16 // CMPXCHG16B Instruction + EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ ENQCMD // Enqueue Command ERMS // Enhanced REP MOVSB/STOSB F16C // Half-precision floating-point conversion + FLUSH_L1D // Flush L1D cache FMA3 // Intel FMA 3. Does not imply AVX. FMA4 // Bulldozer FMA4 functions - GFNI // Galois Field New Instructions + FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide + FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide + FSRM // Fast Short Rep Mov + FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 + FXSROPT // FXSAVE/FXRSTOR optimizations + GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. HLE // Hardware Lock Elision + HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR HTT // Hyperthreading (enabled) HWA // Hardware assert supported. Indicates support for MSRC001_10 + HYBRID_CPU // This part has CPUs of more than one type. HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors + IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel) + IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) + IBRS // AMD: Indirect Branch Restricted Speculation + IBRS_PREFERRED // AMD: IBRS is preferred over software solution + IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection IBS // Instruction Based Sampling (AMD) IBSBRNTRGT // Instruction Based Sampling Feature (AMD) IBSFETCHSAM // Instruction Based Sampling Feature (AMD) @@ -121,29 +148,63 @@ const ( IBSOPSAM // Instruction Based Sampling Feature (AMD) IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) + IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported + IBS_OPDATA4 // AMD: IBS op data 4 MSR supported + IBS_OPFUSE // AMD: Indicates support for IbsOpFuse + IBS_PREVENTHOST // Disallowing IBS use by the host supported + IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4 + IDPRED_CTRL // IPRED_DIS INT_WBINVD // WBINVD/WBNOINVD are interruptible. INVLPGB // NVLPGB and TLBSYNC instruction supported + LAHF // LAHF/SAHF in long mode + LAM // If set, CPU supports Linear Address Masking + LBRVIRT // LBR virtualization LZCNT // LZCNT instruction MCAOVERFLOW // MCA overflow recovery support. + MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. MCOMMIT // MCOMMIT instruction supported + MD_CLEAR // VERW clears CPU buffers MMX // standard MMX MMXEXT // SSE integer functions or AMD MMX ext + MOVBE // MOVBE instruction (big-endian) MOVDIR64B // Move 64 Bytes as Direct Store MOVDIRI // Move Doubleword as Direct Store + MOVSB_ZL // Fast Zero-Length MOVSB + MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD MPX // Intel MPX (Memory Protection Extensions) MSRIRC // Instruction Retired Counter MSR available + MSRLIST // Read/Write List of Model Specific Registers + MSR_PAGEFLUSH // Page Flush MSR available + NRIPS // Indicates support for NRIP save on VMEXIT NX // NX (No-Execute) bit + OSXSAVE // XSAVE enabled by OS + PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption POPCNT // POPCNT instruction + PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled + PREFETCHI // PREFETCHIT0/1 instructions + PSFD // Predictive Store Forward Disable RDPRU // RDPRU instruction supported RDRAND // RDRAND instruction is available RDSEED // RDSEED instruction is available RDTSCP // RDTSCP Instruction + RRSBA_CTRL // Restricted RSB Alternate RTM // Restricted Transactional Memory RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort. SERIALIZE // Serialize Instruction Execution + SEV // AMD Secure Encrypted Virtualization supported + SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host + SEV_ALTERNATIVE // AMD SEV Alternate Injection supported + SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests + SEV_ES // AMD SEV Encrypted State supported + SEV_RESTRICTED // AMD SEV Restricted Injection supported + SEV_SNP // AMD SEV Secure Nested Paging supported SGX // Software Guard Extensions SGXLC // Software Guard Extensions Launch Control SHA // Intel SHA Extensions + SME // AMD Secure Memory Encryption supported + SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced + SPEC_CTRL_SSBD // Speculative Store Bypass Disable + SRBDS_CTRL // SRBDS mitigation MSR available SSE // SSE functions SSE2 // P4 SSE functions SSE3 // Prescott SSE3 functions @@ -152,15 +213,42 @@ const ( SSE4A // AMD Barcelona microarchitecture SSE4a instructions SSSE3 // Conroe SSSE3 functions STIBP // Single Thread Indirect Branch Predictors + STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On + STOSB_SHORT // Fast short STOSB SUCCOR // Software uncorrectable error containment and recovery capability. + SVM // AMD Secure Virtual Machine + SVMDA // Indicates support for the SVM decode assists. + SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control + SVML // AMD SVM lock. Indicates support for SVM-Lock. + SVMNP // AMD SVM nested paging + SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter + SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold + SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. + SYSEE // SYSENTER and SYSEXIT instructions TBM // AMD Trailing Bit Manipulation + TDX_GUEST // Intel Trust Domain Extensions Guest + TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations + TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. + TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. + TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 TSXLDTRK // Intel TSX Suspend Load Address Tracking - VAES // Vector AES + VAES // Vector AES. AVX(512) versions requires additional checks. + VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits. + VMPL // AMD VM Permission Levels supported + VMSA_REGPROT // AMD VMSA Register Protection supported VMX // Virtual Machine Extensions - VPCLMULQDQ // Carry-Less Multiplication Quadword + VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. + VTE // AMD Virtual Transparent Encryption supported WAITPKG // TPAUSE, UMONITOR, UMWAIT WBNOINVD // Write Back and Do Not Invalidate Cache + WRMSRNS // Non-Serializing Write to Model Specific Register + X87 // FPU + XGETBV1 // Supports XGETBV with ECX = 1 XOP // Bulldozer XOP functions + XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV + XSAVEC // Supports XSAVEC and the compacted form of XRSTOR. + XSAVEOPT // XSAVEOPT available + XSAVES // Supports XSAVES/XRSTORS and IA32_XSS // ARM features: AESARM // AES instructions @@ -187,7 +275,6 @@ const ( SM3 // SM3 instructions SM4 // SM4 instructions SVE // Scalable Vector Extension - // Keep it last. It automatically defines the size of []flagSet lastID @@ -205,6 +292,7 @@ type CPUInfo struct { LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. Family int // CPU family number Model int // CPU model number + Stepping int // CPU stepping info CacheLine int // Cache line size in bytes. Will be 0 if undetectable. Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. BoostFreq int64 // Max clock speed, if known, 0 otherwise @@ -307,10 +395,66 @@ func (c CPUInfo) Supports(ids ...FeatureID) bool { // Has allows for checking a single feature. // Should be inlined by the compiler. -func (c CPUInfo) Has(id FeatureID) bool { +func (c *CPUInfo) Has(id FeatureID) bool { return c.featureSet.inSet(id) } +// AnyOf returns whether the CPU supports one or more of the requested features. +func (c CPUInfo) AnyOf(ids ...FeatureID) bool { + for _, id := range ids { + if c.featureSet.inSet(id) { + return true + } + } + return false +} + +// Features contains several features combined for a fast check using +// CpuInfo.HasAll +type Features *flagSet + +// CombineFeatures allows to combine several features for a close to constant time lookup. +func CombineFeatures(ids ...FeatureID) Features { + var v flagSet + for _, id := range ids { + v.set(id) + } + return &v +} + +func (c *CPUInfo) HasAll(f Features) bool { + return c.featureSet.hasSetP(f) +} + +// https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels +var oneOfLevel = CombineFeatures(SYSEE, SYSCALL) +var level1Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2) +var level2Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3) +var level3Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE) +var level4Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL) + +// X64Level returns the microarchitecture level detected on the CPU. +// If features are lacking or non x64 mode, 0 is returned. +// See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels +func (c CPUInfo) X64Level() int { + if !c.featureSet.hasOneOf(oneOfLevel) { + return 0 + } + if c.featureSet.hasSetP(level4Features) { + return 4 + } + if c.featureSet.hasSetP(level3Features) { + return 3 + } + if c.featureSet.hasSetP(level2Features) { + return 2 + } + if c.featureSet.hasSetP(level1Features) { + return 1 + } + return 0 +} + // Disable will disable one or several features. func (c *CPUInfo) Disable(ids ...FeatureID) bool { for _, id := range ids { @@ -333,11 +477,10 @@ func (c CPUInfo) IsVendor(v Vendor) bool { return c.VendorID == v } +// FeatureSet returns all available features as strings. func (c CPUInfo) FeatureSet() []string { - s := make([]string, 0) - for _, f := range c.featureSet.Strings() { - s = append(s, f) - } + s := make([]string, 0, c.featureSet.nEnabled()) + s = append(s, c.featureSet.Strings()...) return s } @@ -470,7 +613,7 @@ const flagMask = flagBits - 1 // flagSet contains detected cpu features and characteristics in an array of flags type flagSet [(lastID + flagMask) / flagBits]flags -func (s flagSet) inSet(feat FeatureID) bool { +func (s *flagSet) inSet(feat FeatureID) bool { return s[feat>>flagBitsLog2]&(1<<(feat&flagMask)) != 0 } @@ -499,6 +642,52 @@ func (s *flagSet) or(other flagSet) { } } +// hasSet returns whether all features are present. +func (s *flagSet) hasSet(other flagSet) bool { + for i, v := range other[:] { + if s[i]&v != v { + return false + } + } + return true +} + +// hasSet returns whether all features are present. +func (s *flagSet) hasSetP(other *flagSet) bool { + for i, v := range other[:] { + if s[i]&v != v { + return false + } + } + return true +} + +// hasOneOf returns whether one or more features are present. +func (s *flagSet) hasOneOf(other *flagSet) bool { + for i, v := range other[:] { + if s[i]&v != 0 { + return true + } + } + return false +} + +// nEnabled will return the number of enabled flags. +func (s *flagSet) nEnabled() (n int) { + for _, v := range s[:] { + n += bits.OnesCount64(uint64(v)) + } + return n +} + +func flagSetWith(feat ...FeatureID) flagSet { + var res flagSet + for _, f := range feat { + res.set(f) + } + return res +} + // ParseFeature will parse the string and return the ID of the matching feature. // Will return UNKNOWN if not found. func ParseFeature(s string) FeatureID { @@ -579,7 +768,7 @@ func threadsPerCore() int { if vend == AMD { // Workaround for AMD returning 0, assume 2 if >= Zen 2 // It will be more correct than not. - fam, _ := familyModel() + fam, _, _ := familyModel() _, _, _, d := cpuid(1) if (d&(1<<28)) != 0 && fam >= 23 { return 2 @@ -617,14 +806,27 @@ func logicalCores() int { } } -func familyModel() (int, int) { +func familyModel() (family, model, stepping int) { if maxFunctionID() < 0x1 { - return 0, 0 + return 0, 0, 0 } eax, _, _, _ := cpuid(1) - family := ((eax >> 8) & 0xf) + ((eax >> 20) & 0xff) - model := ((eax >> 4) & 0xf) + ((eax >> 12) & 0xf0) - return int(family), int(model) + // If BaseFamily[3:0] is less than Fh then ExtendedFamily[7:0] is reserved and Family is equal to BaseFamily[3:0]. + family = int((eax >> 8) & 0xf) + extFam := family == 0x6 // Intel is 0x6, needs extended model. + if family == 0xf { + // Add ExtFamily + family += int((eax >> 20) & 0xff) + extFam = true + } + // If BaseFamily[3:0] is less than 0Fh then ExtendedModel[3:0] is reserved and Model is equal to BaseModel[3:0]. + model = int((eax >> 4) & 0xf) + if extFam { + // Add ExtModel + model += int((eax >> 12) & 0xf0) + } + stepping = int(eax & 0xf) + return family, model, stepping } func physicalCores() int { @@ -708,6 +910,7 @@ func (c *CPUInfo) cacheSize() { if maxFunctionID() < 4 { return } + c.Cache.L1I, c.Cache.L1D, c.Cache.L2, c.Cache.L3 = 0, 0, 0, 0 for i := uint32(0); ; i++ { eax, ebx, ecx, _ := cpuidex(4, i) cacheType := eax & 15 @@ -758,9 +961,14 @@ func (c *CPUInfo) cacheSize() { c.Cache.L2 = int(((ecx >> 16) & 0xFFFF) * 1024) // CPUID Fn8000_001D_EAX_x[N:0] Cache Properties - if maxExtendedFunction() < 0x8000001D { + if maxExtendedFunction() < 0x8000001D || !c.Has(TOPEXT) { return } + + // Xen Hypervisor is buggy and returns the same entry no matter ECX value. + // Hack: When we encounter the same entry 100 times we break. + nSame := 0 + var last uint32 for i := uint32(0); i < math.MaxUint32; i++ { eax, ebx, ecx, _ := cpuidex(0x8000001D, i) @@ -776,6 +984,16 @@ func (c *CPUInfo) cacheSize() { return } + // Check for the same value repeated. + comb := eax ^ ebx ^ ecx + if comb == last { + nSame++ + if nSame == 100 { + return + } + } + last = comb + switch level { case 1: switch typ { @@ -800,8 +1018,6 @@ func (c *CPUInfo) cacheSize() { } } } - - return } type SGXEPCSection struct { @@ -862,21 +1078,26 @@ func support() flagSet { if mfi < 0x1 { return fs } - family, model := familyModel() + family, model, _ := familyModel() _, _, c, d := cpuid(1) + fs.setIf((d&(1<<0)) != 0, X87) + fs.setIf((d&(1<<8)) != 0, CMPXCHG8) + fs.setIf((d&(1<<11)) != 0, SYSEE) fs.setIf((d&(1<<15)) != 0, CMOV) fs.setIf((d&(1<<23)) != 0, MMX) - fs.setIf((d&(1<<25)) != 0, MMXEXT) + fs.setIf((d&(1<<24)) != 0, FXSR) + fs.setIf((d&(1<<25)) != 0, FXSROPT) fs.setIf((d&(1<<25)) != 0, SSE) fs.setIf((d&(1<<26)) != 0, SSE2) fs.setIf((c&1) != 0, SSE3) fs.setIf((c&(1<<5)) != 0, VMX) - fs.setIf((c&0x00000200) != 0, SSSE3) - fs.setIf((c&0x00080000) != 0, SSE4) - fs.setIf((c&0x00100000) != 0, SSE42) + fs.setIf((c&(1<<9)) != 0, SSSE3) + fs.setIf((c&(1<<19)) != 0, SSE4) + fs.setIf((c&(1<<20)) != 0, SSE42) fs.setIf((c&(1<<25)) != 0, AESNI) fs.setIf((c&(1<<1)) != 0, CLMUL) + fs.setIf(c&(1<<22) != 0, MOVBE) fs.setIf(c&(1<<23) != 0, POPCNT) fs.setIf(c&(1<<30) != 0, RDRAND) @@ -892,6 +1113,8 @@ func support() flagSet { if vend == AMD && (d&(1<<28)) != 0 && mfi >= 4 { fs.setIf(threadsPerCore() > 1, HTT) } + fs.setIf(c&1<<26 != 0, XSAVE) + fs.setIf(c&1<<27 != 0, OSXSAVE) // Check XGETBV/XSAVE (26), OXSAVE (27) and AVX (28) bits const avxCheck = 1<<26 | 1<<27 | 1<<28 if c&avxCheck == avxCheck { @@ -917,7 +1140,6 @@ func support() flagSet { // Check AVX2, AVX2 requires OS support, but BMI1/2 don't. if mfi >= 7 { _, ebx, ecx, edx := cpuidex(7, 0) - eax1, _, _, _ := cpuidex(7, 1) if fs.inSet(AVX) && (ebx&0x00000020) != 0 { fs.set(AVX2) } @@ -934,19 +1156,52 @@ func support() flagSet { fs.setIf(ebx&(1<<18) != 0, RDSEED) fs.setIf(ebx&(1<<19) != 0, ADX) fs.setIf(ebx&(1<<29) != 0, SHA) + // CPUID.(EAX=7, ECX=0).ECX fs.setIf(ecx&(1<<5) != 0, WAITPKG) + fs.setIf(ecx&(1<<7) != 0, CETSS) + fs.setIf(ecx&(1<<8) != 0, GFNI) + fs.setIf(ecx&(1<<9) != 0, VAES) + fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ) + fs.setIf(ecx&(1<<13) != 0, TME) fs.setIf(ecx&(1<<25) != 0, CLDEMOTE) fs.setIf(ecx&(1<<27) != 0, MOVDIRI) fs.setIf(ecx&(1<<28) != 0, MOVDIR64B) fs.setIf(ecx&(1<<29) != 0, ENQCMD) fs.setIf(ecx&(1<<30) != 0, SGXLC) + // CPUID.(EAX=7, ECX=0).EDX + fs.setIf(edx&(1<<4) != 0, FSRM) + fs.setIf(edx&(1<<9) != 0, SRBDS_CTRL) + fs.setIf(edx&(1<<10) != 0, MD_CLEAR) fs.setIf(edx&(1<<11) != 0, RTM_ALWAYS_ABORT) fs.setIf(edx&(1<<14) != 0, SERIALIZE) + fs.setIf(edx&(1<<15) != 0, HYBRID_CPU) fs.setIf(edx&(1<<16) != 0, TSXLDTRK) + fs.setIf(edx&(1<<18) != 0, PCONFIG) + fs.setIf(edx&(1<<20) != 0, CETIBT) fs.setIf(edx&(1<<26) != 0, IBPB) fs.setIf(edx&(1<<27) != 0, STIBP) + fs.setIf(edx&(1<<28) != 0, FLUSH_L1D) + fs.setIf(edx&(1<<29) != 0, IA32_ARCH_CAP) + fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP) + fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD) + + // CPUID.(EAX=7, ECX=1).EAX + eax1, _, _, edx1 := cpuidex(7, 1) + fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI) + fs.setIf(eax1&(1<<7) != 0, CMPCCXADD) + fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL) + fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT) + fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT) + fs.setIf(eax1&(1<<22) != 0, HRESET) + fs.setIf(eax1&(1<<23) != 0, AVXIFMA) + fs.setIf(eax1&(1<<26) != 0, LAM) + + // CPUID.(EAX=7, ECX=1).EDX + fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8) + fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT) + fs.setIf(edx1&(1<<14) != 0, PREFETCHI) // Only detect AVX-512 features if XGETBV is supported if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) { @@ -972,9 +1227,6 @@ func support() flagSet { // ecx fs.setIf(ecx&(1<<1) != 0, AVX512VBMI) fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2) - fs.setIf(ecx&(1<<8) != 0, GFNI) - fs.setIf(ecx&(1<<9) != 0, VAES) - fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ) fs.setIf(ecx&(1<<11) != 0, AVX512VNNI) fs.setIf(ecx&(1<<12) != 0, AVX512BITALG) fs.setIf(ecx&(1<<14) != 0, AVX512VPOPCNTDQ) @@ -986,30 +1238,73 @@ func support() flagSet { fs.setIf(edx&(1<<25) != 0, AMXINT8) // eax1 = CPUID.(EAX=7, ECX=1).EAX fs.setIf(eax1&(1<<5) != 0, AVX512BF16) + fs.setIf(eax1&(1<<19) != 0, WRMSRNS) + fs.setIf(eax1&(1<<21) != 0, AMXFP16) + fs.setIf(eax1&(1<<27) != 0, MSRLIST) } } + + // CPUID.(EAX=7, ECX=2) + _, _, _, edx = cpuidex(7, 2) + fs.setIf(edx&(1<<0) != 0, PSFD) + fs.setIf(edx&(1<<1) != 0, IDPRED_CTRL) + fs.setIf(edx&(1<<2) != 0, RRSBA_CTRL) + fs.setIf(edx&(1<<4) != 0, BHI_CTRL) + fs.setIf(edx&(1<<5) != 0, MCDT_NO) + } + // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1) + // EAX + // Bit 00: XSAVEOPT is available. + // Bit 01: Supports XSAVEC and the compacted form of XRSTOR if set. + // Bit 02: Supports XGETBV with ECX = 1 if set. + // Bit 03: Supports XSAVES/XRSTORS and IA32_XSS if set. + // Bits 31 - 04: Reserved. + // EBX + // Bits 31 - 00: The size in bytes of the XSAVE area containing all states enabled by XCRO | IA32_XSS. + // ECX + // Bits 31 - 00: Reports the supported bits of the lower 32 bits of the IA32_XSS MSR. IA32_XSS[n] can be set to 1 only if ECX[n] is 1. + // EDX? + // Bits 07 - 00: Used for XCR0. Bit 08: PT state. Bit 09: Used for XCR0. Bits 12 - 10: Reserved. Bit 13: HWP state. Bits 31 - 14: Reserved. + if mfi >= 0xd { + if fs.inSet(XSAVE) { + eax, _, _, _ := cpuidex(0xd, 1) + fs.setIf(eax&(1<<0) != 0, XSAVEOPT) + fs.setIf(eax&(1<<1) != 0, XSAVEC) + fs.setIf(eax&(1<<2) != 0, XGETBV1) + fs.setIf(eax&(1<<3) != 0, XSAVES) + } + } if maxExtendedFunction() >= 0x80000001 { _, _, c, d := cpuid(0x80000001) if (c & (1 << 5)) != 0 { fs.set(LZCNT) fs.set(POPCNT) } - fs.setIf((c&(1<<10)) != 0, IBS) - fs.setIf((d&(1<<31)) != 0, AMD3DNOW) - fs.setIf((d&(1<<30)) != 0, AMD3DNOWEXT) - fs.setIf((d&(1<<23)) != 0, MMX) - fs.setIf((d&(1<<22)) != 0, MMXEXT) + // ECX + fs.setIf((c&(1<<0)) != 0, LAHF) + fs.setIf((c&(1<<2)) != 0, SVM) fs.setIf((c&(1<<6)) != 0, SSE4A) + fs.setIf((c&(1<<10)) != 0, IBS) + fs.setIf((c&(1<<22)) != 0, TOPEXT) + + // EDX + fs.setIf(d&(1<<11) != 0, SYSCALL) fs.setIf(d&(1<<20) != 0, NX) + fs.setIf(d&(1<<22) != 0, MMXEXT) + fs.setIf(d&(1<<23) != 0, MMX) + fs.setIf(d&(1<<24) != 0, FXSR) + fs.setIf(d&(1<<25) != 0, FXSROPT) fs.setIf(d&(1<<27) != 0, RDTSCP) + fs.setIf(d&(1<<30) != 0, AMD3DNOWEXT) + fs.setIf(d&(1<<31) != 0, AMD3DNOW) /* XOP and FMA4 use the AVX instruction coding scheme, so they can't be * used unless the OS has AVX support. */ if fs.inSet(AVX) { - fs.setIf((c&0x00000800) != 0, XOP) - fs.setIf((c&0x00010000) != 0, FMA4) + fs.setIf((c&(1<<11)) != 0, XOP) + fs.setIf((c&(1<<16)) != 0, FMA4) } } @@ -1023,15 +1318,48 @@ func support() flagSet { if maxExtendedFunction() >= 0x80000008 { _, b, _, _ := cpuid(0x80000008) + fs.setIf(b&(1<<28) != 0, PSFD) + fs.setIf(b&(1<<27) != 0, CPPC) + fs.setIf(b&(1<<24) != 0, SPEC_CTRL_SSBD) + fs.setIf(b&(1<<23) != 0, PPIN) + fs.setIf(b&(1<<21) != 0, TLB_FLUSH_NESTED) + fs.setIf(b&(1<<20) != 0, EFER_LMSLE_UNS) + fs.setIf(b&(1<<19) != 0, IBRS_PROVIDES_SMP) + fs.setIf(b&(1<<18) != 0, IBRS_PREFERRED) + fs.setIf(b&(1<<17) != 0, STIBP_ALWAYSON) + fs.setIf(b&(1<<15) != 0, STIBP) + fs.setIf(b&(1<<14) != 0, IBRS) + fs.setIf((b&(1<<13)) != 0, INT_WBINVD) + fs.setIf(b&(1<<12) != 0, IBPB) fs.setIf((b&(1<<9)) != 0, WBNOINVD) fs.setIf((b&(1<<8)) != 0, MCOMMIT) - fs.setIf((b&(1<<13)) != 0, INT_WBINVD) fs.setIf((b&(1<<4)) != 0, RDPRU) fs.setIf((b&(1<<3)) != 0, INVLPGB) fs.setIf((b&(1<<1)) != 0, MSRIRC) fs.setIf((b&(1<<0)) != 0, CLZERO) } + if fs.inSet(SVM) && maxExtendedFunction() >= 0x8000000A { + _, _, _, edx := cpuid(0x8000000A) + fs.setIf((edx>>0)&1 == 1, SVMNP) + fs.setIf((edx>>1)&1 == 1, LBRVIRT) + fs.setIf((edx>>2)&1 == 1, SVML) + fs.setIf((edx>>3)&1 == 1, NRIPS) + fs.setIf((edx>>4)&1 == 1, TSCRATEMSR) + fs.setIf((edx>>5)&1 == 1, VMCBCLEAN) + fs.setIf((edx>>6)&1 == 1, SVMFBASID) + fs.setIf((edx>>7)&1 == 1, SVMDA) + fs.setIf((edx>>10)&1 == 1, SVMPF) + fs.setIf((edx>>12)&1 == 1, SVMPFT) + } + + if maxExtendedFunction() >= 0x8000001a { + eax, _, _, _ := cpuid(0x8000001a) + fs.setIf((eax>>0)&1 == 1, FP128) + fs.setIf((eax>>1)&1 == 1, MOVU) + fs.setIf((eax>>2)&1 == 1, FP256) + } + if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) { eax, _, _, _ := cpuid(0x8000001b) fs.setIf((eax>>0)&1 == 1, IBSFFV) @@ -1042,6 +1370,35 @@ func support() flagSet { fs.setIf((eax>>5)&1 == 1, IBSBRNTRGT) fs.setIf((eax>>6)&1 == 1, IBSOPCNTEXT) fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK) + fs.setIf((eax>>8)&1 == 1, IBS_OPFUSE) + fs.setIf((eax>>9)&1 == 1, IBS_FETCH_CTLX) + fs.setIf((eax>>10)&1 == 1, IBS_OPDATA4) // Doc says "Fixed,0. IBS op data 4 MSR supported", but assuming they mean 1. + fs.setIf((eax>>11)&1 == 1, IBS_ZEN4) + } + + if maxExtendedFunction() >= 0x8000001f && vend == AMD { + a, _, _, _ := cpuid(0x8000001f) + fs.setIf((a>>0)&1 == 1, SME) + fs.setIf((a>>1)&1 == 1, SEV) + fs.setIf((a>>2)&1 == 1, MSR_PAGEFLUSH) + fs.setIf((a>>3)&1 == 1, SEV_ES) + fs.setIf((a>>4)&1 == 1, SEV_SNP) + fs.setIf((a>>5)&1 == 1, VMPL) + fs.setIf((a>>10)&1 == 1, SME_COHERENT) + fs.setIf((a>>11)&1 == 1, SEV_64BIT) + fs.setIf((a>>12)&1 == 1, SEV_RESTRICTED) + fs.setIf((a>>13)&1 == 1, SEV_ALTERNATIVE) + fs.setIf((a>>14)&1 == 1, SEV_DEBUGSWAP) + fs.setIf((a>>15)&1 == 1, IBS_PREVENTHOST) + fs.setIf((a>>16)&1 == 1, VTE) + fs.setIf((a>>24)&1 == 1, VMSA_REGPROT) + } + + if mfi >= 0x21 { + // Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21). + _, ebx, ecx, edx := cpuid(0x21) + identity := string(valAsString(ebx, edx, ecx)) + fs.setIf(identity == "IntelTDX ", TDX_GUEST) } return fs diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go index 9bf9f77f3..9a53504a0 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go @@ -1,6 +1,7 @@ // Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. -//+build arm64,!gccgo,!noasm,!appengine +//go:build arm64 && !gccgo && !noasm && !appengine +// +build arm64,!gccgo,!noasm,!appengine package cpuid diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go index e9c8606ab..9636c2bc1 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go @@ -1,6 +1,7 @@ // Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. -//+build !amd64,!386,!arm64 gccgo noasm appengine +//go:build (!amd64 && !386 && !arm64) || gccgo || noasm || appengine +// +build !amd64,!386,!arm64 gccgo noasm appengine package cpuid diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index 367c35c88..c946824ec 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -1,6 +1,7 @@ // Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. -//+build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine +//go:build (386 && !gccgo && !noasm && !appengine) || (amd64 && !gccgo && !noasm && !appengine) +// +build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine package cpuid @@ -23,7 +24,7 @@ func addInfo(c *CPUInfo, safe bool) { c.maxExFunc = maxExtendedFunction() c.BrandName = brandName() c.CacheLine = cacheLine() - c.Family, c.Model = familyModel() + c.Family, c.Model, c.Stepping = familyModel() c.featureSet = support() c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC)) c.ThreadsPerCore = threadsPerCore() diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index b1fe42e46..024c706af 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -13,126 +13,213 @@ func _() { _ = x[AMD3DNOW-3] _ = x[AMD3DNOWEXT-4] _ = x[AMXBF16-5] - _ = x[AMXINT8-6] - _ = x[AMXTILE-7] - _ = x[AVX-8] - _ = x[AVX2-9] - _ = x[AVX512BF16-10] - _ = x[AVX512BITALG-11] - _ = x[AVX512BW-12] - _ = x[AVX512CD-13] - _ = x[AVX512DQ-14] - _ = x[AVX512ER-15] - _ = x[AVX512F-16] - _ = x[AVX512FP16-17] - _ = x[AVX512IFMA-18] - _ = x[AVX512PF-19] - _ = x[AVX512VBMI-20] - _ = x[AVX512VBMI2-21] - _ = x[AVX512VL-22] - _ = x[AVX512VNNI-23] - _ = x[AVX512VP2INTERSECT-24] - _ = x[AVX512VPOPCNTDQ-25] - _ = x[AVXSLOW-26] - _ = x[BMI1-27] - _ = x[BMI2-28] - _ = x[CLDEMOTE-29] - _ = x[CLMUL-30] - _ = x[CLZERO-31] - _ = x[CMOV-32] - _ = x[CPBOOST-33] - _ = x[CX16-34] - _ = x[ENQCMD-35] - _ = x[ERMS-36] - _ = x[F16C-37] - _ = x[FMA3-38] - _ = x[FMA4-39] - _ = x[GFNI-40] - _ = x[HLE-41] - _ = x[HTT-42] - _ = x[HWA-43] - _ = x[HYPERVISOR-44] - _ = x[IBPB-45] - _ = x[IBS-46] - _ = x[IBSBRNTRGT-47] - _ = x[IBSFETCHSAM-48] - _ = x[IBSFFV-49] - _ = x[IBSOPCNT-50] - _ = x[IBSOPCNTEXT-51] - _ = x[IBSOPSAM-52] - _ = x[IBSRDWROPCNT-53] - _ = x[IBSRIPINVALIDCHK-54] - _ = x[INT_WBINVD-55] - _ = x[INVLPGB-56] - _ = x[LZCNT-57] - _ = x[MCAOVERFLOW-58] - _ = x[MCOMMIT-59] - _ = x[MMX-60] - _ = x[MMXEXT-61] - _ = x[MOVDIR64B-62] - _ = x[MOVDIRI-63] - _ = x[MPX-64] - _ = x[MSRIRC-65] - _ = x[NX-66] - _ = x[POPCNT-67] - _ = x[RDPRU-68] - _ = x[RDRAND-69] - _ = x[RDSEED-70] - _ = x[RDTSCP-71] - _ = x[RTM-72] - _ = x[RTM_ALWAYS_ABORT-73] - _ = x[SERIALIZE-74] - _ = x[SGX-75] - _ = x[SGXLC-76] - _ = x[SHA-77] - _ = x[SSE-78] - _ = x[SSE2-79] - _ = x[SSE3-80] - _ = x[SSE4-81] - _ = x[SSE42-82] - _ = x[SSE4A-83] - _ = x[SSSE3-84] - _ = x[STIBP-85] - _ = x[SUCCOR-86] - _ = x[TBM-87] - _ = x[TSXLDTRK-88] - _ = x[VAES-89] - _ = x[VMX-90] - _ = x[VPCLMULQDQ-91] - _ = x[WAITPKG-92] - _ = x[WBNOINVD-93] - _ = x[XOP-94] - _ = x[AESARM-95] - _ = x[ARMCPUID-96] - _ = x[ASIMD-97] - _ = x[ASIMDDP-98] - _ = x[ASIMDHP-99] - _ = x[ASIMDRDM-100] - _ = x[ATOMICS-101] - _ = x[CRC32-102] - _ = x[DCPOP-103] - _ = x[EVTSTRM-104] - _ = x[FCMA-105] - _ = x[FP-106] - _ = x[FPHP-107] - _ = x[GPA-108] - _ = x[JSCVT-109] - _ = x[LRCPC-110] - _ = x[PMULL-111] - _ = x[SHA1-112] - _ = x[SHA2-113] - _ = x[SHA3-114] - _ = x[SHA512-115] - _ = x[SM3-116] - _ = x[SM4-117] - _ = x[SVE-118] - _ = x[lastID-119] + _ = x[AMXFP16-6] + _ = x[AMXINT8-7] + _ = x[AMXTILE-8] + _ = x[AVX-9] + _ = x[AVX2-10] + _ = x[AVX512BF16-11] + _ = x[AVX512BITALG-12] + _ = x[AVX512BW-13] + _ = x[AVX512CD-14] + _ = x[AVX512DQ-15] + _ = x[AVX512ER-16] + _ = x[AVX512F-17] + _ = x[AVX512FP16-18] + _ = x[AVX512IFMA-19] + _ = x[AVX512PF-20] + _ = x[AVX512VBMI-21] + _ = x[AVX512VBMI2-22] + _ = x[AVX512VL-23] + _ = x[AVX512VNNI-24] + _ = x[AVX512VP2INTERSECT-25] + _ = x[AVX512VPOPCNTDQ-26] + _ = x[AVXIFMA-27] + _ = x[AVXNECONVERT-28] + _ = x[AVXSLOW-29] + _ = x[AVXVNNI-30] + _ = x[AVXVNNIINT8-31] + _ = x[BHI_CTRL-32] + _ = x[BMI1-33] + _ = x[BMI2-34] + _ = x[CETIBT-35] + _ = x[CETSS-36] + _ = x[CLDEMOTE-37] + _ = x[CLMUL-38] + _ = x[CLZERO-39] + _ = x[CMOV-40] + _ = x[CMPCCXADD-41] + _ = x[CMPSB_SCADBS_SHORT-42] + _ = x[CMPXCHG8-43] + _ = x[CPBOOST-44] + _ = x[CPPC-45] + _ = x[CX16-46] + _ = x[EFER_LMSLE_UNS-47] + _ = x[ENQCMD-48] + _ = x[ERMS-49] + _ = x[F16C-50] + _ = x[FLUSH_L1D-51] + _ = x[FMA3-52] + _ = x[FMA4-53] + _ = x[FP128-54] + _ = x[FP256-55] + _ = x[FSRM-56] + _ = x[FXSR-57] + _ = x[FXSROPT-58] + _ = x[GFNI-59] + _ = x[HLE-60] + _ = x[HRESET-61] + _ = x[HTT-62] + _ = x[HWA-63] + _ = x[HYBRID_CPU-64] + _ = x[HYPERVISOR-65] + _ = x[IA32_ARCH_CAP-66] + _ = x[IA32_CORE_CAP-67] + _ = x[IBPB-68] + _ = x[IBRS-69] + _ = x[IBRS_PREFERRED-70] + _ = x[IBRS_PROVIDES_SMP-71] + _ = x[IBS-72] + _ = x[IBSBRNTRGT-73] + _ = x[IBSFETCHSAM-74] + _ = x[IBSFFV-75] + _ = x[IBSOPCNT-76] + _ = x[IBSOPCNTEXT-77] + _ = x[IBSOPSAM-78] + _ = x[IBSRDWROPCNT-79] + _ = x[IBSRIPINVALIDCHK-80] + _ = x[IBS_FETCH_CTLX-81] + _ = x[IBS_OPDATA4-82] + _ = x[IBS_OPFUSE-83] + _ = x[IBS_PREVENTHOST-84] + _ = x[IBS_ZEN4-85] + _ = x[IDPRED_CTRL-86] + _ = x[INT_WBINVD-87] + _ = x[INVLPGB-88] + _ = x[LAHF-89] + _ = x[LAM-90] + _ = x[LBRVIRT-91] + _ = x[LZCNT-92] + _ = x[MCAOVERFLOW-93] + _ = x[MCDT_NO-94] + _ = x[MCOMMIT-95] + _ = x[MD_CLEAR-96] + _ = x[MMX-97] + _ = x[MMXEXT-98] + _ = x[MOVBE-99] + _ = x[MOVDIR64B-100] + _ = x[MOVDIRI-101] + _ = x[MOVSB_ZL-102] + _ = x[MOVU-103] + _ = x[MPX-104] + _ = x[MSRIRC-105] + _ = x[MSRLIST-106] + _ = x[MSR_PAGEFLUSH-107] + _ = x[NRIPS-108] + _ = x[NX-109] + _ = x[OSXSAVE-110] + _ = x[PCONFIG-111] + _ = x[POPCNT-112] + _ = x[PPIN-113] + _ = x[PREFETCHI-114] + _ = x[PSFD-115] + _ = x[RDPRU-116] + _ = x[RDRAND-117] + _ = x[RDSEED-118] + _ = x[RDTSCP-119] + _ = x[RRSBA_CTRL-120] + _ = x[RTM-121] + _ = x[RTM_ALWAYS_ABORT-122] + _ = x[SERIALIZE-123] + _ = x[SEV-124] + _ = x[SEV_64BIT-125] + _ = x[SEV_ALTERNATIVE-126] + _ = x[SEV_DEBUGSWAP-127] + _ = x[SEV_ES-128] + _ = x[SEV_RESTRICTED-129] + _ = x[SEV_SNP-130] + _ = x[SGX-131] + _ = x[SGXLC-132] + _ = x[SHA-133] + _ = x[SME-134] + _ = x[SME_COHERENT-135] + _ = x[SPEC_CTRL_SSBD-136] + _ = x[SRBDS_CTRL-137] + _ = x[SSE-138] + _ = x[SSE2-139] + _ = x[SSE3-140] + _ = x[SSE4-141] + _ = x[SSE42-142] + _ = x[SSE4A-143] + _ = x[SSSE3-144] + _ = x[STIBP-145] + _ = x[STIBP_ALWAYSON-146] + _ = x[STOSB_SHORT-147] + _ = x[SUCCOR-148] + _ = x[SVM-149] + _ = x[SVMDA-150] + _ = x[SVMFBASID-151] + _ = x[SVML-152] + _ = x[SVMNP-153] + _ = x[SVMPF-154] + _ = x[SVMPFT-155] + _ = x[SYSCALL-156] + _ = x[SYSEE-157] + _ = x[TBM-158] + _ = x[TDX_GUEST-159] + _ = x[TLB_FLUSH_NESTED-160] + _ = x[TME-161] + _ = x[TOPEXT-162] + _ = x[TSCRATEMSR-163] + _ = x[TSXLDTRK-164] + _ = x[VAES-165] + _ = x[VMCBCLEAN-166] + _ = x[VMPL-167] + _ = x[VMSA_REGPROT-168] + _ = x[VMX-169] + _ = x[VPCLMULQDQ-170] + _ = x[VTE-171] + _ = x[WAITPKG-172] + _ = x[WBNOINVD-173] + _ = x[WRMSRNS-174] + _ = x[X87-175] + _ = x[XGETBV1-176] + _ = x[XOP-177] + _ = x[XSAVE-178] + _ = x[XSAVEC-179] + _ = x[XSAVEOPT-180] + _ = x[XSAVES-181] + _ = x[AESARM-182] + _ = x[ARMCPUID-183] + _ = x[ASIMD-184] + _ = x[ASIMDDP-185] + _ = x[ASIMDHP-186] + _ = x[ASIMDRDM-187] + _ = x[ATOMICS-188] + _ = x[CRC32-189] + _ = x[DCPOP-190] + _ = x[EVTSTRM-191] + _ = x[FCMA-192] + _ = x[FP-193] + _ = x[FPHP-194] + _ = x[GPA-195] + _ = x[JSCVT-196] + _ = x[LRCPC-197] + _ = x[PMULL-198] + _ = x[SHA1-199] + _ = x[SHA2-200] + _ = x[SHA3-201] + _ = x[SHA512-202] + _ = x[SM3-203] + _ = x[SM4-204] + _ = x[SVE-205] + _ = x[lastID-206] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWBMI1BMI2CLDEMOTECLMULCLZEROCMOVCPBOOSTCX16ENQCMDERMSF16CFMA3FMA4GFNIHLEHTTHWAHYPERVISORIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKINT_WBINVDINVLPGBLZCNTMCAOVERFLOWMCOMMITMMXMMXEXTMOVDIR64BMOVDIRIMPXMSRIRCNXPOPCNTRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSERIALIZESGXSGXLCSHASSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSUCCORTBMTSXLDTRKVAESVMXVPCLMULQDQWAITPKGWBNOINVDXOPAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 58, 62, 72, 84, 92, 100, 108, 116, 123, 133, 143, 151, 161, 172, 180, 190, 208, 223, 230, 234, 238, 246, 251, 257, 261, 268, 272, 278, 282, 286, 290, 294, 298, 301, 304, 307, 317, 321, 324, 334, 345, 351, 359, 370, 378, 390, 406, 416, 423, 428, 439, 446, 449, 455, 464, 471, 474, 480, 482, 488, 493, 499, 505, 511, 514, 530, 539, 542, 547, 550, 553, 557, 561, 565, 570, 575, 580, 585, 591, 594, 602, 606, 609, 619, 626, 634, 637, 643, 651, 656, 663, 670, 678, 685, 690, 695, 702, 706, 708, 712, 715, 720, 725, 730, 734, 738, 742, 748, 751, 754, 757, 763} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { diff --git a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go index 8d2cb0368..84b1acd21 100644 --- a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go @@ -2,18 +2,120 @@ package cpuid -import "runtime" +import ( + "runtime" + "strings" + + "golang.org/x/sys/unix" +) func detectOS(c *CPUInfo) bool { + if runtime.GOOS != "ios" { + tryToFillCPUInfoFomSysctl(c) + } // There are no hw.optional sysctl values for the below features on Mac OS 11.0 // to detect their supported state dynamically. Assume the CPU features that // Apple Silicon M1 supports to be available as a minimal set of features // to all Go programs running on darwin/arm64. // TODO: Add more if we know them. c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2) - c.PhysicalCores = runtime.NumCPU() - // For now assuming 1 thread per core... - c.ThreadsPerCore = 1 - c.LogicalCores = c.PhysicalCores + return true } + +func sysctlGetBool(name string) bool { + value, err := unix.SysctlUint32(name) + if err != nil { + return false + } + return value != 0 +} + +func sysctlGetString(name string) string { + value, err := unix.Sysctl(name) + if err != nil { + return "" + } + return value +} + +func sysctlGetInt(unknown int, names ...string) int { + for _, name := range names { + value, err := unix.SysctlUint32(name) + if err != nil { + continue + } + if value != 0 { + return int(value) + } + } + return unknown +} + +func sysctlGetInt64(unknown int, names ...string) int { + for _, name := range names { + value64, err := unix.SysctlUint64(name) + if err != nil { + continue + } + if int(value64) != unknown { + return int(value64) + } + } + return unknown +} + +func setFeature(c *CPUInfo, name string, feature FeatureID) { + c.featureSet.setIf(sysctlGetBool(name), feature) +} +func tryToFillCPUInfoFomSysctl(c *CPUInfo) { + c.BrandName = sysctlGetString("machdep.cpu.brand_string") + + if len(c.BrandName) != 0 { + c.VendorString = strings.Fields(c.BrandName)[0] + } + + c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu") + c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") / + sysctlGetInt(1, "hw.physicalcpu") + c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count") + c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily") + c.Model = sysctlGetInt(0, "machdep.cpu.model") + c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize") + c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize") + c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize") + c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize") + c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize") + + // from https://developer.arm.com/downloads/-/exploration-tools/feature-names-for-a-profile + setFeature(c, "hw.optional.arm.FEAT_AES", AESARM) + setFeature(c, "hw.optional.AdvSIMD", ASIMD) + setFeature(c, "hw.optional.arm.FEAT_DotProd", ASIMDDP) + setFeature(c, "hw.optional.arm.FEAT_RDM", ASIMDRDM) + setFeature(c, "hw.optional.FEAT_CRC32", CRC32) + setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP) + // setFeature(c, "", EVTSTRM) + setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA) + setFeature(c, "hw.optional.arm.FEAT_FP", FP) + setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP) + setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA) + setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT) + setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC) + setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL) + setFeature(c, "hw.optional.arm.FEAT_SHA1", SHA1) + setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2) + setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3) + setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512) + // setFeature(c, "", SM3) + // setFeature(c, "", SM4) + setFeature(c, "hw.optional.arm.FEAT_SVE", SVE) + + // from empirical observation + setFeature(c, "hw.optional.AdvSIMD_HPFPCvt", ASIMDHP) + setFeature(c, "hw.optional.armv8_1_atomics", ATOMICS) + setFeature(c, "hw.optional.floatingpoint", FP) + setFeature(c, "hw.optional.armv8_2_sha3", SHA3) + setFeature(c, "hw.optional.armv8_2_sha512", SHA512) + setFeature(c, "hw.optional.armv8_3_compnum", FCMA) + setFeature(c, "hw.optional.armv8_crc32", CRC32) +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go index 1a951e6ca..8733ba343 100644 --- a/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go @@ -1,8 +1,7 @@ // Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file. -// +build arm64 -// +build !linux -// +build !darwin +//go:build arm64 && !linux && !darwin +// +build arm64,!linux,!darwin package cpuid diff --git a/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go index 4d0b8b465..f8f201b5f 100644 --- a/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go @@ -1,6 +1,7 @@ // Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file. -//+build nounsafe +//go:build nounsafe +// +build nounsafe package cpuid diff --git a/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go index 329800286..92af622eb 100644 --- a/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go @@ -1,6 +1,7 @@ // Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file. -//+build !nounsafe +//go:build !nounsafe +// +build !nounsafe package cpuid diff --git a/vendor/kubedb.dev/apimachinery/apis/autoscaling/v1alpha1/ignite_helpers.go b/vendor/kubedb.dev/apimachinery/apis/autoscaling/v1alpha1/ignite_helpers.go new file mode 100644 index 000000000..9fbea081e --- /dev/null +++ b/vendor/kubedb.dev/apimachinery/apis/autoscaling/v1alpha1/ignite_helpers.go @@ -0,0 +1,67 @@ +/* +Copyright AppsCode Inc. and Contributors + +Licensed under the Apache License, Version 2.0 (the "License"); +you may not use this file except in compliance with the License. +You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + +Unless required by applicable law or agreed to in writing, software +distributed under the License is distributed on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +See the License for the specific language governing permissions and +limitations under the License. +*/ + +package v1alpha1 + +import ( + "fmt" + + "kubedb.dev/apimachinery/apis" + "kubedb.dev/apimachinery/apis/autoscaling" + "kubedb.dev/apimachinery/crds" + + "kmodules.xyz/client-go/apiextensions" +) + +func (r IgniteAutoscaler) CustomResourceDefinition() *apiextensions.CustomResourceDefinition { + return crds.MustCustomResourceDefinition(SchemeGroupVersion.WithResource(ResourcePluralIgniteAutoscaler)) +} + +var _ apis.ResourceInfo = &IgniteAutoscaler{} + +func (p IgniteAutoscaler) ResourceFQN() string { + return fmt.Sprintf("%s.%s", ResourcePluralIgniteAutoscaler, autoscaling.GroupName) +} + +func (p IgniteAutoscaler) ResourceShortCode() string { + return ResourceCodeIgniteAutoscaler +} + +func (p IgniteAutoscaler) ResourceKind() string { + return ResourceKindIgniteAutoscaler +} + +func (p IgniteAutoscaler) ResourceSingular() string { + return ResourceSingularIgniteAutoscaler +} + +func (p IgniteAutoscaler) ResourcePlural() string { + return ResourcePluralIgniteAutoscaler +} + +func (p IgniteAutoscaler) ValidateSpecs() error { + return nil +} + +var _ StatusAccessor = &IgniteAutoscaler{} + +func (e *IgniteAutoscaler) GetStatus() AutoscalerStatus { + return e.Status +} + +func (e *IgniteAutoscaler) SetStatus(s AutoscalerStatus) { + e.Status = s +} diff --git a/vendor/kubedb.dev/apimachinery/apis/autoscaling/v1alpha1/ignite_types.go b/vendor/kubedb.dev/apimachinery/apis/autoscaling/v1alpha1/ignite_types.go new file mode 100644 index 000000000..022aa5aca --- /dev/null +++ b/vendor/kubedb.dev/apimachinery/apis/autoscaling/v1alpha1/ignite_types.go @@ -0,0 +1,91 @@ +/* +Copyright AppsCode Inc. and Contributors + +Licensed under the Apache License, Version 2.0 (the "License"); +you may not use this file except in compliance with the License. +You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + +Unless required by applicable law or agreed to in writing, software +distributed under the License is distributed on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +See the License for the specific language governing permissions and +limitations under the License. +*/ + +package v1alpha1 + +import ( + opsapi "kubedb.dev/apimachinery/apis/ops/v1alpha1" + + core "k8s.io/api/core/v1" + metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" +) + +const ( + ResourceCodeIgniteAutoscaler = "igscaler" + ResourceKindIgniteAutoscaler = "IgniteAutoscaler" + ResourceSingularIgniteAutoscaler = "igniteautoscaler" + ResourcePluralIgniteAutoscaler = "igniteautoscalers" +) + +// +genclient +// +k8s:openapi-gen=true +// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object + +// +kubebuilder:object:root=true +// +kubebuilder:resource:path=igniteautoscalers,singular=igniteautoscaler,shortName=igscaler,categories={autoscaler,kubedb,appscode} +// +kubebuilder:subresource:status +type IgniteAutoscaler struct { + metav1.TypeMeta `json:",inline"` + // Standard object metadata. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#metadata + // +optional + metav1.ObjectMeta `json:"metadata,omitempty"` + + // Specification of the behavior of the autoscaler. + // More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#spec-and-status. + Spec IgniteAutoscalerSpec `json:"spec"` + + // Current information about the autoscaler. + // +optional + Status AutoscalerStatus `json:"status,omitempty"` +} + +type IgniteAutoscalerSpec struct { + DatabaseRef *core.LocalObjectReference `json:"databaseRef"` + + // OpsRequestOptions will be used to control the behaviour of ops-manager + OpsRequestOptions *IgniteOpsrequestOptions `json:"opsRequestOptions,omitempty"` + + Compute *IgniteComputeAutoscalerSpec `json:"compute,omitempty"` + Storage *IgniteStorageAutoscalerSpec `json:"storage,omitempty"` +} + +type IgniteComputeAutoscalerSpec struct { + // +optional + NodeTopology *NodeTopology `json:"nodeTopology,omitempty"` + + Ignite *ComputeAutoscalerSpec `json:"ignite,omitempty"` +} + +type IgniteStorageAutoscalerSpec struct { + Ignite *StorageAutoscalerSpec `json:"ignite,omitempty"` +} + +type IgniteOpsrequestOptions struct { + // Timeout for each step of the ops request in second. If a step doesn't finish within the specified timeout, the ops request will result in failure. + Timeout *metav1.Duration `json:"timeout,omitempty"` + + // ApplyOption is to control the execution of OpsRequest depending on the database state. + // +kubebuilder:default="IfReady" + Apply opsapi.ApplyOption `json:"apply,omitempty"` +} + +// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object +type IgniteAutoscalerList struct { + metav1.TypeMeta `json:",inline"` + // +optional + metav1.ListMeta `json:"metadata,omitempty"` + Items []IgniteAutoscaler `json:"items"` +} diff --git a/vendor/kubedb.dev/apimachinery/apis/autoscaling/v1alpha1/openapi_generated.go b/vendor/kubedb.dev/apimachinery/apis/autoscaling/v1alpha1/openapi_generated.go index fd1e8283f..d28f4e680 100644 --- a/vendor/kubedb.dev/apimachinery/apis/autoscaling/v1alpha1/openapi_generated.go +++ b/vendor/kubedb.dev/apimachinery/apis/autoscaling/v1alpha1/openapi_generated.go @@ -551,6 +551,12 @@ func GetOpenAPIDefinitions(ref common.ReferenceCallback) map[string]common.OpenA "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.HazelcastOpsrequestOptions": schema_apimachinery_apis_autoscaling_v1alpha1_HazelcastOpsrequestOptions(ref), "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.HazelcastStorageAutoscalerSpec": schema_apimachinery_apis_autoscaling_v1alpha1_HazelcastStorageAutoscalerSpec(ref), "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.HistogramCheckpoint": schema_apimachinery_apis_autoscaling_v1alpha1_HistogramCheckpoint(ref), + "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteAutoscaler": schema_apimachinery_apis_autoscaling_v1alpha1_IgniteAutoscaler(ref), + "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteAutoscalerList": schema_apimachinery_apis_autoscaling_v1alpha1_IgniteAutoscalerList(ref), + "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteAutoscalerSpec": schema_apimachinery_apis_autoscaling_v1alpha1_IgniteAutoscalerSpec(ref), + "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteComputeAutoscalerSpec": schema_apimachinery_apis_autoscaling_v1alpha1_IgniteComputeAutoscalerSpec(ref), + "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteOpsrequestOptions": schema_apimachinery_apis_autoscaling_v1alpha1_IgniteOpsrequestOptions(ref), + "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteStorageAutoscalerSpec": schema_apimachinery_apis_autoscaling_v1alpha1_IgniteStorageAutoscalerSpec(ref), "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.KafkaAutoscaler": schema_apimachinery_apis_autoscaling_v1alpha1_KafkaAutoscaler(ref), "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.KafkaAutoscalerList": schema_apimachinery_apis_autoscaling_v1alpha1_KafkaAutoscalerList(ref), "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.KafkaAutoscalerSpec": schema_apimachinery_apis_autoscaling_v1alpha1_KafkaAutoscalerSpec(ref), @@ -28004,6 +28010,210 @@ func schema_apimachinery_apis_autoscaling_v1alpha1_HistogramCheckpoint(ref commo } } +func schema_apimachinery_apis_autoscaling_v1alpha1_IgniteAutoscaler(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object metadata. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "Specification of the behavior of the autoscaler. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#spec-and-status.", + Default: map[string]interface{}{}, + Ref: ref("kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteAutoscalerSpec"), + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Current information about the autoscaler.", + Default: map[string]interface{}{}, + Ref: ref("kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.AutoscalerStatus"), + }, + }, + }, + Required: []string{"spec"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta", "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.AutoscalerStatus", "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteAutoscalerSpec"}, + } +} + +func schema_apimachinery_apis_autoscaling_v1alpha1_IgniteAutoscalerList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteAutoscaler"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta", "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteAutoscaler"}, + } +} + +func schema_apimachinery_apis_autoscaling_v1alpha1_IgniteAutoscalerSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "databaseRef": { + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + "opsRequestOptions": { + SchemaProps: spec.SchemaProps{ + Description: "OpsRequestOptions will be used to control the behaviour of ops-manager", + Ref: ref("kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteOpsrequestOptions"), + }, + }, + "compute": { + SchemaProps: spec.SchemaProps{ + Ref: ref("kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteComputeAutoscalerSpec"), + }, + }, + "storage": { + SchemaProps: spec.SchemaProps{ + Ref: ref("kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteStorageAutoscalerSpec"), + }, + }, + }, + Required: []string{"databaseRef"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LocalObjectReference", "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteComputeAutoscalerSpec", "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteOpsrequestOptions", "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.IgniteStorageAutoscalerSpec"}, + } +} + +func schema_apimachinery_apis_autoscaling_v1alpha1_IgniteComputeAutoscalerSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "nodeTopology": { + SchemaProps: spec.SchemaProps{ + Ref: ref("kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.NodeTopology"), + }, + }, + "ignite": { + SchemaProps: spec.SchemaProps{ + Ref: ref("kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.ComputeAutoscalerSpec"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.ComputeAutoscalerSpec", "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.NodeTopology"}, + } +} + +func schema_apimachinery_apis_autoscaling_v1alpha1_IgniteOpsrequestOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "timeout": { + SchemaProps: spec.SchemaProps{ + Description: "Timeout for each step of the ops request in second. If a step doesn't finish within the specified timeout, the ops request will result in failure.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Duration"), + }, + }, + "apply": { + SchemaProps: spec.SchemaProps{ + Description: "ApplyOption is to control the execution of OpsRequest depending on the database state.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.Duration"}, + } +} + +func schema_apimachinery_apis_autoscaling_v1alpha1_IgniteStorageAutoscalerSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "ignite": { + SchemaProps: spec.SchemaProps{ + Ref: ref("kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.StorageAutoscalerSpec"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1.StorageAutoscalerSpec"}, + } +} + func schema_apimachinery_apis_autoscaling_v1alpha1_KafkaAutoscaler(ref common.ReferenceCallback) common.OpenAPIDefinition { return common.OpenAPIDefinition{ Schema: spec.Schema{ diff --git a/vendor/kubedb.dev/apimachinery/apis/autoscaling/v1alpha1/zz_generated.deepcopy.go b/vendor/kubedb.dev/apimachinery/apis/autoscaling/v1alpha1/zz_generated.deepcopy.go index 3c0595eda..0b0acf800 100644 --- a/vendor/kubedb.dev/apimachinery/apis/autoscaling/v1alpha1/zz_generated.deepcopy.go +++ b/vendor/kubedb.dev/apimachinery/apis/autoscaling/v1alpha1/zz_generated.deepcopy.go @@ -1535,6 +1535,171 @@ func (in *HistogramCheckpoint) DeepCopy() *HistogramCheckpoint { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *IgniteAutoscaler) DeepCopyInto(out *IgniteAutoscaler) { + *out = *in + out.TypeMeta = in.TypeMeta + in.ObjectMeta.DeepCopyInto(&out.ObjectMeta) + in.Spec.DeepCopyInto(&out.Spec) + in.Status.DeepCopyInto(&out.Status) + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new IgniteAutoscaler. +func (in *IgniteAutoscaler) DeepCopy() *IgniteAutoscaler { + if in == nil { + return nil + } + out := new(IgniteAutoscaler) + in.DeepCopyInto(out) + return out +} + +// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. +func (in *IgniteAutoscaler) DeepCopyObject() runtime.Object { + if c := in.DeepCopy(); c != nil { + return c + } + return nil +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *IgniteAutoscalerList) DeepCopyInto(out *IgniteAutoscalerList) { + *out = *in + out.TypeMeta = in.TypeMeta + in.ListMeta.DeepCopyInto(&out.ListMeta) + if in.Items != nil { + in, out := &in.Items, &out.Items + *out = make([]IgniteAutoscaler, len(*in)) + for i := range *in { + (*in)[i].DeepCopyInto(&(*out)[i]) + } + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new IgniteAutoscalerList. +func (in *IgniteAutoscalerList) DeepCopy() *IgniteAutoscalerList { + if in == nil { + return nil + } + out := new(IgniteAutoscalerList) + in.DeepCopyInto(out) + return out +} + +// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. +func (in *IgniteAutoscalerList) DeepCopyObject() runtime.Object { + if c := in.DeepCopy(); c != nil { + return c + } + return nil +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *IgniteAutoscalerSpec) DeepCopyInto(out *IgniteAutoscalerSpec) { + *out = *in + if in.DatabaseRef != nil { + in, out := &in.DatabaseRef, &out.DatabaseRef + *out = new(corev1.LocalObjectReference) + **out = **in + } + if in.OpsRequestOptions != nil { + in, out := &in.OpsRequestOptions, &out.OpsRequestOptions + *out = new(IgniteOpsrequestOptions) + (*in).DeepCopyInto(*out) + } + if in.Compute != nil { + in, out := &in.Compute, &out.Compute + *out = new(IgniteComputeAutoscalerSpec) + (*in).DeepCopyInto(*out) + } + if in.Storage != nil { + in, out := &in.Storage, &out.Storage + *out = new(IgniteStorageAutoscalerSpec) + (*in).DeepCopyInto(*out) + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new IgniteAutoscalerSpec. +func (in *IgniteAutoscalerSpec) DeepCopy() *IgniteAutoscalerSpec { + if in == nil { + return nil + } + out := new(IgniteAutoscalerSpec) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *IgniteComputeAutoscalerSpec) DeepCopyInto(out *IgniteComputeAutoscalerSpec) { + *out = *in + if in.NodeTopology != nil { + in, out := &in.NodeTopology, &out.NodeTopology + *out = new(NodeTopology) + (*in).DeepCopyInto(*out) + } + if in.Ignite != nil { + in, out := &in.Ignite, &out.Ignite + *out = new(ComputeAutoscalerSpec) + (*in).DeepCopyInto(*out) + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new IgniteComputeAutoscalerSpec. +func (in *IgniteComputeAutoscalerSpec) DeepCopy() *IgniteComputeAutoscalerSpec { + if in == nil { + return nil + } + out := new(IgniteComputeAutoscalerSpec) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *IgniteOpsrequestOptions) DeepCopyInto(out *IgniteOpsrequestOptions) { + *out = *in + if in.Timeout != nil { + in, out := &in.Timeout, &out.Timeout + *out = new(metav1.Duration) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new IgniteOpsrequestOptions. +func (in *IgniteOpsrequestOptions) DeepCopy() *IgniteOpsrequestOptions { + if in == nil { + return nil + } + out := new(IgniteOpsrequestOptions) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *IgniteStorageAutoscalerSpec) DeepCopyInto(out *IgniteStorageAutoscalerSpec) { + *out = *in + if in.Ignite != nil { + in, out := &in.Ignite, &out.Ignite + *out = new(StorageAutoscalerSpec) + (*in).DeepCopyInto(*out) + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new IgniteStorageAutoscalerSpec. +func (in *IgniteStorageAutoscalerSpec) DeepCopy() *IgniteStorageAutoscalerSpec { + if in == nil { + return nil + } + out := new(IgniteStorageAutoscalerSpec) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *KafkaAutoscaler) DeepCopyInto(out *KafkaAutoscaler) { *out = *in diff --git a/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/openapi_generated.go b/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/openapi_generated.go index 5523d0494..40120962a 100644 --- a/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/openapi_generated.go +++ b/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/openapi_generated.go @@ -31154,6 +31154,12 @@ func schema_apimachinery_apis_catalog_v1alpha1_PgBouncerVersionSpec(ref common.R Format: "", }, }, + "gitSyncer": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kubedb.dev/apimachinery/apis/catalog/v1alpha1.GitSyncer"), + }, + }, "securityContext": { SchemaProps: spec.SchemaProps{ Description: "SecurityContext is for the additional config for pgbouncer DB container", @@ -31186,7 +31192,7 @@ func schema_apimachinery_apis_catalog_v1alpha1_PgBouncerVersionSpec(ref common.R }, }, Dependencies: []string{ - "kubedb.dev/apimachinery/apis/catalog/v1alpha1.ChartInfo", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.PgBouncerSecurityContext", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.PgBouncerVersionDatabase", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.PgBouncerVersionExporter", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.UpdateConstraints"}, + "kubedb.dev/apimachinery/apis/catalog/v1alpha1.ChartInfo", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.GitSyncer", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.PgBouncerSecurityContext", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.PgBouncerVersionDatabase", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.PgBouncerVersionExporter", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.UpdateConstraints"}, } } @@ -31397,6 +31403,12 @@ func schema_apimachinery_apis_catalog_v1alpha1_PgpoolVersionSpec(ref common.Refe Format: "", }, }, + "gitSyncer": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kubedb.dev/apimachinery/apis/catalog/v1alpha1.GitSyncer"), + }, + }, "exporter": { SchemaProps: spec.SchemaProps{ Description: "Exporter Image", @@ -31436,7 +31448,7 @@ func schema_apimachinery_apis_catalog_v1alpha1_PgpoolVersionSpec(ref common.Refe }, }, Dependencies: []string{ - "kubedb.dev/apimachinery/apis/catalog/v1alpha1.ChartInfo", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.PgpoolSecurityContext", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.PgpoolVersionExporter", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.PgpoolVersionPgpool", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.UpdateConstraints"}, + "kubedb.dev/apimachinery/apis/catalog/v1alpha1.ChartInfo", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.GitSyncer", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.PgpoolSecurityContext", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.PgpoolVersionExporter", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.PgpoolVersionPgpool", "kubedb.dev/apimachinery/apis/catalog/v1alpha1.UpdateConstraints"}, } } diff --git a/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/pgbouncer_version_types.go b/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/pgbouncer_version_types.go index 8a16eb653..7ebef666b 100644 --- a/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/pgbouncer_version_types.go +++ b/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/pgbouncer_version_types.go @@ -58,6 +58,8 @@ type PgBouncerVersionSpec struct { // Deprecated versions usable but regarded as obsolete and best avoided, typically due to having been superseded. // +optional Deprecated bool `json:"deprecated,omitempty"` + // +optional + GitSyncer GitSyncer `json:"gitSyncer,omitempty"` // SecurityContext is for the additional config for pgbouncer DB container // +optional SecurityContext PgBouncerSecurityContext `json:"securityContext"` diff --git a/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/pgpool_version_types.go b/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/pgpool_version_types.go index 704afa7b9..868369294 100644 --- a/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/pgpool_version_types.go +++ b/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/pgpool_version_types.go @@ -56,6 +56,9 @@ type PgpoolVersionSpec struct { // +optional Deprecated bool `json:"deprecated,omitempty"` + // +optional + GitSyncer GitSyncer `json:"gitSyncer,omitempty"` + // Exporter Image Exporter PgpoolVersionExporter `json:"exporter,omitempty"` diff --git a/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/zz_generated.deepcopy.go b/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/zz_generated.deepcopy.go index 6daacfd07..2d398ee5e 100644 --- a/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/zz_generated.deepcopy.go +++ b/vendor/kubedb.dev/apimachinery/apis/catalog/v1alpha1/zz_generated.deepcopy.go @@ -3063,6 +3063,7 @@ func (in *PgBouncerVersionSpec) DeepCopyInto(out *PgBouncerVersionSpec) { *out = *in out.PgBouncer = in.PgBouncer out.Exporter = in.Exporter + out.GitSyncer = in.GitSyncer in.SecurityContext.DeepCopyInto(&out.SecurityContext) in.UpdateConstraints.DeepCopyInto(&out.UpdateConstraints) if in.UI != nil { @@ -3218,6 +3219,7 @@ func (in *PgpoolVersionPodSecurityPolicy) DeepCopy() *PgpoolVersionPodSecurityPo func (in *PgpoolVersionSpec) DeepCopyInto(out *PgpoolVersionSpec) { *out = *in out.Pgpool = in.Pgpool + out.GitSyncer = in.GitSyncer out.Exporter = in.Exporter in.UpdateConstraints.DeepCopyInto(&out.UpdateConstraints) in.SecurityContext.DeepCopyInto(&out.SecurityContext) diff --git a/vendor/kubedb.dev/apimachinery/apis/kubedb/constants.go b/vendor/kubedb.dev/apimachinery/apis/kubedb/constants.go index 79a1bc874..722fbad44 100644 --- a/vendor/kubedb.dev/apimachinery/apis/kubedb/constants.go +++ b/vendor/kubedb.dev/apimachinery/apis/kubedb/constants.go @@ -666,6 +666,8 @@ const ( PgBouncerConfigSectionPeers = "peers" PgBouncerConfigSectionPgbouncer = "pgbouncer" PgBouncerConfigSectionUsers = "users" + PgBouncerInitVolumePath = "/init-scripts" + PgBouncerInitVolumeName = "init-scripts" // =========================== Pgpool Constants ============================ EnvPostgresUsername = "POSTGRES_USERNAME" @@ -703,6 +705,8 @@ const ( PgpoolCustomHBAConfigFile = "pool_hba.conf" PgpoolCustomPCPFile = "pcp.conf" PGPOOL_INSTALL_DIR = "/opt/pgpool-II" + PgpoolInitVolumePath = "/init-scripts" + PgpoolInitVolumeName = "init-scripts" // ========================================== ZooKeeper Constants =================================================// KubeDBZooKeeperRoleName = "kubedb:zookeeper-version-reader" @@ -1439,7 +1443,7 @@ const ( RabbitMQPeerDiscoveryKey = "cluster_formation.peer_discovery_backend" RabbitMQPeerDiscoveryVal = "rabbit_peer_discovery_k8s" RabbitMQK8sHostKey = "cluster_formation.k8s.host" - RabbitMQK8sHostVal = "kubernetes.default.svc.cluster.local" + RabbitMQK8sHostVal = "kubernetes.default.svc" RabbitMQK8sAddressTypeKey = "cluster_formation.k8s.address_type" RabbitMQK8sAddressTypeVal = "hostname" RabbitMQNodeCleanupWarningKey = "cluster_formation.node_cleanup.only_log_warning" @@ -1770,6 +1774,12 @@ const ( CassandraTLSStoreTypeJKSValue = "JKS" ) +// =========================== Migration Constant ================================= +const ( + StorageMigration = "StorageMigration" + StorageMigrationSucceeded = "StorageMigrationSucceeded" +) + // =========================== Virtual Secrets Constants ============================ const ( @@ -1831,6 +1841,16 @@ var ( }, } + IgniteDefaultResources = core.ResourceRequirements{ + Requests: core.ResourceList{ + core.ResourceCPU: resource.MustParse(".500"), + core.ResourceMemory: resource.MustParse("2Gi"), + }, + Limits: core.ResourceList{ + core.ResourceMemory: resource.MustParse("2Gi"), + }, + } + // CoordinatorDefaultResources must be used for raft backed coordinators to avoid unintended leader switches CoordinatorDefaultResources = core.ResourceRequirements{ Requests: core.ResourceList{ @@ -1976,11 +1996,11 @@ func DefaultArbiter(computeOnly bool) core.ResourceRequirements { } const ( - InitFromGit = "init-from-git" - InitFromGitMountPath = "/git" - GitSecretVolume = "git-secret" - GitSecretMountPath = "/etc/git-secret" - GitSyncContainerName = "git-sync" + InitFromGit = "init-from-git" + DefaultInitFromGitMountPath = "/git" + GitSecretVolume = "git-secret" + GitSecretMountPath = "/etc/git-secret" + GitSyncContainerName = "git-sync" ) const ( diff --git a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/mysql_helpers.go b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/mysql_helpers.go index 35f7b0dbe..d89f33140 100644 --- a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/mysql_helpers.go +++ b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/mysql_helpers.go @@ -185,6 +185,10 @@ func (m MySQL) GetAuthSecretName() string { return meta_util.NameWithSuffix(m.OffshootName(), "auth") } +func (m MySQL) GetStorageClassName() string { + return *m.Spec.Storage.StorageClassName +} + type mysqlApp struct { *MySQL } diff --git a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/openapi_generated.go b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/openapi_generated.go index 4e53c4837..d388e8a49 100644 --- a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/openapi_generated.go +++ b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/openapi_generated.go @@ -29969,6 +29969,12 @@ func schema_apimachinery_apis_kubedb_v1_PgBouncerSpec(ref common.ReferenceCallba Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), }, }, + "init": { + SchemaProps: spec.SchemaProps{ + Description: "Init is used to initialize database", + Ref: ref("kubedb.dev/apimachinery/apis/kubedb/v1.InitSpec"), + }, + }, "monitor": { SchemaProps: spec.SchemaProps{ Description: "Monitor is used monitor database instance.", @@ -30014,7 +30020,7 @@ func schema_apimachinery_apis_kubedb_v1_PgBouncerSpec(ref common.ReferenceCallba }, }, Dependencies: []string{ - "k8s.io/api/core/v1.LocalObjectReference", "kmodules.xyz/client-go/api/v1.HealthCheckSpec", "kmodules.xyz/client-go/api/v1.TLSConfig", "kmodules.xyz/monitoring-agent-api/api/v1.AgentSpec", "kmodules.xyz/offshoot-api/api/v2.PodTemplateSpec", "kubedb.dev/apimachinery/apis/kubedb/v1.AutoOpsSpec", "kubedb.dev/apimachinery/apis/kubedb/v1.ConnectionPoolConfig", "kubedb.dev/apimachinery/apis/kubedb/v1.Database", "kubedb.dev/apimachinery/apis/kubedb/v1.NamedServiceTemplateSpec", "kubedb.dev/apimachinery/apis/kubedb/v1.SecretReference"}, + "k8s.io/api/core/v1.LocalObjectReference", "kmodules.xyz/client-go/api/v1.HealthCheckSpec", "kmodules.xyz/client-go/api/v1.TLSConfig", "kmodules.xyz/monitoring-agent-api/api/v1.AgentSpec", "kmodules.xyz/offshoot-api/api/v2.PodTemplateSpec", "kubedb.dev/apimachinery/apis/kubedb/v1.AutoOpsSpec", "kubedb.dev/apimachinery/apis/kubedb/v1.ConnectionPoolConfig", "kubedb.dev/apimachinery/apis/kubedb/v1.Database", "kubedb.dev/apimachinery/apis/kubedb/v1.InitSpec", "kubedb.dev/apimachinery/apis/kubedb/v1.NamedServiceTemplateSpec", "kubedb.dev/apimachinery/apis/kubedb/v1.SecretReference"}, } } diff --git a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/pgbouncer_types.go b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/pgbouncer_types.go index 7fa8fc5be..ab0b0cdd5 100644 --- a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/pgbouncer_types.go +++ b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/pgbouncer_types.go @@ -87,6 +87,10 @@ type PgBouncerSpec struct { // If specified, this file will be used as configuration file otherwise default configuration file will be used. ConfigSecret *core.LocalObjectReference `json:"configSecret,omitempty"` + // Init is used to initialize database + // +optional + Init *InitSpec `json:"init,omitempty"` + // Monitor is used monitor database instance. // +optional Monitor *mona.AgentSpec `json:"monitor,omitempty"` diff --git a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/postgres_helpers.go b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/postgres_helpers.go index 4e93fd0db..c8917e62d 100644 --- a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/postgres_helpers.go +++ b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/postgres_helpers.go @@ -131,6 +131,10 @@ func (p Postgres) GetAuthSecretName() string { return meta_util.NameWithSuffix(p.OffshootName(), "auth") } +func (p Postgres) GetStorageClassName() string { + return *p.Spec.Storage.StorageClassName +} + func (p Postgres) ServiceName() string { return p.OffshootName() } diff --git a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/zz_generated.deepcopy.go b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/zz_generated.deepcopy.go index 5636aae10..4c134967d 100644 --- a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/zz_generated.deepcopy.go +++ b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1/zz_generated.deepcopy.go @@ -2441,6 +2441,11 @@ func (in *PgBouncerSpec) DeepCopyInto(out *PgBouncerSpec) { *out = new(corev1.LocalObjectReference) **out = **in } + if in.Init != nil { + in, out := &in.Init, &out.Init + *out = new(InitSpec) + (*in).DeepCopyInto(*out) + } if in.Monitor != nil { in, out := &in.Monitor, &out.Monitor *out = new(monitoringagentapiapiv1.AgentSpec) diff --git a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/cassandra_helpers.go b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/cassandra_helpers.go index 1318e7c87..2feaef10a 100644 --- a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/cassandra_helpers.go +++ b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/cassandra_helpers.go @@ -441,14 +441,14 @@ func (r *Cassandra) GetSeed() string { namespace := r.Namespace name := r.Name if r.Spec.Topology == nil { - seed = fmt.Sprintf("%s-0.%s-pods.%s.svc.cluster.local", name, name, namespace) + seed = fmt.Sprintf("%s-0.%s-pods.%s.svc", name, name, namespace) seed = seed + " , " return seed } for _, rack := range r.Spec.Topology.Rack { rackCount := min(*rack.Replicas, 3) for i := int32(0); i < rackCount; i++ { - current_seed := fmt.Sprintf("%s-rack-%s-%d.%s-rack-%s-pods.%s.svc.cluster.local", name, rack.Name, i, name, rack.Name, namespace) + current_seed := fmt.Sprintf("%s-rack-%s-%d.%s-rack-%s-pods.%s.svc", name, rack.Name, i, name, rack.Name, namespace) seed += current_seed + " , " } } diff --git a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/clickhouse_helpers.go b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/clickhouse_helpers.go index fc7f2781c..b817a768c 100644 --- a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/clickhouse_helpers.go +++ b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/clickhouse_helpers.go @@ -315,6 +315,14 @@ func (c *ClickHouse) StatsServiceLabels() map[string]string { return c.ServiceLabels(StatsServiceAlias, map[string]string{kubedb.LabelRole: kubedb.RoleStats}) } +func (r *ClickHouse) SetTLSDefaults() { + if r.Spec.TLS == nil || r.Spec.TLS.IssuerRef == nil { + return + } + r.Spec.TLS.Certificates = kmapi.SetMissingSecretNameForCertificate(r.Spec.TLS.Certificates, string(ClickHouseServerCert), r.CertificateName(ClickHouseServerCert)) + r.Spec.TLS.Certificates = kmapi.SetMissingSecretNameForCertificate(r.Spec.TLS.Certificates, string(ClickHouseClientCert), r.CertificateName(ClickHouseClientCert)) +} + func (c *ClickHouse) SetDefaults(kc client.Client) { var chVersion catalog.ClickHouseVersion err := kc.Get(context.TODO(), types.NamespacedName{ @@ -342,41 +350,38 @@ func (c *ClickHouse) SetDefaults(kc client.Client) { if c.Spec.ClusterTopology != nil { clusterName := map[string]bool{} - clusters := c.Spec.ClusterTopology.Cluster - for index, cluster := range clusters { - if cluster.Shards == nil { - cluster.Shards = pointer.Int32P(1) - } - if cluster.Replicas == nil { - cluster.Replicas = pointer.Int32P(1) - } - if cluster.Name == "" { - for i := 1; ; i += 1 { - cluster.Name = c.OffshootClusterName(strconv.Itoa(i)) - if !clusterName[cluster.Name] { - clusterName[cluster.Name] = true - break - } + cluster := c.Spec.ClusterTopology.Cluster + if cluster.Shards == nil { + cluster.Shards = pointer.Int32P(1) + } + if cluster.Replicas == nil { + cluster.Replicas = pointer.Int32P(1) + } + if cluster.Name == "" { + for i := 1; ; i += 1 { + cluster.Name = c.OffshootClusterName(strconv.Itoa(i)) + if !clusterName[cluster.Name] { + clusterName[cluster.Name] = true + break } - } else { - clusterName[cluster.Name] = true - } - if cluster.StorageType == "" { - cluster.StorageType = StorageTypeDurable } + } else { + clusterName[cluster.Name] = true + } + if cluster.StorageType == "" { + cluster.StorageType = StorageTypeDurable + } - if cluster.PodTemplate == nil { - cluster.PodTemplate = &ofst.PodTemplateSpec{} - } + if cluster.PodTemplate == nil { + cluster.PodTemplate = &ofst.PodTemplateSpec{} + } - dbContainer := coreutil.GetContainerByName(cluster.PodTemplate.Spec.Containers, kubedb.ClickHouseContainerName) - if dbContainer != nil && (dbContainer.Resources.Requests == nil && dbContainer.Resources.Limits == nil) { - apis.SetDefaultResourceLimits(&dbContainer.Resources, kubedb.ClickHouseDefaultResources) - } - c.setDefaultContainerSecurityContext(&chVersion, cluster.PodTemplate) - clusters[index] = cluster + dbContainer := coreutil.GetContainerByName(cluster.PodTemplate.Spec.Containers, kubedb.ClickHouseContainerName) + if dbContainer != nil && (dbContainer.Resources.Requests == nil && dbContainer.Resources.Limits == nil) { + apis.SetDefaultResourceLimits(&dbContainer.Resources, kubedb.ClickHouseDefaultResources) } - c.Spec.ClusterTopology.Cluster = clusters + c.setDefaultContainerSecurityContext(&chVersion, cluster.PodTemplate) + c.Spec.ClusterTopology.Cluster = cluster if c.Spec.ClusterTopology.ClickHouseKeeper != nil && !c.Spec.ClusterTopology.ClickHouseKeeper.ExternallyManaged && c.Spec.ClusterTopology.ClickHouseKeeper.Spec != nil { if c.Spec.ClusterTopology.ClickHouseKeeper.Spec.Replicas == nil { @@ -519,9 +524,7 @@ func (c *ClickHouse) ReplicasAreReady(lister pslister.PetSetLister) (bool, strin // Desire number of petSets expectedItems := 0 if c.Spec.ClusterTopology != nil { - for _, cluster := range c.Spec.ClusterTopology.Cluster { - expectedItems += int(*cluster.Shards) - } + expectedItems += int(*c.Spec.ClusterTopology.Cluster.Shards) if c.Spec.ClusterTopology.ClickHouseKeeper != nil && !c.Spec.ClusterTopology.ClickHouseKeeper.ExternallyManaged { if c.Spec.ClusterTopology.ClickHouseKeeper.Spec.Replicas != nil { expectedItems += 1 diff --git a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/clickhouse_types.go b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/clickhouse_types.go index 86743f891..8ae9e2f52 100644 --- a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/clickhouse_types.go +++ b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/clickhouse_types.go @@ -127,7 +127,7 @@ type ClickHouseSpec struct { type ClusterTopology struct { // Clickhouse Cluster Structure - Cluster []ClusterSpec `json:"cluster,omitempty"` + Cluster ClusterSpec `json:"cluster,omitempty"` // ClickHouse Keeper server name ClickHouseKeeper *ClickHouseKeeper `json:"clickHouseKeeper,omitempty"` diff --git a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/ignite_helpers.go b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/ignite_helpers.go index 68af6c7f6..1c5c18ef5 100644 --- a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/ignite_helpers.go +++ b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/ignite_helpers.go @@ -128,7 +128,7 @@ func (i *Ignite) SetDefaults(kc client.Client) { dbContainer := coreutil.GetContainerByName(i.Spec.PodTemplate.Spec.Containers, kubedb.IgniteContainerName) if dbContainer != nil && (dbContainer.Resources.Requests == nil || dbContainer.Resources.Limits == nil) { - apis.SetDefaultResourceLimits(&dbContainer.Resources, kubedb.DefaultResources) + apis.SetDefaultResourceLimits(&dbContainer.Resources, kubedb.IgniteDefaultResources) } i.SetHealthCheckerDefaults() @@ -274,7 +274,7 @@ func (i *Ignite) PVCName(alias string) string { } func (i *Ignite) Address() string { - return fmt.Sprintf("%v.%v.svc.cluster.local", i.Name, i.Namespace) + return fmt.Sprintf("%v.%v.svc", i.Name, i.Namespace) } type igniteStatsService struct { diff --git a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/openapi_generated.go b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/openapi_generated.go index 64205c448..8dba6fdea 100644 --- a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/openapi_generated.go +++ b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/openapi_generated.go @@ -27087,15 +27087,8 @@ func schema_apimachinery_apis_kubedb_v1alpha2_ClusterTopology(ref common.Referen "cluster": { SchemaProps: spec.SchemaProps{ Description: "Clickhouse Cluster Structure", - Type: []string{"array"}, - Items: &spec.SchemaOrArray{ - Schema: &spec.Schema{ - SchemaProps: spec.SchemaProps{ - Default: map[string]interface{}{}, - Ref: ref("kubedb.dev/apimachinery/apis/kubedb/v1alpha2.ClusterSpec"), - }, - }, - }, + Default: map[string]interface{}{}, + Ref: ref("kubedb.dev/apimachinery/apis/kubedb/v1alpha2.ClusterSpec"), }, }, "clickHouseKeeper": { @@ -33945,6 +33938,12 @@ func schema_apimachinery_apis_kubedb_v1alpha2_PgpoolSpec(ref common.ReferenceCal Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), }, }, + "init": { + SchemaProps: spec.SchemaProps{ + Description: "Init is used to initialize database", + Ref: ref("kubedb.dev/apimachinery/apis/kubedb/v1alpha2.InitSpec"), + }, + }, "podTemplate": { SchemaProps: spec.SchemaProps{ Description: "PodTemplate is an optional configuration for pods used to expose Pgpool", @@ -34016,7 +34015,7 @@ func schema_apimachinery_apis_kubedb_v1alpha2_PgpoolSpec(ref common.ReferenceCal }, }, Dependencies: []string{ - "k8s.io/api/core/v1.LocalObjectReference", "kmodules.xyz/client-go/api/v1.HealthCheckSpec", "kmodules.xyz/client-go/api/v1.ObjectReference", "kmodules.xyz/client-go/api/v1.TLSConfig", "kmodules.xyz/monitoring-agent-api/api/v1.AgentSpec", "kmodules.xyz/offshoot-api/api/v2.PodTemplateSpec", "kubedb.dev/apimachinery/apis/kubedb/v1alpha2.AutoOpsSpec", "kubedb.dev/apimachinery/apis/kubedb/v1alpha2.NamedServiceTemplateSpec", "kubedb.dev/apimachinery/apis/kubedb/v1alpha2.PgpoolConfiguration", "kubedb.dev/apimachinery/apis/kubedb/v1alpha2.SecretReference"}, + "k8s.io/api/core/v1.LocalObjectReference", "kmodules.xyz/client-go/api/v1.HealthCheckSpec", "kmodules.xyz/client-go/api/v1.ObjectReference", "kmodules.xyz/client-go/api/v1.TLSConfig", "kmodules.xyz/monitoring-agent-api/api/v1.AgentSpec", "kmodules.xyz/offshoot-api/api/v2.PodTemplateSpec", "kubedb.dev/apimachinery/apis/kubedb/v1alpha2.AutoOpsSpec", "kubedb.dev/apimachinery/apis/kubedb/v1alpha2.InitSpec", "kubedb.dev/apimachinery/apis/kubedb/v1alpha2.NamedServiceTemplateSpec", "kubedb.dev/apimachinery/apis/kubedb/v1alpha2.PgpoolConfiguration", "kubedb.dev/apimachinery/apis/kubedb/v1alpha2.SecretReference"}, } } diff --git a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/pgpool_types.go b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/pgpool_types.go index c89cf2443..ede2ea281 100644 --- a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/pgpool_types.go +++ b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/pgpool_types.go @@ -80,6 +80,10 @@ type PgpoolSpec struct { // +optional ConfigSecret *core.LocalObjectReference `json:"configSecret,omitempty"` + // Init is used to initialize database + // +optional + Init *InitSpec `json:"init,omitempty"` + // PodTemplate is an optional configuration for pods used to expose Pgpool // +optional PodTemplate *ofst.PodTemplateSpec `json:"podTemplate,omitempty"` diff --git a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/zz_generated.conversion.go b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/zz_generated.conversion.go index 4457c1a65..aa0064197 100644 --- a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/zz_generated.conversion.go +++ b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/zz_generated.conversion.go @@ -3538,6 +3538,7 @@ func autoConvert_v1_PgBouncerSpec_To_v1alpha2_PgBouncerSpec(in *v1.PgBouncerSpec out.ConnectionPool = (*ConnectionPoolConfig)(unsafe.Pointer(in.ConnectionPool)) out.AuthSecret = (*SecretReference)(unsafe.Pointer(in.AuthSecret)) out.ConfigSecret = (*corev1.LocalObjectReference)(unsafe.Pointer(in.ConfigSecret)) + // WARNING: in.Init requires manual conversion: does not exist in peer-type out.Monitor = (*monitoringagentapiapiv1.AgentSpec)(unsafe.Pointer(in.Monitor)) out.SSLMode = PgBouncerSSLMode(in.SSLMode) out.TLS = (*clientgoapiv1.TLSConfig)(unsafe.Pointer(in.TLS)) diff --git a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/zz_generated.deepcopy.go b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/zz_generated.deepcopy.go index 002d0b5d4..7bab18e45 100644 --- a/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/zz_generated.deepcopy.go +++ b/vendor/kubedb.dev/apimachinery/apis/kubedb/v1alpha2/zz_generated.deepcopy.go @@ -732,13 +732,7 @@ func (in *ClusterSpec) DeepCopy() *ClusterSpec { // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *ClusterTopology) DeepCopyInto(out *ClusterTopology) { *out = *in - if in.Cluster != nil { - in, out := &in.Cluster, &out.Cluster - *out = make([]ClusterSpec, len(*in)) - for i := range *in { - (*in)[i].DeepCopyInto(&(*out)[i]) - } - } + in.Cluster.DeepCopyInto(&out.Cluster) if in.ClickHouseKeeper != nil { in, out := &in.ClickHouseKeeper, &out.ClickHouseKeeper *out = new(ClickHouseKeeper) @@ -4820,6 +4814,11 @@ func (in *PgpoolSpec) DeepCopyInto(out *PgpoolSpec) { *out = new(corev1.LocalObjectReference) **out = **in } + if in.Init != nil { + in, out := &in.Init, &out.Init + *out = new(InitSpec) + (*in).DeepCopyInto(*out) + } if in.PodTemplate != nil { in, out := &in.PodTemplate, &out.PodTemplate *out = new(v2.PodTemplateSpec) diff --git a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/clickhouse_ops-types.go b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/clickhouse_ops-types.go index 8e0c351ca..f9f2b9694 100644 --- a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/clickhouse_ops-types.go +++ b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/clickhouse_ops-types.go @@ -18,6 +18,8 @@ limitations under the License. package v1alpha1 import ( + olddbapi "kubedb.dev/apimachinery/apis/kubedb/v1alpha2" + core "k8s.io/api/core/v1" "k8s.io/apimachinery/pkg/api/resource" metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" @@ -71,13 +73,15 @@ type ClickHouseOpsRequestSpec struct { Configuration *ClickHouseCustomConfigurationSpec `json:"configuration,omitempty"` // Timeout for each step of the ops request in second. If a step doesn't finish within the specified timeout, the ops request will result in failure. Timeout *metav1.Duration `json:"timeout,omitempty"` + // Specifies information necessary for configuring TLS + TLS *ClickHouseTLSSpec `json:"tls,omitempty"` // ApplyOption is to control the execution of OpsRequest depending on the database state. // +kubebuilder:default="IfReady" Apply ApplyOption `json:"apply,omitempty"` } -// +kubebuilder:validation:Enum=Restart;VerticalScaling;HorizontalScaling;UpdateVersion;VolumeExpansion;Reconfigure -// ENUM(Restart, VerticalScaling, HorizontalScaling, UpdateVersion, VolumeExpansion, Reconfigure) +// +kubebuilder:validation:Enum=Restart;VerticalScaling;HorizontalScaling;UpdateVersion;VolumeExpansion;Reconfigure;ReconfigureTLS;RotateAuth +// ENUM(Restart, VerticalScaling, HorizontalScaling, UpdateVersion, VolumeExpansion, Reconfigure, ReconfigureTLS, RotateAuth) type ClickHouseOpsRequestType string // ClickHouseUpdateVersionSpec contains the update version information of a clickhouse cluster @@ -114,34 +118,25 @@ type ClickHouseCustomConfigurationSpec struct { RemoveCustomConfig bool `json:"removeCustomConfig,omitempty"` } +// ClickHouseTLSSpec contains necessary information for configuring TLS +type ClickHouseTLSSpec struct { + // SSLVerificationMode specifies how server certificates should be verified + SSLVerificationMode olddbapi.SSLVerificationMode `json:"sslVerificationMode,omitempty"` + // TLSSpec holds the TLS certificate and key configuration. + TLSSpec `json:",inline,omitempty"` +} + // ClickHouseVerticalScalingSpec contains the vertical scaling information of a clickhouse cluster type ClickHouseVerticalScalingSpec struct { - // Resource spec for Standalone node - Standalone *PodResources `json:"standalone,omitempty"` - // List of cluster configurations for ClickHouse when running in cluster mode. - Cluster []*ClickHouseClusterVerticalScalingSpec `json:"cluster,omitempty"` + Node *PodResources `json:"node,omitempty"` } // ClickHouseHorizontalScalingSpec contains the horizontal scaling information of a clickhouse cluster type ClickHouseHorizontalScalingSpec struct { - // List of cluster configurations for ClickHouse when running in cluster mode. - Cluster []*ClickHouseClusterHorizontalScalingSpec `json:"cluster,omitempty"` -} - -type ClickHouseClusterHorizontalScalingSpec struct { - // Name of the ClickHouse cluster to which the vertical scaling configuration applies. - ClusterName string `json:"clusterName,omitempty"` // Number of node Replicas *int32 `json:"replicas,omitempty"` } -type ClickHouseClusterVerticalScalingSpec struct { - // Name of the ClickHouse cluster to which the vertical scaling configuration applies. - ClusterName string `json:"clusterName,omitempty"` - // Resource specifications for the nodes in this ClickHouse cluster. - Node *PodResources `json:"node,omitempty"` -} - // +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object // ClickHouseOpsRequestList is a list of ClickHouseOpsRequests diff --git a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/clickhouse_ops-types_enum.go b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/clickhouse_ops-types_enum.go index 09f1f4cd2..f2395948a 100644 --- a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/clickhouse_ops-types_enum.go +++ b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/clickhouse_ops-types_enum.go @@ -23,6 +23,10 @@ const ( ClickHouseOpsRequestTypeVolumeExpansion ClickHouseOpsRequestType = "VolumeExpansion" // ClickHouseOpsRequestTypeReconfigure is a ClickHouseOpsRequestType of type Reconfigure. ClickHouseOpsRequestTypeReconfigure ClickHouseOpsRequestType = "Reconfigure" + // ClickHouseOpsRequestTypeReconfigureTLS is a ClickHouseOpsRequestType of type ReconfigureTLS. + ClickHouseOpsRequestTypeReconfigureTLS ClickHouseOpsRequestType = "ReconfigureTLS" + // ClickHouseOpsRequestTypeRotateAuth is a ClickHouseOpsRequestType of type RotateAuth. + ClickHouseOpsRequestTypeRotateAuth ClickHouseOpsRequestType = "RotateAuth" ) var ErrInvalidClickHouseOpsRequestType = fmt.Errorf("not a valid ClickHouseOpsRequestType, try [%s]", strings.Join(_ClickHouseOpsRequestTypeNames, ", ")) @@ -34,6 +38,8 @@ var _ClickHouseOpsRequestTypeNames = []string{ string(ClickHouseOpsRequestTypeUpdateVersion), string(ClickHouseOpsRequestTypeVolumeExpansion), string(ClickHouseOpsRequestTypeReconfigure), + string(ClickHouseOpsRequestTypeReconfigureTLS), + string(ClickHouseOpsRequestTypeRotateAuth), } // ClickHouseOpsRequestTypeNames returns a list of possible string values of ClickHouseOpsRequestType. @@ -52,6 +58,8 @@ func ClickHouseOpsRequestTypeValues() []ClickHouseOpsRequestType { ClickHouseOpsRequestTypeUpdateVersion, ClickHouseOpsRequestTypeVolumeExpansion, ClickHouseOpsRequestTypeReconfigure, + ClickHouseOpsRequestTypeReconfigureTLS, + ClickHouseOpsRequestTypeRotateAuth, } } @@ -74,6 +82,8 @@ var _ClickHouseOpsRequestTypeValue = map[string]ClickHouseOpsRequestType{ "UpdateVersion": ClickHouseOpsRequestTypeUpdateVersion, "VolumeExpansion": ClickHouseOpsRequestTypeVolumeExpansion, "Reconfigure": ClickHouseOpsRequestTypeReconfigure, + "ReconfigureTLS": ClickHouseOpsRequestTypeReconfigureTLS, + "RotateAuth": ClickHouseOpsRequestTypeRotateAuth, } // ParseClickHouseOpsRequestType attempts to convert a string to a ClickHouseOpsRequestType. diff --git a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/mysql_ops_types.go b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/mysql_ops_types.go index 30c4d322f..8e02c9e3a 100644 --- a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/mysql_ops_types.go +++ b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/mysql_ops_types.go @@ -76,6 +76,8 @@ type MySQLOpsRequestSpec struct { ReplicationModeTransformation *MySQLReplicationModeTransformSpec `json:"replicationModeTransformation,omitempty"` // Specifies information necessary for restarting database Restart *RestartSpec `json:"restart,omitempty"` + // Specifies information necessary for migrating storageClass or data + Migration *MySQLMigrationSpec `json:"migration,omitempty"` // Timeout for each step of the ops request in second. If a step doesn't finish within the specified timeout, the ops request will result in failure. Timeout *metav1.Duration `json:"timeout,omitempty"` // ApplyOption is to control the execution of OpsRequest depending on the database state. @@ -83,8 +85,8 @@ type MySQLOpsRequestSpec struct { Apply ApplyOption `json:"apply,omitempty"` } -// +kubebuilder:validation:Enum=Upgrade;UpdateVersion;HorizontalScaling;VerticalScaling;VolumeExpansion;Restart;Reconfigure;ReconfigureTLS;RotateAuth;ReplicationModeTransformation -// ENUM(UpdateVersion, HorizontalScaling, VerticalScaling, VolumeExpansion, Restart, Reconfigure, ReconfigureTLS, RotateAuth, ReplicationModeTransformation) +// +kubebuilder:validation:Enum=Upgrade;UpdateVersion;HorizontalScaling;VerticalScaling;VolumeExpansion;Restart;Reconfigure;ReconfigureTLS;RotateAuth;ReplicationModeTransformation;StorageMigration +// ENUM(UpdateVersion, HorizontalScaling, VerticalScaling, VolumeExpansion, Restart, Reconfigure, ReconfigureTLS, RotateAuth, ReplicationModeTransformation, StorageMigration) type MySQLOpsRequestType string // MySQLReplicaReadinessCriteria is the criteria for checking readiness of a MySQL pod @@ -102,6 +104,11 @@ type MySQLHorizontalScalingSpec struct { Member *int32 `json:"member,omitempty"` } +type MySQLMigrationSpec struct { + StorageClassName *string `json:"storageClassName"` + OldPVReclaimPolicy core.PersistentVolumeReclaimPolicy `json:"oldPVReclaimPolicy,omitempty"` +} + type MySQLReplicationModeTransformSpec struct { // Group Replication can be deployed in either "Single-Primary" or "Multi-Primary" mode // +kubebuilder:default=Single-Primary diff --git a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/mysql_ops_types_enum.go b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/mysql_ops_types_enum.go index 66770b10a..955b7ddb3 100644 --- a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/mysql_ops_types_enum.go +++ b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/mysql_ops_types_enum.go @@ -29,6 +29,8 @@ const ( MySQLOpsRequestTypeRotateAuth MySQLOpsRequestType = "RotateAuth" // MySQLOpsRequestTypeReplicationModeTransformation is a MySQLOpsRequestType of type ReplicationModeTransformation. MySQLOpsRequestTypeReplicationModeTransformation MySQLOpsRequestType = "ReplicationModeTransformation" + // MySQLOpsRequestTypeStorageMigration is a MySQLOpsRequestType of type StorageMigration. + MySQLOpsRequestTypeStorageMigration MySQLOpsRequestType = "StorageMigration" ) var ErrInvalidMySQLOpsRequestType = fmt.Errorf("not a valid MySQLOpsRequestType, try [%s]", strings.Join(_MySQLOpsRequestTypeNames, ", ")) @@ -43,6 +45,7 @@ var _MySQLOpsRequestTypeNames = []string{ string(MySQLOpsRequestTypeReconfigureTLS), string(MySQLOpsRequestTypeRotateAuth), string(MySQLOpsRequestTypeReplicationModeTransformation), + string(MySQLOpsRequestTypeStorageMigration), } // MySQLOpsRequestTypeNames returns a list of possible string values of MySQLOpsRequestType. @@ -64,6 +67,7 @@ func MySQLOpsRequestTypeValues() []MySQLOpsRequestType { MySQLOpsRequestTypeReconfigureTLS, MySQLOpsRequestTypeRotateAuth, MySQLOpsRequestTypeReplicationModeTransformation, + MySQLOpsRequestTypeStorageMigration, } } @@ -89,6 +93,7 @@ var _MySQLOpsRequestTypeValue = map[string]MySQLOpsRequestType{ "ReconfigureTLS": MySQLOpsRequestTypeReconfigureTLS, "RotateAuth": MySQLOpsRequestTypeRotateAuth, "ReplicationModeTransformation": MySQLOpsRequestTypeReplicationModeTransformation, + "StorageMigration": MySQLOpsRequestTypeStorageMigration, } // ParseMySQLOpsRequestType attempts to convert a string to a MySQLOpsRequestType. diff --git a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/openapi_generated.go b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/openapi_generated.go index 4613c7033..273abf94d 100644 --- a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/openapi_generated.go +++ b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/openapi_generated.go @@ -512,13 +512,12 @@ func GetOpenAPIDefinitions(ref common.ReferenceCallback) map[string]common.OpenA "kubedb.dev/apimachinery/apis/ops/v1alpha1.CassandraUpdateVersionSpec": schema_apimachinery_apis_ops_v1alpha1_CassandraUpdateVersionSpec(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.CassandraVerticalScalingSpec": schema_apimachinery_apis_ops_v1alpha1_CassandraVerticalScalingSpec(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.CassandraVolumeExpansionSpec": schema_apimachinery_apis_ops_v1alpha1_CassandraVolumeExpansionSpec(ref), - "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseClusterHorizontalScalingSpec": schema_apimachinery_apis_ops_v1alpha1_ClickHouseClusterHorizontalScalingSpec(ref), - "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseClusterVerticalScalingSpec": schema_apimachinery_apis_ops_v1alpha1_ClickHouseClusterVerticalScalingSpec(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseCustomConfigurationSpec": schema_apimachinery_apis_ops_v1alpha1_ClickHouseCustomConfigurationSpec(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseHorizontalScalingSpec": schema_apimachinery_apis_ops_v1alpha1_ClickHouseHorizontalScalingSpec(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseOpsRequest": schema_apimachinery_apis_ops_v1alpha1_ClickHouseOpsRequest(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseOpsRequestList": schema_apimachinery_apis_ops_v1alpha1_ClickHouseOpsRequestList(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseOpsRequestSpec": schema_apimachinery_apis_ops_v1alpha1_ClickHouseOpsRequestSpec(ref), + "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseTLSSpec": schema_apimachinery_apis_ops_v1alpha1_ClickHouseTLSSpec(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseUpdateVersionSpec": schema_apimachinery_apis_ops_v1alpha1_ClickHouseUpdateVersionSpec(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseVerticalScalingSpec": schema_apimachinery_apis_ops_v1alpha1_ClickHouseVerticalScalingSpec(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseVolumeExpansionSpec": schema_apimachinery_apis_ops_v1alpha1_ClickHouseVolumeExpansionSpec(ref), @@ -635,6 +634,7 @@ func GetOpenAPIDefinitions(ref common.ReferenceCallback) map[string]common.OpenA "kubedb.dev/apimachinery/apis/ops/v1alpha1.MongosNode": schema_apimachinery_apis_ops_v1alpha1_MongosNode(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLCustomConfigurationSpec": schema_apimachinery_apis_ops_v1alpha1_MySQLCustomConfigurationSpec(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLHorizontalScalingSpec": schema_apimachinery_apis_ops_v1alpha1_MySQLHorizontalScalingSpec(ref), + "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLMigrationSpec": schema_apimachinery_apis_ops_v1alpha1_MySQLMigrationSpec(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLOpsRequest": schema_apimachinery_apis_ops_v1alpha1_MySQLOpsRequest(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLOpsRequestList": schema_apimachinery_apis_ops_v1alpha1_MySQLOpsRequestList(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLOpsRequestSpec": schema_apimachinery_apis_ops_v1alpha1_MySQLOpsRequestSpec(ref), @@ -679,6 +679,7 @@ func GetOpenAPIDefinitions(ref common.ReferenceCallback) map[string]common.OpenA "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresCustomConfigurationSpec": schema_apimachinery_apis_ops_v1alpha1_PostgresCustomConfigurationSpec(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresForceFailOver": schema_apimachinery_apis_ops_v1alpha1_PostgresForceFailOver(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresHorizontalScalingSpec": schema_apimachinery_apis_ops_v1alpha1_PostgresHorizontalScalingSpec(ref), + "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresMigrationSpec": schema_apimachinery_apis_ops_v1alpha1_PostgresMigrationSpec(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresOpsRequest": schema_apimachinery_apis_ops_v1alpha1_PostgresOpsRequest(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresOpsRequestList": schema_apimachinery_apis_ops_v1alpha1_PostgresOpsRequestList(ref), "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresOpsRequestSpec": schema_apimachinery_apis_ops_v1alpha1_PostgresOpsRequestSpec(ref), @@ -26462,59 +26463,6 @@ func schema_apimachinery_apis_ops_v1alpha1_CassandraVolumeExpansionSpec(ref comm } } -func schema_apimachinery_apis_ops_v1alpha1_ClickHouseClusterHorizontalScalingSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { - return common.OpenAPIDefinition{ - Schema: spec.Schema{ - SchemaProps: spec.SchemaProps{ - Type: []string{"object"}, - Properties: map[string]spec.Schema{ - "clusterName": { - SchemaProps: spec.SchemaProps{ - Description: "Name of the ClickHouse cluster to which the vertical scaling configuration applies.", - Type: []string{"string"}, - Format: "", - }, - }, - "replicas": { - SchemaProps: spec.SchemaProps{ - Description: "Number of node", - Type: []string{"integer"}, - Format: "int32", - }, - }, - }, - }, - }, - } -} - -func schema_apimachinery_apis_ops_v1alpha1_ClickHouseClusterVerticalScalingSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { - return common.OpenAPIDefinition{ - Schema: spec.Schema{ - SchemaProps: spec.SchemaProps{ - Type: []string{"object"}, - Properties: map[string]spec.Schema{ - "clusterName": { - SchemaProps: spec.SchemaProps{ - Description: "Name of the ClickHouse cluster to which the vertical scaling configuration applies.", - Type: []string{"string"}, - Format: "", - }, - }, - "node": { - SchemaProps: spec.SchemaProps{ - Description: "Resource specifications for the nodes in this ClickHouse cluster.", - Ref: ref("kubedb.dev/apimachinery/apis/ops/v1alpha1.PodResources"), - }, - }, - }, - }, - }, - Dependencies: []string{ - "kubedb.dev/apimachinery/apis/ops/v1alpha1.PodResources"}, - } -} - func schema_apimachinery_apis_ops_v1alpha1_ClickHouseCustomConfigurationSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { return common.OpenAPIDefinition{ Schema: spec.Schema{ @@ -26566,24 +26514,16 @@ func schema_apimachinery_apis_ops_v1alpha1_ClickHouseHorizontalScalingSpec(ref c Description: "ClickHouseHorizontalScalingSpec contains the horizontal scaling information of a clickhouse cluster", Type: []string{"object"}, Properties: map[string]spec.Schema{ - "cluster": { + "replicas": { SchemaProps: spec.SchemaProps{ - Description: "List of cluster configurations for ClickHouse when running in cluster mode.", - Type: []string{"array"}, - Items: &spec.SchemaOrArray{ - Schema: &spec.Schema{ - SchemaProps: spec.SchemaProps{ - Ref: ref("kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseClusterHorizontalScalingSpec"), - }, - }, - }, + Description: "Number of node", + Type: []string{"integer"}, + Format: "int32", }, }, }, }, }, - Dependencies: []string{ - "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseClusterHorizontalScalingSpec"}, } } @@ -26752,6 +26692,12 @@ func schema_apimachinery_apis_ops_v1alpha1_ClickHouseOpsRequestSpec(ref common.R Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Duration"), }, }, + "tls": { + SchemaProps: spec.SchemaProps{ + Description: "Specifies information necessary for configuring TLS", + Ref: ref("kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseTLSSpec"), + }, + }, "apply": { SchemaProps: spec.SchemaProps{ Description: "ApplyOption is to control the execution of OpsRequest depending on the database state.", @@ -26764,7 +26710,63 @@ func schema_apimachinery_apis_ops_v1alpha1_ClickHouseOpsRequestSpec(ref common.R }, }, Dependencies: []string{ - "k8s.io/api/core/v1.LocalObjectReference", "k8s.io/apimachinery/pkg/apis/meta/v1.Duration", "kubedb.dev/apimachinery/apis/ops/v1alpha1.AuthSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseCustomConfigurationSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseHorizontalScalingSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseUpdateVersionSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseVerticalScalingSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseVolumeExpansionSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.RestartSpec"}, + "k8s.io/api/core/v1.LocalObjectReference", "k8s.io/apimachinery/pkg/apis/meta/v1.Duration", "kubedb.dev/apimachinery/apis/ops/v1alpha1.AuthSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseCustomConfigurationSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseHorizontalScalingSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseTLSSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseUpdateVersionSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseVerticalScalingSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseVolumeExpansionSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.RestartSpec"}, + } +} + +func schema_apimachinery_apis_ops_v1alpha1_ClickHouseTLSSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ClickHouseTLSSpec contains necessary information for configuring TLS", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "sslVerificationMode": { + SchemaProps: spec.SchemaProps{ + Description: "SSLVerificationMode specifies how server certificates should be verified", + Type: []string{"string"}, + Format: "", + }, + }, + "issuerRef": { + SchemaProps: spec.SchemaProps{ + Description: "IssuerRef is a reference to a Certificate Issuer.", + Ref: ref("k8s.io/api/core/v1.TypedLocalObjectReference"), + }, + }, + "certificates": { + SchemaProps: spec.SchemaProps{ + Description: "Certificate provides server and/or client certificate options used by application pods. These options are passed to a cert-manager Certificate object. xref: https://github.com/jetstack/cert-manager/blob/v0.16.0/pkg/apis/certmanager/v1beta1/types_certificate.go#L82-L162", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/client-go/api/v1.CertificateSpec"), + }, + }, + }, + }, + }, + "rotateCertificates": { + SchemaProps: spec.SchemaProps{ + Description: "RotateCertificates tells operator to initiate certificate rotation", + Type: []string{"boolean"}, + Format: "", + }, + }, + "remove": { + SchemaProps: spec.SchemaProps{ + Description: "Remove tells operator to remove TLS configuration", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.TypedLocalObjectReference", "kmodules.xyz/client-go/api/v1.CertificateSpec"}, } } @@ -26795,30 +26797,16 @@ func schema_apimachinery_apis_ops_v1alpha1_ClickHouseVerticalScalingSpec(ref com Description: "ClickHouseVerticalScalingSpec contains the vertical scaling information of a clickhouse cluster", Type: []string{"object"}, Properties: map[string]spec.Schema{ - "standalone": { - SchemaProps: spec.SchemaProps{ - Description: "Resource spec for Standalone node", - Ref: ref("kubedb.dev/apimachinery/apis/ops/v1alpha1.PodResources"), - }, - }, - "cluster": { + "node": { SchemaProps: spec.SchemaProps{ - Description: "List of cluster configurations for ClickHouse when running in cluster mode.", - Type: []string{"array"}, - Items: &spec.SchemaOrArray{ - Schema: &spec.Schema{ - SchemaProps: spec.SchemaProps{ - Ref: ref("kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseClusterVerticalScalingSpec"), - }, - }, - }, + Ref: ref("kubedb.dev/apimachinery/apis/ops/v1alpha1.PodResources"), }, }, }, }, }, Dependencies: []string{ - "kubedb.dev/apimachinery/apis/ops/v1alpha1.ClickHouseClusterVerticalScalingSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PodResources"}, + "kubedb.dev/apimachinery/apis/ops/v1alpha1.PodResources"}, } } @@ -31417,6 +31405,33 @@ func schema_apimachinery_apis_ops_v1alpha1_MySQLHorizontalScalingSpec(ref common } } +func schema_apimachinery_apis_ops_v1alpha1_MySQLMigrationSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "storageClassName": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "oldPVReclaimPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Possible enum values:\n - `\"Delete\"` means the volume will be deleted from Kubernetes on release from its claim. The volume plugin must support Deletion.\n - `\"Recycle\"` means the volume will be recycled back into the pool of unbound persistent volumes on release from its claim. The volume plugin must support Recycling.\n - `\"Retain\"` means the volume will be left in its current phase (Released) for manual reclamation by the administrator. The default policy is Retain.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Delete", "Recycle", "Retain"}, + }, + }, + }, + Required: []string{"storageClassName"}, + }, + }, + } +} + func schema_apimachinery_apis_ops_v1alpha1_MySQLOpsRequest(ref common.ReferenceCallback) common.OpenAPIDefinition { return common.OpenAPIDefinition{ Schema: spec.Schema{ @@ -31588,6 +31603,12 @@ func schema_apimachinery_apis_ops_v1alpha1_MySQLOpsRequestSpec(ref common.Refere Ref: ref("kubedb.dev/apimachinery/apis/ops/v1alpha1.RestartSpec"), }, }, + "migration": { + SchemaProps: spec.SchemaProps{ + Description: "Specifies information necessary for migrating storageClass or data", + Ref: ref("kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLMigrationSpec"), + }, + }, "timeout": { SchemaProps: spec.SchemaProps{ Description: "Timeout for each step of the ops request in second. If a step doesn't finish within the specified timeout, the ops request will result in failure.", @@ -31606,7 +31627,7 @@ func schema_apimachinery_apis_ops_v1alpha1_MySQLOpsRequestSpec(ref common.Refere }, }, Dependencies: []string{ - "k8s.io/api/core/v1.LocalObjectReference", "k8s.io/apimachinery/pkg/apis/meta/v1.Duration", "kubedb.dev/apimachinery/apis/ops/v1alpha1.AuthSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLCustomConfigurationSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLHorizontalScalingSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLReplicationModeTransformSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLTLSSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLUpdateVersionSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLVerticalScalingSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLVolumeExpansionSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.RestartSpec"}, + "k8s.io/api/core/v1.LocalObjectReference", "k8s.io/apimachinery/pkg/apis/meta/v1.Duration", "kubedb.dev/apimachinery/apis/ops/v1alpha1.AuthSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLCustomConfigurationSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLHorizontalScalingSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLMigrationSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLReplicationModeTransformSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLTLSSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLUpdateVersionSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLVerticalScalingSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.MySQLVolumeExpansionSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.RestartSpec"}, } } @@ -33218,6 +33239,33 @@ func schema_apimachinery_apis_ops_v1alpha1_PostgresHorizontalScalingSpec(ref com } } +func schema_apimachinery_apis_ops_v1alpha1_PostgresMigrationSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "storageClassName": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "oldPVReclaimPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Possible enum values:\n - `\"Delete\"` means the volume will be deleted from Kubernetes on release from its claim. The volume plugin must support Deletion.\n - `\"Recycle\"` means the volume will be recycled back into the pool of unbound persistent volumes on release from its claim. The volume plugin must support Recycling.\n - `\"Retain\"` means the volume will be left in its current phase (Released) for manual reclamation by the administrator. The default policy is Retain.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Delete", "Recycle", "Retain"}, + }, + }, + }, + Required: []string{"storageClassName"}, + }, + }, + } +} + func schema_apimachinery_apis_ops_v1alpha1_PostgresOpsRequest(ref common.ReferenceCallback) common.OpenAPIDefinition { return common.OpenAPIDefinition{ Schema: spec.Schema{ @@ -33401,6 +33449,12 @@ func schema_apimachinery_apis_ops_v1alpha1_PostgresOpsRequestSpec(ref common.Ref Ref: ref("kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresSetRaftKeyPair"), }, }, + "migration": { + SchemaProps: spec.SchemaProps{ + Description: "Specifies information necessary for migrating storageClass or data", + Ref: ref("kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresMigrationSpec"), + }, + }, "timeout": { SchemaProps: spec.SchemaProps{ Description: "Timeout for each step of the ops request in second. If a step doesn't finish within the specified timeout, the ops request will result in failure.", @@ -33419,7 +33473,7 @@ func schema_apimachinery_apis_ops_v1alpha1_PostgresOpsRequestSpec(ref common.Ref }, }, Dependencies: []string{ - "k8s.io/api/core/v1.LocalObjectReference", "k8s.io/apimachinery/pkg/apis/meta/v1.Duration", "kubedb.dev/apimachinery/apis/ops/v1alpha1.AuthSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresCustomConfigurationSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresForceFailOver", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresHorizontalScalingSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresReconnectStandby", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresSetRaftKeyPair", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresTLSSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresUpdateVersionSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresVerticalScalingSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresVolumeExpansionSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.RestartSpec"}, + "k8s.io/api/core/v1.LocalObjectReference", "k8s.io/apimachinery/pkg/apis/meta/v1.Duration", "kubedb.dev/apimachinery/apis/ops/v1alpha1.AuthSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresCustomConfigurationSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresForceFailOver", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresHorizontalScalingSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresMigrationSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresReconnectStandby", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresSetRaftKeyPair", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresTLSSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresUpdateVersionSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresVerticalScalingSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.PostgresVolumeExpansionSpec", "kubedb.dev/apimachinery/apis/ops/v1alpha1.RestartSpec"}, } } diff --git a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/postgres_ops_types.go b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/postgres_ops_types.go index 42854892a..c83cd07f6 100644 --- a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/postgres_ops_types.go +++ b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/postgres_ops_types.go @@ -90,6 +90,8 @@ type PostgresOpsRequestSpec struct { ForceFailOver *PostgresForceFailOver `json:"forceFailOver,omitempty"` // Set given key pairs to raft storage SetRaftKeyPair *PostgresSetRaftKeyPair `json:"setRaftKeyPair,omitempty"` + // Specifies information necessary for migrating storageClass or data + Migration *PostgresMigrationSpec `json:"migration,omitempty"` // Timeout for each step of the ops request in second. If a step doesn't finish within the specified timeout, the ops request will result in failure. Timeout *metav1.Duration `json:"timeout,omitempty"` // ApplyOption is to control the execution of OpsRequest depending on the database state. @@ -97,8 +99,8 @@ type PostgresOpsRequestSpec struct { Apply ApplyOption `json:"apply,omitempty"` } -// +kubebuilder:validation:Enum=Upgrade;UpdateVersion;HorizontalScaling;VerticalScaling;VolumeExpansion;Restart;Reconfigure;ReconfigureTLS;RotateAuth;ReconnectStandby;ForceFailOver;SetRaftKeyPair -// ENUM(UpdateVersion, HorizontalScaling, VerticalScaling, VolumeExpansion, Restart, Reconfigure, ReconfigureTLS, RotateAuth, ReconnectStandby, ForceFailOver, SetRaftKeyPair) +// +kubebuilder:validation:Enum=Upgrade;UpdateVersion;HorizontalScaling;VerticalScaling;VolumeExpansion;Restart;Reconfigure;ReconfigureTLS;RotateAuth;ReconnectStandby;ForceFailOver;SetRaftKeyPair;StorageMigration +// ENUM(UpdateVersion, HorizontalScaling, VerticalScaling, VolumeExpansion, Restart, Reconfigure, ReconfigureTLS, RotateAuth, ReconnectStandby, ForceFailOver, SetRaftKeyPair, StorageMigration) type PostgresOpsRequestType string type PostgresUpdateVersionSpec struct { @@ -144,6 +146,11 @@ type PostgresVerticalScalingSpec struct { Arbiter *PodResources `json:"arbiter,omitempty"` } +type PostgresMigrationSpec struct { + StorageClassName *string `json:"storageClassName"` + OldPVReclaimPolicy core.PersistentVolumeReclaimPolicy `json:"oldPVReclaimPolicy,omitempty"` +} + // PostgresVolumeExpansionSpec is the spec for Postgres volume expansion type PostgresVolumeExpansionSpec struct { // volume specification for Postgres diff --git a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/postgres_ops_types_enum.go b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/postgres_ops_types_enum.go index 157c0805c..13a6f971c 100644 --- a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/postgres_ops_types_enum.go +++ b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/postgres_ops_types_enum.go @@ -33,6 +33,8 @@ const ( PostgresOpsRequestTypeForceFailOver PostgresOpsRequestType = "ForceFailOver" // PostgresOpsRequestTypeSetRaftKeyPair is a PostgresOpsRequestType of type SetRaftKeyPair. PostgresOpsRequestTypeSetRaftKeyPair PostgresOpsRequestType = "SetRaftKeyPair" + // PostgresOpsRequestTypeStorageMigration is a PostgresOpsRequestType of type StorageMigration. + PostgresOpsRequestTypeStorageMigration PostgresOpsRequestType = "StorageMigration" ) var ErrInvalidPostgresOpsRequestType = fmt.Errorf("not a valid PostgresOpsRequestType, try [%s]", strings.Join(_PostgresOpsRequestTypeNames, ", ")) @@ -49,6 +51,7 @@ var _PostgresOpsRequestTypeNames = []string{ string(PostgresOpsRequestTypeReconnectStandby), string(PostgresOpsRequestTypeForceFailOver), string(PostgresOpsRequestTypeSetRaftKeyPair), + string(PostgresOpsRequestTypeStorageMigration), } // PostgresOpsRequestTypeNames returns a list of possible string values of PostgresOpsRequestType. @@ -72,6 +75,7 @@ func PostgresOpsRequestTypeValues() []PostgresOpsRequestType { PostgresOpsRequestTypeReconnectStandby, PostgresOpsRequestTypeForceFailOver, PostgresOpsRequestTypeSetRaftKeyPair, + PostgresOpsRequestTypeStorageMigration, } } @@ -99,6 +103,7 @@ var _PostgresOpsRequestTypeValue = map[string]PostgresOpsRequestType{ "ReconnectStandby": PostgresOpsRequestTypeReconnectStandby, "ForceFailOver": PostgresOpsRequestTypeForceFailOver, "SetRaftKeyPair": PostgresOpsRequestTypeSetRaftKeyPair, + "StorageMigration": PostgresOpsRequestTypeStorageMigration, } // ParsePostgresOpsRequestType attempts to convert a string to a PostgresOpsRequestType. diff --git a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/zz_generated.deepcopy.go b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/zz_generated.deepcopy.go index 3571c7d1c..f9f129156 100644 --- a/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/zz_generated.deepcopy.go +++ b/vendor/kubedb.dev/apimachinery/apis/ops/v1alpha1/zz_generated.deepcopy.go @@ -327,48 +327,6 @@ func (in *CassandraVolumeExpansionSpec) DeepCopy() *CassandraVolumeExpansionSpec return out } -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *ClickHouseClusterHorizontalScalingSpec) DeepCopyInto(out *ClickHouseClusterHorizontalScalingSpec) { - *out = *in - if in.Replicas != nil { - in, out := &in.Replicas, &out.Replicas - *out = new(int32) - **out = **in - } - return -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ClickHouseClusterHorizontalScalingSpec. -func (in *ClickHouseClusterHorizontalScalingSpec) DeepCopy() *ClickHouseClusterHorizontalScalingSpec { - if in == nil { - return nil - } - out := new(ClickHouseClusterHorizontalScalingSpec) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *ClickHouseClusterVerticalScalingSpec) DeepCopyInto(out *ClickHouseClusterVerticalScalingSpec) { - *out = *in - if in.Node != nil { - in, out := &in.Node, &out.Node - *out = new(PodResources) - (*in).DeepCopyInto(*out) - } - return -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ClickHouseClusterVerticalScalingSpec. -func (in *ClickHouseClusterVerticalScalingSpec) DeepCopy() *ClickHouseClusterVerticalScalingSpec { - if in == nil { - return nil - } - out := new(ClickHouseClusterVerticalScalingSpec) - in.DeepCopyInto(out) - return out -} - // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *ClickHouseCustomConfigurationSpec) DeepCopyInto(out *ClickHouseCustomConfigurationSpec) { *out = *in @@ -400,16 +358,10 @@ func (in *ClickHouseCustomConfigurationSpec) DeepCopy() *ClickHouseCustomConfigu // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *ClickHouseHorizontalScalingSpec) DeepCopyInto(out *ClickHouseHorizontalScalingSpec) { *out = *in - if in.Cluster != nil { - in, out := &in.Cluster, &out.Cluster - *out = make([]*ClickHouseClusterHorizontalScalingSpec, len(*in)) - for i := range *in { - if (*in)[i] != nil { - in, out := &(*in)[i], &(*out)[i] - *out = new(ClickHouseClusterHorizontalScalingSpec) - (*in).DeepCopyInto(*out) - } - } + if in.Replicas != nil { + in, out := &in.Replicas, &out.Replicas + *out = new(int32) + **out = **in } return } @@ -529,6 +481,11 @@ func (in *ClickHouseOpsRequestSpec) DeepCopyInto(out *ClickHouseOpsRequestSpec) *out = new(metav1.Duration) **out = **in } + if in.TLS != nil { + in, out := &in.TLS, &out.TLS + *out = new(ClickHouseTLSSpec) + (*in).DeepCopyInto(*out) + } return } @@ -542,6 +499,23 @@ func (in *ClickHouseOpsRequestSpec) DeepCopy() *ClickHouseOpsRequestSpec { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ClickHouseTLSSpec) DeepCopyInto(out *ClickHouseTLSSpec) { + *out = *in + in.TLSSpec.DeepCopyInto(&out.TLSSpec) + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ClickHouseTLSSpec. +func (in *ClickHouseTLSSpec) DeepCopy() *ClickHouseTLSSpec { + if in == nil { + return nil + } + out := new(ClickHouseTLSSpec) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *ClickHouseUpdateVersionSpec) DeepCopyInto(out *ClickHouseUpdateVersionSpec) { *out = *in @@ -561,22 +535,11 @@ func (in *ClickHouseUpdateVersionSpec) DeepCopy() *ClickHouseUpdateVersionSpec { // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *ClickHouseVerticalScalingSpec) DeepCopyInto(out *ClickHouseVerticalScalingSpec) { *out = *in - if in.Standalone != nil { - in, out := &in.Standalone, &out.Standalone + if in.Node != nil { + in, out := &in.Node, &out.Node *out = new(PodResources) (*in).DeepCopyInto(*out) } - if in.Cluster != nil { - in, out := &in.Cluster, &out.Cluster - *out = make([]*ClickHouseClusterVerticalScalingSpec, len(*in)) - for i := range *in { - if (*in)[i] != nil { - in, out := &(*in)[i], &(*out)[i] - *out = new(ClickHouseClusterVerticalScalingSpec) - (*in).DeepCopyInto(*out) - } - } - } return } @@ -4036,6 +3999,27 @@ func (in *MySQLHorizontalScalingSpec) DeepCopy() *MySQLHorizontalScalingSpec { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *MySQLMigrationSpec) DeepCopyInto(out *MySQLMigrationSpec) { + *out = *in + if in.StorageClassName != nil { + in, out := &in.StorageClassName, &out.StorageClassName + *out = new(string) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new MySQLMigrationSpec. +func (in *MySQLMigrationSpec) DeepCopy() *MySQLMigrationSpec { + if in == nil { + return nil + } + out := new(MySQLMigrationSpec) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *MySQLOpsRequest) DeepCopyInto(out *MySQLOpsRequest) { *out = *in @@ -4146,6 +4130,11 @@ func (in *MySQLOpsRequestSpec) DeepCopyInto(out *MySQLOpsRequestSpec) { *out = new(RestartSpec) **out = **in } + if in.Migration != nil { + in, out := &in.Migration, &out.Migration + *out = new(MySQLMigrationSpec) + (*in).DeepCopyInto(*out) + } if in.Timeout != nil { in, out := &in.Timeout, &out.Timeout *out = new(metav1.Duration) @@ -5256,6 +5245,27 @@ func (in *PostgresHorizontalScalingSpec) DeepCopy() *PostgresHorizontalScalingSp return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *PostgresMigrationSpec) DeepCopyInto(out *PostgresMigrationSpec) { + *out = *in + if in.StorageClassName != nil { + in, out := &in.StorageClassName, &out.StorageClassName + *out = new(string) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new PostgresMigrationSpec. +func (in *PostgresMigrationSpec) DeepCopy() *PostgresMigrationSpec { + if in == nil { + return nil + } + out := new(PostgresMigrationSpec) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *PostgresOpsRequest) DeepCopyInto(out *PostgresOpsRequest) { *out = *in @@ -5376,6 +5386,11 @@ func (in *PostgresOpsRequestSpec) DeepCopyInto(out *PostgresOpsRequestSpec) { *out = new(PostgresSetRaftKeyPair) (*in).DeepCopyInto(*out) } + if in.Migration != nil { + in, out := &in.Migration, &out.Migration + *out = new(PostgresMigrationSpec) + (*in).DeepCopyInto(*out) + } if in.Timeout != nil { in, out := &in.Timeout, &out.Timeout *out = new(metav1.Duration) diff --git a/vendor/kubedb.dev/apimachinery/client/clientset/versioned/typed/autoscaling/v1alpha1/autoscaling_client.go b/vendor/kubedb.dev/apimachinery/client/clientset/versioned/typed/autoscaling/v1alpha1/autoscaling_client.go index 1403795be..7832fb522 100644 --- a/vendor/kubedb.dev/apimachinery/client/clientset/versioned/typed/autoscaling/v1alpha1/autoscaling_client.go +++ b/vendor/kubedb.dev/apimachinery/client/clientset/versioned/typed/autoscaling/v1alpha1/autoscaling_client.go @@ -36,6 +36,7 @@ type AutoscalingV1alpha1Interface interface { EtcdAutoscalersGetter FerretDBAutoscalersGetter HazelcastAutoscalersGetter + IgniteAutoscalersGetter KafkaAutoscalersGetter MSSQLServerAutoscalersGetter MariaDBAutoscalersGetter @@ -88,6 +89,10 @@ func (c *AutoscalingV1alpha1Client) HazelcastAutoscalers(namespace string) Hazel return newHazelcastAutoscalers(c, namespace) } +func (c *AutoscalingV1alpha1Client) IgniteAutoscalers(namespace string) IgniteAutoscalerInterface { + return newIgniteAutoscalers(c, namespace) +} + func (c *AutoscalingV1alpha1Client) KafkaAutoscalers(namespace string) KafkaAutoscalerInterface { return newKafkaAutoscalers(c, namespace) } diff --git a/vendor/kubedb.dev/apimachinery/client/clientset/versioned/typed/autoscaling/v1alpha1/generated_expansion.go b/vendor/kubedb.dev/apimachinery/client/clientset/versioned/typed/autoscaling/v1alpha1/generated_expansion.go index 5dbffa0f3..7e1f2cd42 100644 --- a/vendor/kubedb.dev/apimachinery/client/clientset/versioned/typed/autoscaling/v1alpha1/generated_expansion.go +++ b/vendor/kubedb.dev/apimachinery/client/clientset/versioned/typed/autoscaling/v1alpha1/generated_expansion.go @@ -32,6 +32,8 @@ type FerretDBAutoscalerExpansion interface{} type HazelcastAutoscalerExpansion interface{} +type IgniteAutoscalerExpansion interface{} + type KafkaAutoscalerExpansion interface{} type MSSQLServerAutoscalerExpansion interface{} diff --git a/vendor/kubedb.dev/apimachinery/client/clientset/versioned/typed/autoscaling/v1alpha1/igniteautoscaler.go b/vendor/kubedb.dev/apimachinery/client/clientset/versioned/typed/autoscaling/v1alpha1/igniteautoscaler.go new file mode 100644 index 000000000..3341ac274 --- /dev/null +++ b/vendor/kubedb.dev/apimachinery/client/clientset/versioned/typed/autoscaling/v1alpha1/igniteautoscaler.go @@ -0,0 +1,196 @@ +/* +Copyright AppsCode Inc. and Contributors + +Licensed under the Apache License, Version 2.0 (the "License"); +you may not use this file except in compliance with the License. +You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + +Unless required by applicable law or agreed to in writing, software +distributed under the License is distributed on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +See the License for the specific language governing permissions and +limitations under the License. +*/ + +// Code generated by client-gen. DO NOT EDIT. + +package v1alpha1 + +import ( + "context" + "time" + + v1alpha1 "kubedb.dev/apimachinery/apis/autoscaling/v1alpha1" + scheme "kubedb.dev/apimachinery/client/clientset/versioned/scheme" + + v1 "k8s.io/apimachinery/pkg/apis/meta/v1" + types "k8s.io/apimachinery/pkg/types" + watch "k8s.io/apimachinery/pkg/watch" + rest "k8s.io/client-go/rest" +) + +// IgniteAutoscalersGetter has a method to return a IgniteAutoscalerInterface. +// A group's client should implement this interface. +type IgniteAutoscalersGetter interface { + IgniteAutoscalers(namespace string) IgniteAutoscalerInterface +} + +// IgniteAutoscalerInterface has methods to work with IgniteAutoscaler resources. +type IgniteAutoscalerInterface interface { + Create(ctx context.Context, igniteAutoscaler *v1alpha1.IgniteAutoscaler, opts v1.CreateOptions) (*v1alpha1.IgniteAutoscaler, error) + Update(ctx context.Context, igniteAutoscaler *v1alpha1.IgniteAutoscaler, opts v1.UpdateOptions) (*v1alpha1.IgniteAutoscaler, error) + UpdateStatus(ctx context.Context, igniteAutoscaler *v1alpha1.IgniteAutoscaler, opts v1.UpdateOptions) (*v1alpha1.IgniteAutoscaler, error) + Delete(ctx context.Context, name string, opts v1.DeleteOptions) error + DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error + Get(ctx context.Context, name string, opts v1.GetOptions) (*v1alpha1.IgniteAutoscaler, error) + List(ctx context.Context, opts v1.ListOptions) (*v1alpha1.IgniteAutoscalerList, error) + Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) + Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1alpha1.IgniteAutoscaler, err error) + IgniteAutoscalerExpansion +} + +// igniteAutoscalers implements IgniteAutoscalerInterface +type igniteAutoscalers struct { + client rest.Interface + ns string +} + +// newIgniteAutoscalers returns a IgniteAutoscalers +func newIgniteAutoscalers(c *AutoscalingV1alpha1Client, namespace string) *igniteAutoscalers { + return &igniteAutoscalers{ + client: c.RESTClient(), + ns: namespace, + } +} + +// Get takes name of the igniteAutoscaler, and returns the corresponding igniteAutoscaler object, and an error if there is any. +func (c *igniteAutoscalers) Get(ctx context.Context, name string, options v1.GetOptions) (result *v1alpha1.IgniteAutoscaler, err error) { + result = &v1alpha1.IgniteAutoscaler{} + err = c.client.Get(). + Namespace(c.ns). + Resource("igniteautoscalers"). + Name(name). + VersionedParams(&options, scheme.ParameterCodec). + Do(ctx). + Into(result) + return +} + +// List takes label and field selectors, and returns the list of IgniteAutoscalers that match those selectors. +func (c *igniteAutoscalers) List(ctx context.Context, opts v1.ListOptions) (result *v1alpha1.IgniteAutoscalerList, err error) { + var timeout time.Duration + if opts.TimeoutSeconds != nil { + timeout = time.Duration(*opts.TimeoutSeconds) * time.Second + } + result = &v1alpha1.IgniteAutoscalerList{} + err = c.client.Get(). + Namespace(c.ns). + Resource("igniteautoscalers"). + VersionedParams(&opts, scheme.ParameterCodec). + Timeout(timeout). + Do(ctx). + Into(result) + return +} + +// Watch returns a watch.Interface that watches the requested igniteAutoscalers. +func (c *igniteAutoscalers) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { + var timeout time.Duration + if opts.TimeoutSeconds != nil { + timeout = time.Duration(*opts.TimeoutSeconds) * time.Second + } + opts.Watch = true + return c.client.Get(). + Namespace(c.ns). + Resource("igniteautoscalers"). + VersionedParams(&opts, scheme.ParameterCodec). + Timeout(timeout). + Watch(ctx) +} + +// Create takes the representation of a igniteAutoscaler and creates it. Returns the server's representation of the igniteAutoscaler, and an error, if there is any. +func (c *igniteAutoscalers) Create(ctx context.Context, igniteAutoscaler *v1alpha1.IgniteAutoscaler, opts v1.CreateOptions) (result *v1alpha1.IgniteAutoscaler, err error) { + result = &v1alpha1.IgniteAutoscaler{} + err = c.client.Post(). + Namespace(c.ns). + Resource("igniteautoscalers"). + VersionedParams(&opts, scheme.ParameterCodec). + Body(igniteAutoscaler). + Do(ctx). + Into(result) + return +} + +// Update takes the representation of a igniteAutoscaler and updates it. Returns the server's representation of the igniteAutoscaler, and an error, if there is any. +func (c *igniteAutoscalers) Update(ctx context.Context, igniteAutoscaler *v1alpha1.IgniteAutoscaler, opts v1.UpdateOptions) (result *v1alpha1.IgniteAutoscaler, err error) { + result = &v1alpha1.IgniteAutoscaler{} + err = c.client.Put(). + Namespace(c.ns). + Resource("igniteautoscalers"). + Name(igniteAutoscaler.Name). + VersionedParams(&opts, scheme.ParameterCodec). + Body(igniteAutoscaler). + Do(ctx). + Into(result) + return +} + +// UpdateStatus was generated because the type contains a Status member. +// Add a +genclient:noStatus comment above the type to avoid generating UpdateStatus(). +func (c *igniteAutoscalers) UpdateStatus(ctx context.Context, igniteAutoscaler *v1alpha1.IgniteAutoscaler, opts v1.UpdateOptions) (result *v1alpha1.IgniteAutoscaler, err error) { + result = &v1alpha1.IgniteAutoscaler{} + err = c.client.Put(). + Namespace(c.ns). + Resource("igniteautoscalers"). + Name(igniteAutoscaler.Name). + SubResource("status"). + VersionedParams(&opts, scheme.ParameterCodec). + Body(igniteAutoscaler). + Do(ctx). + Into(result) + return +} + +// Delete takes name of the igniteAutoscaler and deletes it. Returns an error if one occurs. +func (c *igniteAutoscalers) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { + return c.client.Delete(). + Namespace(c.ns). + Resource("igniteautoscalers"). + Name(name). + Body(&opts). + Do(ctx). + Error() +} + +// DeleteCollection deletes a collection of objects. +func (c *igniteAutoscalers) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { + var timeout time.Duration + if listOpts.TimeoutSeconds != nil { + timeout = time.Duration(*listOpts.TimeoutSeconds) * time.Second + } + return c.client.Delete(). + Namespace(c.ns). + Resource("igniteautoscalers"). + VersionedParams(&listOpts, scheme.ParameterCodec). + Timeout(timeout). + Body(&opts). + Do(ctx). + Error() +} + +// Patch applies the patch and returns the patched igniteAutoscaler. +func (c *igniteAutoscalers) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1alpha1.IgniteAutoscaler, err error) { + result = &v1alpha1.IgniteAutoscaler{} + err = c.client.Patch(pt). + Namespace(c.ns). + Resource("igniteautoscalers"). + Name(name). + SubResource(subresources...). + VersionedParams(&opts, scheme.ParameterCodec). + Body(data). + Do(ctx). + Into(result) + return +} diff --git a/vendor/kubedb.dev/apimachinery/crds/autoscaling.kubedb.com_igniteautoscalers.yaml b/vendor/kubedb.dev/apimachinery/crds/autoscaling.kubedb.com_igniteautoscalers.yaml new file mode 100644 index 000000000..8d218cd1f --- /dev/null +++ b/vendor/kubedb.dev/apimachinery/crds/autoscaling.kubedb.com_igniteautoscalers.yaml @@ -0,0 +1,345 @@ +apiVersion: apiextensions.k8s.io/v1 +kind: CustomResourceDefinition +metadata: + creationTimestamp: null + labels: + app.kubernetes.io/name: kubedb + name: igniteautoscalers.autoscaling.kubedb.com +spec: + group: autoscaling.kubedb.com + names: + categories: + - autoscaler + - kubedb + - appscode + kind: IgniteAutoscaler + listKind: IgniteAutoscalerList + plural: igniteautoscalers + shortNames: + - igscaler + singular: igniteautoscaler + scope: Namespaced + versions: + - name: v1alpha1 + schema: + openAPIV3Schema: + properties: + apiVersion: + type: string + kind: + type: string + metadata: + type: object + spec: + properties: + compute: + properties: + ignite: + properties: + containerControlledValues: + enum: + - RequestsAndLimits + - RequestsOnly + type: string + controlledResources: + items: + type: string + type: array + inMemoryStorage: + properties: + scalingFactorPercentage: + format: int32 + type: integer + usageThresholdPercentage: + format: int32 + type: integer + type: object + maxAllowed: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + minAllowed: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + podLifeTimeThreshold: + type: string + resourceDiffPercentage: + format: int32 + type: integer + trigger: + type: string + type: object + nodeTopology: + properties: + name: + type: string + scaleDownDiffPercentage: + default: 25 + format: int32 + type: integer + scaleUpDiffPercentage: + default: 15 + format: int32 + type: integer + type: object + type: object + databaseRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + opsRequestOptions: + properties: + apply: + default: IfReady + enum: + - IfReady + - Always + type: string + timeout: + type: string + type: object + storage: + properties: + ignite: + properties: + expansionMode: + enum: + - Offline + - Online + type: string + scalingRules: + items: + properties: + appliesUpto: + type: string + threshold: + type: string + required: + - appliesUpto + - threshold + type: object + type: array + scalingThreshold: + format: int32 + type: integer + trigger: + type: string + upperBound: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + usageThreshold: + format: int32 + type: integer + required: + - expansionMode + type: object + type: object + required: + - databaseRef + type: object + status: + properties: + checkpoints: + items: + properties: + cpuHistogram: + properties: + bucketWeights: + items: + properties: + index: + type: integer + weight: + format: int32 + type: integer + required: + - index + - weight + type: object + type: array + x-kubernetes-preserve-unknown-fields: true + referenceTimestamp: + format: date-time + nullable: true + type: string + totalWeight: + format: double + type: number + type: object + firstSampleStart: + format: date-time + nullable: true + type: string + lastSampleStart: + format: date-time + nullable: true + type: string + lastUpdateTime: + format: date-time + nullable: true + type: string + memoryHistogram: + properties: + bucketWeights: + items: + properties: + index: + type: integer + weight: + format: int32 + type: integer + required: + - index + - weight + type: object + type: array + x-kubernetes-preserve-unknown-fields: true + referenceTimestamp: + format: date-time + nullable: true + type: string + totalWeight: + format: double + type: number + type: object + ref: + properties: + containerName: + type: string + vpaObjectName: + type: string + type: object + totalSamplesCount: + type: integer + version: + type: string + type: object + type: array + conditions: + items: + properties: + lastTransitionTime: + format: date-time + type: string + message: + type: string + observedGeneration: + format: int64 + type: integer + reason: + type: string + severity: + type: string + status: + type: string + type: + type: string + required: + - lastTransitionTime + - status + - type + type: object + type: array + observedGeneration: + format: int64 + type: integer + phase: + enum: + - InProgress + - Current + - Terminating + - Failed + type: string + vpas: + items: + properties: + conditions: + items: + properties: + lastTransitionTime: + format: date-time + type: string + message: + type: string + reason: + type: string + status: + type: string + type: + type: string + required: + - status + - type + type: object + type: array + recommendation: + properties: + containerRecommendations: + items: + properties: + containerName: + type: string + lowerBound: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + target: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + uncappedTarget: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + upperBound: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + required: + - target + type: object + type: array + type: object + vpaName: + type: string + type: object + type: array + type: object + required: + - spec + type: object + served: true + storage: true + subresources: + status: {} diff --git a/vendor/kubedb.dev/apimachinery/crds/catalog.kubedb.com_pgbouncerversions.yaml b/vendor/kubedb.dev/apimachinery/crds/catalog.kubedb.com_pgbouncerversions.yaml index e4fedcc4c..ce1cfe9d7 100644 --- a/vendor/kubedb.dev/apimachinery/crds/catalog.kubedb.com_pgbouncerversions.yaml +++ b/vendor/kubedb.dev/apimachinery/crds/catalog.kubedb.com_pgbouncerversions.yaml @@ -54,6 +54,13 @@ spec: required: - image type: object + gitSyncer: + properties: + image: + type: string + required: + - image + type: object pgBouncer: properties: image: diff --git a/vendor/kubedb.dev/apimachinery/crds/catalog.kubedb.com_pgpoolversions.yaml b/vendor/kubedb.dev/apimachinery/crds/catalog.kubedb.com_pgpoolversions.yaml index 25afe8a89..67224b6c6 100644 --- a/vendor/kubedb.dev/apimachinery/crds/catalog.kubedb.com_pgpoolversions.yaml +++ b/vendor/kubedb.dev/apimachinery/crds/catalog.kubedb.com_pgpoolversions.yaml @@ -54,6 +54,13 @@ spec: required: - image type: object + gitSyncer: + properties: + image: + type: string + required: + - image + type: object pgpool: properties: image: diff --git a/vendor/kubedb.dev/apimachinery/crds/gitops.kubedb.com_pgbouncers.yaml b/vendor/kubedb.dev/apimachinery/crds/gitops.kubedb.com_pgbouncers.yaml index fa7a9a9fb..9eeeefa8b 100644 --- a/vendor/kubedb.dev/apimachinery/crds/gitops.kubedb.com_pgbouncers.yaml +++ b/vendor/kubedb.dev/apimachinery/crds/gitops.kubedb.com_pgbouncers.yaml @@ -149,6 +149,1054 @@ spec: format: int32 type: integer type: object + init: + properties: + archiver: + properties: + encryptionSecret: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + fullDBRepository: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + manifestOptions: + properties: + archiver: + default: false + type: boolean + archiverRef: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + initScript: + default: false + type: boolean + type: object + manifestRepository: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + recoveryTimestamp: + format: date-time + type: string + replicationStrategy: + enum: + - fscopy + - clone + - sync + - none + type: string + required: + - recoveryTimestamp + type: object + initialized: + type: boolean + script: + properties: + awsElasticBlockStore: + properties: + fsType: + type: string + partition: + format: int32 + type: integer + readOnly: + type: boolean + volumeID: + type: string + required: + - volumeID + type: object + azureDisk: + properties: + cachingMode: + type: string + diskName: + type: string + diskURI: + type: string + fsType: + default: ext4 + type: string + kind: + type: string + readOnly: + default: false + type: boolean + required: + - diskName + - diskURI + type: object + azureFile: + properties: + readOnly: + type: boolean + secretName: + type: string + shareName: + type: string + required: + - secretName + - shareName + type: object + cephfs: + properties: + monitors: + items: + type: string + type: array + x-kubernetes-list-type: atomic + path: + type: string + readOnly: + type: boolean + secretFile: + type: string + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + user: + type: string + required: + - monitors + type: object + cinder: + properties: + fsType: + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + volumeID: + type: string + required: + - volumeID + type: object + configMap: + properties: + defaultMode: + format: int32 + type: integer + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + name: + default: "" + type: string + optional: + type: boolean + type: object + x-kubernetes-map-type: atomic + csi: + properties: + driver: + type: string + fsType: + type: string + nodePublishSecretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + readOnly: + type: boolean + volumeAttributes: + additionalProperties: + type: string + type: object + required: + - driver + type: object + downwardAPI: + properties: + defaultMode: + format: int32 + type: integer + items: + items: + properties: + fieldRef: + properties: + apiVersion: + type: string + fieldPath: + type: string + required: + - fieldPath + type: object + x-kubernetes-map-type: atomic + mode: + format: int32 + type: integer + path: + type: string + resourceFieldRef: + properties: + containerName: + type: string + divisor: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + resource: + type: string + required: + - resource + type: object + x-kubernetes-map-type: atomic + required: + - path + type: object + type: array + x-kubernetes-list-type: atomic + type: object + emptyDir: + properties: + medium: + type: string + sizeLimit: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + ephemeral: + properties: + volumeClaimTemplate: + properties: + metadata: + properties: + annotations: + additionalProperties: + type: string + type: object + finalizers: + items: + type: string + type: array + labels: + additionalProperties: + type: string + type: object + name: + type: string + namespace: + type: string + type: object + spec: + properties: + accessModes: + items: + type: string + type: array + x-kubernetes-list-type: atomic + dataSource: + properties: + apiGroup: + type: string + kind: + type: string + name: + type: string + required: + - kind + - name + type: object + x-kubernetes-map-type: atomic + dataSourceRef: + properties: + apiGroup: + type: string + kind: + type: string + name: + type: string + namespace: + type: string + required: + - kind + - name + type: object + resources: + properties: + limits: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + requests: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + type: object + selector: + properties: + matchExpressions: + items: + properties: + key: + type: string + operator: + type: string + values: + items: + type: string + type: array + x-kubernetes-list-type: atomic + required: + - key + - operator + type: object + type: array + x-kubernetes-list-type: atomic + matchLabels: + additionalProperties: + type: string + type: object + type: object + x-kubernetes-map-type: atomic + storageClassName: + type: string + volumeAttributesClassName: + type: string + volumeMode: + type: string + volumeName: + type: string + type: object + required: + - spec + type: object + type: object + fc: + properties: + fsType: + type: string + lun: + format: int32 + type: integer + readOnly: + type: boolean + targetWWNs: + items: + type: string + type: array + x-kubernetes-list-type: atomic + wwids: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + flexVolume: + properties: + driver: + type: string + fsType: + type: string + options: + additionalProperties: + type: string + type: object + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + required: + - driver + type: object + flocker: + properties: + datasetName: + type: string + datasetUUID: + type: string + type: object + gcePersistentDisk: + properties: + fsType: + type: string + partition: + format: int32 + type: integer + pdName: + type: string + readOnly: + type: boolean + required: + - pdName + type: object + git: + properties: + args: + items: + type: string + type: array + authSecret: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + env: + items: + properties: + name: + type: string + value: + type: string + valueFrom: + properties: + configMapKeyRef: + properties: + key: + type: string + name: + default: "" + type: string + optional: + type: boolean + required: + - key + type: object + x-kubernetes-map-type: atomic + fieldRef: + properties: + apiVersion: + type: string + fieldPath: + type: string + required: + - fieldPath + type: object + x-kubernetes-map-type: atomic + resourceFieldRef: + properties: + containerName: + type: string + divisor: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + resource: + type: string + required: + - resource + type: object + x-kubernetes-map-type: atomic + secretKeyRef: + properties: + key: + type: string + name: + default: "" + type: string + optional: + type: boolean + required: + - key + type: object + x-kubernetes-map-type: atomic + type: object + required: + - name + type: object + type: array + resources: + properties: + claims: + items: + properties: + name: + type: string + request: + type: string + required: + - name + type: object + type: array + x-kubernetes-list-map-keys: + - name + x-kubernetes-list-type: map + limits: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + requests: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + type: object + securityContext: + properties: + allowPrivilegeEscalation: + type: boolean + appArmorProfile: + properties: + localhostProfile: + type: string + type: + type: string + required: + - type + type: object + capabilities: + properties: + add: + items: + type: string + type: array + x-kubernetes-list-type: atomic + drop: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + privileged: + type: boolean + procMount: + type: string + readOnlyRootFilesystem: + type: boolean + runAsGroup: + format: int64 + type: integer + runAsNonRoot: + type: boolean + runAsUser: + format: int64 + type: integer + seLinuxOptions: + properties: + level: + type: string + role: + type: string + type: + type: string + user: + type: string + type: object + seccompProfile: + properties: + localhostProfile: + type: string + type: + type: string + required: + - type + type: object + windowsOptions: + properties: + gmsaCredentialSpec: + type: string + gmsaCredentialSpecName: + type: string + hostProcess: + type: boolean + runAsUserName: + type: string + type: object + type: object + required: + - args + type: object + gitRepo: + properties: + directory: + type: string + repository: + type: string + revision: + type: string + required: + - repository + type: object + glusterfs: + properties: + endpoints: + type: string + path: + type: string + readOnly: + type: boolean + required: + - endpoints + - path + type: object + hostPath: + properties: + path: + type: string + type: + type: string + required: + - path + type: object + image: + properties: + pullPolicy: + type: string + reference: + type: string + type: object + iscsi: + properties: + chapAuthDiscovery: + type: boolean + chapAuthSession: + type: boolean + fsType: + type: string + initiatorName: + type: string + iqn: + type: string + iscsiInterface: + default: default + type: string + lun: + format: int32 + type: integer + portals: + items: + type: string + type: array + x-kubernetes-list-type: atomic + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + targetPortal: + type: string + required: + - iqn + - lun + - targetPortal + type: object + nfs: + properties: + path: + type: string + readOnly: + type: boolean + server: + type: string + required: + - path + - server + type: object + persistentVolumeClaim: + properties: + claimName: + type: string + readOnly: + type: boolean + required: + - claimName + type: object + photonPersistentDisk: + properties: + fsType: + type: string + pdID: + type: string + required: + - pdID + type: object + portworxVolume: + properties: + fsType: + type: string + readOnly: + type: boolean + volumeID: + type: string + required: + - volumeID + type: object + projected: + properties: + defaultMode: + format: int32 + type: integer + sources: + items: + properties: + clusterTrustBundle: + properties: + labelSelector: + properties: + matchExpressions: + items: + properties: + key: + type: string + operator: + type: string + values: + items: + type: string + type: array + x-kubernetes-list-type: atomic + required: + - key + - operator + type: object + type: array + x-kubernetes-list-type: atomic + matchLabels: + additionalProperties: + type: string + type: object + type: object + x-kubernetes-map-type: atomic + name: + type: string + optional: + type: boolean + path: + type: string + signerName: + type: string + required: + - path + type: object + configMap: + properties: + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + name: + default: "" + type: string + optional: + type: boolean + type: object + x-kubernetes-map-type: atomic + downwardAPI: + properties: + items: + items: + properties: + fieldRef: + properties: + apiVersion: + type: string + fieldPath: + type: string + required: + - fieldPath + type: object + x-kubernetes-map-type: atomic + mode: + format: int32 + type: integer + path: + type: string + resourceFieldRef: + properties: + containerName: + type: string + divisor: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + resource: + type: string + required: + - resource + type: object + x-kubernetes-map-type: atomic + required: + - path + type: object + type: array + x-kubernetes-list-type: atomic + type: object + secret: + properties: + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + name: + default: "" + type: string + optional: + type: boolean + type: object + x-kubernetes-map-type: atomic + serviceAccountToken: + properties: + audience: + type: string + expirationSeconds: + format: int64 + type: integer + path: + type: string + required: + - path + type: object + type: object + type: array + x-kubernetes-list-type: atomic + type: object + quobyte: + properties: + group: + type: string + readOnly: + type: boolean + registry: + type: string + tenant: + type: string + user: + type: string + volume: + type: string + required: + - registry + - volume + type: object + rbd: + properties: + fsType: + type: string + image: + type: string + keyring: + default: /etc/ceph/keyring + type: string + monitors: + items: + type: string + type: array + x-kubernetes-list-type: atomic + pool: + default: rbd + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + user: + default: admin + type: string + required: + - image + - monitors + type: object + scaleIO: + properties: + fsType: + default: xfs + type: string + gateway: + type: string + protectionDomain: + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + sslEnabled: + type: boolean + storageMode: + default: ThinProvisioned + type: string + storagePool: + type: string + system: + type: string + volumeName: + type: string + required: + - gateway + - secretRef + - system + type: object + scriptPath: + type: string + secret: + properties: + defaultMode: + format: int32 + type: integer + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + optional: + type: boolean + secretName: + type: string + type: object + storageos: + properties: + fsType: + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + volumeName: + type: string + volumeNamespace: + type: string + type: object + vsphereVolume: + properties: + fsType: + type: string + storagePolicyID: + type: string + storagePolicyName: + type: string + volumePath: + type: string + required: + - volumePath + type: object + type: object + waitForInitialRestore: + type: boolean + type: object monitor: properties: agent: diff --git a/vendor/kubedb.dev/apimachinery/crds/gitops.kubedb.com_pgpools.yaml b/vendor/kubedb.dev/apimachinery/crds/gitops.kubedb.com_pgpools.yaml index f2ab51145..b3827de61 100644 --- a/vendor/kubedb.dev/apimachinery/crds/gitops.kubedb.com_pgpools.yaml +++ b/vendor/kubedb.dev/apimachinery/crds/gitops.kubedb.com_pgpools.yaml @@ -91,6 +91,1054 @@ spec: format: int32 type: integer type: object + init: + properties: + archiver: + properties: + encryptionSecret: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + fullDBRepository: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + manifestOptions: + properties: + archiver: + default: false + type: boolean + archiverRef: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + initScript: + default: false + type: boolean + type: object + manifestRepository: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + recoveryTimestamp: + format: date-time + type: string + replicationStrategy: + enum: + - fscopy + - clone + - sync + - none + type: string + required: + - recoveryTimestamp + type: object + initialized: + type: boolean + script: + properties: + awsElasticBlockStore: + properties: + fsType: + type: string + partition: + format: int32 + type: integer + readOnly: + type: boolean + volumeID: + type: string + required: + - volumeID + type: object + azureDisk: + properties: + cachingMode: + type: string + diskName: + type: string + diskURI: + type: string + fsType: + default: ext4 + type: string + kind: + type: string + readOnly: + default: false + type: boolean + required: + - diskName + - diskURI + type: object + azureFile: + properties: + readOnly: + type: boolean + secretName: + type: string + shareName: + type: string + required: + - secretName + - shareName + type: object + cephfs: + properties: + monitors: + items: + type: string + type: array + x-kubernetes-list-type: atomic + path: + type: string + readOnly: + type: boolean + secretFile: + type: string + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + user: + type: string + required: + - monitors + type: object + cinder: + properties: + fsType: + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + volumeID: + type: string + required: + - volumeID + type: object + configMap: + properties: + defaultMode: + format: int32 + type: integer + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + name: + default: "" + type: string + optional: + type: boolean + type: object + x-kubernetes-map-type: atomic + csi: + properties: + driver: + type: string + fsType: + type: string + nodePublishSecretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + readOnly: + type: boolean + volumeAttributes: + additionalProperties: + type: string + type: object + required: + - driver + type: object + downwardAPI: + properties: + defaultMode: + format: int32 + type: integer + items: + items: + properties: + fieldRef: + properties: + apiVersion: + type: string + fieldPath: + type: string + required: + - fieldPath + type: object + x-kubernetes-map-type: atomic + mode: + format: int32 + type: integer + path: + type: string + resourceFieldRef: + properties: + containerName: + type: string + divisor: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + resource: + type: string + required: + - resource + type: object + x-kubernetes-map-type: atomic + required: + - path + type: object + type: array + x-kubernetes-list-type: atomic + type: object + emptyDir: + properties: + medium: + type: string + sizeLimit: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + ephemeral: + properties: + volumeClaimTemplate: + properties: + metadata: + properties: + annotations: + additionalProperties: + type: string + type: object + finalizers: + items: + type: string + type: array + labels: + additionalProperties: + type: string + type: object + name: + type: string + namespace: + type: string + type: object + spec: + properties: + accessModes: + items: + type: string + type: array + x-kubernetes-list-type: atomic + dataSource: + properties: + apiGroup: + type: string + kind: + type: string + name: + type: string + required: + - kind + - name + type: object + x-kubernetes-map-type: atomic + dataSourceRef: + properties: + apiGroup: + type: string + kind: + type: string + name: + type: string + namespace: + type: string + required: + - kind + - name + type: object + resources: + properties: + limits: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + requests: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + type: object + selector: + properties: + matchExpressions: + items: + properties: + key: + type: string + operator: + type: string + values: + items: + type: string + type: array + x-kubernetes-list-type: atomic + required: + - key + - operator + type: object + type: array + x-kubernetes-list-type: atomic + matchLabels: + additionalProperties: + type: string + type: object + type: object + x-kubernetes-map-type: atomic + storageClassName: + type: string + volumeAttributesClassName: + type: string + volumeMode: + type: string + volumeName: + type: string + type: object + required: + - spec + type: object + type: object + fc: + properties: + fsType: + type: string + lun: + format: int32 + type: integer + readOnly: + type: boolean + targetWWNs: + items: + type: string + type: array + x-kubernetes-list-type: atomic + wwids: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + flexVolume: + properties: + driver: + type: string + fsType: + type: string + options: + additionalProperties: + type: string + type: object + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + required: + - driver + type: object + flocker: + properties: + datasetName: + type: string + datasetUUID: + type: string + type: object + gcePersistentDisk: + properties: + fsType: + type: string + partition: + format: int32 + type: integer + pdName: + type: string + readOnly: + type: boolean + required: + - pdName + type: object + git: + properties: + args: + items: + type: string + type: array + authSecret: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + env: + items: + properties: + name: + type: string + value: + type: string + valueFrom: + properties: + configMapKeyRef: + properties: + key: + type: string + name: + default: "" + type: string + optional: + type: boolean + required: + - key + type: object + x-kubernetes-map-type: atomic + fieldRef: + properties: + apiVersion: + type: string + fieldPath: + type: string + required: + - fieldPath + type: object + x-kubernetes-map-type: atomic + resourceFieldRef: + properties: + containerName: + type: string + divisor: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + resource: + type: string + required: + - resource + type: object + x-kubernetes-map-type: atomic + secretKeyRef: + properties: + key: + type: string + name: + default: "" + type: string + optional: + type: boolean + required: + - key + type: object + x-kubernetes-map-type: atomic + type: object + required: + - name + type: object + type: array + resources: + properties: + claims: + items: + properties: + name: + type: string + request: + type: string + required: + - name + type: object + type: array + x-kubernetes-list-map-keys: + - name + x-kubernetes-list-type: map + limits: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + requests: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + type: object + securityContext: + properties: + allowPrivilegeEscalation: + type: boolean + appArmorProfile: + properties: + localhostProfile: + type: string + type: + type: string + required: + - type + type: object + capabilities: + properties: + add: + items: + type: string + type: array + x-kubernetes-list-type: atomic + drop: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + privileged: + type: boolean + procMount: + type: string + readOnlyRootFilesystem: + type: boolean + runAsGroup: + format: int64 + type: integer + runAsNonRoot: + type: boolean + runAsUser: + format: int64 + type: integer + seLinuxOptions: + properties: + level: + type: string + role: + type: string + type: + type: string + user: + type: string + type: object + seccompProfile: + properties: + localhostProfile: + type: string + type: + type: string + required: + - type + type: object + windowsOptions: + properties: + gmsaCredentialSpec: + type: string + gmsaCredentialSpecName: + type: string + hostProcess: + type: boolean + runAsUserName: + type: string + type: object + type: object + required: + - args + type: object + gitRepo: + properties: + directory: + type: string + repository: + type: string + revision: + type: string + required: + - repository + type: object + glusterfs: + properties: + endpoints: + type: string + path: + type: string + readOnly: + type: boolean + required: + - endpoints + - path + type: object + hostPath: + properties: + path: + type: string + type: + type: string + required: + - path + type: object + image: + properties: + pullPolicy: + type: string + reference: + type: string + type: object + iscsi: + properties: + chapAuthDiscovery: + type: boolean + chapAuthSession: + type: boolean + fsType: + type: string + initiatorName: + type: string + iqn: + type: string + iscsiInterface: + default: default + type: string + lun: + format: int32 + type: integer + portals: + items: + type: string + type: array + x-kubernetes-list-type: atomic + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + targetPortal: + type: string + required: + - iqn + - lun + - targetPortal + type: object + nfs: + properties: + path: + type: string + readOnly: + type: boolean + server: + type: string + required: + - path + - server + type: object + persistentVolumeClaim: + properties: + claimName: + type: string + readOnly: + type: boolean + required: + - claimName + type: object + photonPersistentDisk: + properties: + fsType: + type: string + pdID: + type: string + required: + - pdID + type: object + portworxVolume: + properties: + fsType: + type: string + readOnly: + type: boolean + volumeID: + type: string + required: + - volumeID + type: object + projected: + properties: + defaultMode: + format: int32 + type: integer + sources: + items: + properties: + clusterTrustBundle: + properties: + labelSelector: + properties: + matchExpressions: + items: + properties: + key: + type: string + operator: + type: string + values: + items: + type: string + type: array + x-kubernetes-list-type: atomic + required: + - key + - operator + type: object + type: array + x-kubernetes-list-type: atomic + matchLabels: + additionalProperties: + type: string + type: object + type: object + x-kubernetes-map-type: atomic + name: + type: string + optional: + type: boolean + path: + type: string + signerName: + type: string + required: + - path + type: object + configMap: + properties: + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + name: + default: "" + type: string + optional: + type: boolean + type: object + x-kubernetes-map-type: atomic + downwardAPI: + properties: + items: + items: + properties: + fieldRef: + properties: + apiVersion: + type: string + fieldPath: + type: string + required: + - fieldPath + type: object + x-kubernetes-map-type: atomic + mode: + format: int32 + type: integer + path: + type: string + resourceFieldRef: + properties: + containerName: + type: string + divisor: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + resource: + type: string + required: + - resource + type: object + x-kubernetes-map-type: atomic + required: + - path + type: object + type: array + x-kubernetes-list-type: atomic + type: object + secret: + properties: + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + name: + default: "" + type: string + optional: + type: boolean + type: object + x-kubernetes-map-type: atomic + serviceAccountToken: + properties: + audience: + type: string + expirationSeconds: + format: int64 + type: integer + path: + type: string + required: + - path + type: object + type: object + type: array + x-kubernetes-list-type: atomic + type: object + quobyte: + properties: + group: + type: string + readOnly: + type: boolean + registry: + type: string + tenant: + type: string + user: + type: string + volume: + type: string + required: + - registry + - volume + type: object + rbd: + properties: + fsType: + type: string + image: + type: string + keyring: + default: /etc/ceph/keyring + type: string + monitors: + items: + type: string + type: array + x-kubernetes-list-type: atomic + pool: + default: rbd + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + user: + default: admin + type: string + required: + - image + - monitors + type: object + scaleIO: + properties: + fsType: + default: xfs + type: string + gateway: + type: string + protectionDomain: + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + sslEnabled: + type: boolean + storageMode: + default: ThinProvisioned + type: string + storagePool: + type: string + system: + type: string + volumeName: + type: string + required: + - gateway + - secretRef + - system + type: object + scriptPath: + type: string + secret: + properties: + defaultMode: + format: int32 + type: integer + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + optional: + type: boolean + secretName: + type: string + type: object + storageos: + properties: + fsType: + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + volumeName: + type: string + volumeNamespace: + type: string + type: object + vsphereVolume: + properties: + fsType: + type: string + storagePolicyID: + type: string + storagePolicyName: + type: string + volumePath: + type: string + required: + - volumePath + type: object + type: object + waitForInitialRestore: + type: boolean + type: object initConfig: properties: pgpoolConfig: diff --git a/vendor/kubedb.dev/apimachinery/crds/kubedb.com_clickhouses.yaml b/vendor/kubedb.dev/apimachinery/crds/kubedb.com_clickhouses.yaml index 53d474aae..ff57777e2 100644 --- a/vendor/kubedb.dev/apimachinery/crds/kubedb.com_clickhouses.yaml +++ b/vendor/kubedb.dev/apimachinery/crds/kubedb.com_clickhouses.yaml @@ -3280,3202 +3280,3200 @@ spec: type: object type: object cluster: - items: - properties: - name: - type: string - podTemplate: - properties: - controller: - properties: - annotations: - additionalProperties: - type: string - type: object - labels: - additionalProperties: - type: string - type: object - type: object - metadata: - properties: - annotations: - additionalProperties: - type: string - type: object - labels: - additionalProperties: - type: string - type: object - type: object - spec: - properties: - activeDeadlineSeconds: - format: int64 - type: integer - automountServiceAccountToken: - type: boolean - containers: - items: - properties: - args: - items: - type: string - type: array - x-kubernetes-list-type: atomic - command: - items: - type: string - type: array - x-kubernetes-list-type: atomic - env: - items: - properties: - name: - type: string - value: - type: string - valueFrom: - properties: - configMapKeyRef: - properties: - key: - type: string - name: - default: "" - type: string - optional: - type: boolean - required: - - key - type: object - x-kubernetes-map-type: atomic - fieldRef: - properties: - apiVersion: - type: string - fieldPath: - type: string - required: - - fieldPath - type: object - x-kubernetes-map-type: atomic - resourceFieldRef: - properties: - containerName: - type: string - divisor: - anyOf: - - type: integer - - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ - x-kubernetes-int-or-string: true - resource: - type: string - required: - - resource - type: object - x-kubernetes-map-type: atomic - secretKeyRef: - properties: - key: - type: string - name: - default: "" - type: string - optional: - type: boolean - required: - - key - type: object - x-kubernetes-map-type: atomic - type: object - required: - - name - type: object - type: array - x-kubernetes-list-map-keys: - - name - x-kubernetes-list-type: map - envFrom: - items: - properties: - configMapRef: - properties: - name: - default: "" - type: string - optional: - type: boolean - type: object - x-kubernetes-map-type: atomic - prefix: - type: string - secretRef: - properties: - name: - default: "" - type: string - optional: - type: boolean - type: object - x-kubernetes-map-type: atomic - type: object - type: array - x-kubernetes-list-type: atomic - image: + properties: + name: + type: string + podTemplate: + properties: + controller: + properties: + annotations: + additionalProperties: + type: string + type: object + labels: + additionalProperties: + type: string + type: object + type: object + metadata: + properties: + annotations: + additionalProperties: + type: string + type: object + labels: + additionalProperties: + type: string + type: object + type: object + spec: + properties: + activeDeadlineSeconds: + format: int64 + type: integer + automountServiceAccountToken: + type: boolean + containers: + items: + properties: + args: + items: type: string - imagePullPolicy: + type: array + x-kubernetes-list-type: atomic + command: + items: type: string - lifecycle: + type: array + x-kubernetes-list-type: atomic + env: + items: properties: - postStart: + name: + type: string + value: + type: string + valueFrom: properties: - exec: - properties: - command: - items: - type: string - type: array - x-kubernetes-list-type: atomic - type: object - httpGet: + configMapKeyRef: properties: - host: - type: string - httpHeaders: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - path: + key: type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - scheme: + name: + default: "" type: string + optional: + type: boolean required: - - port - type: object - sleep: - properties: - seconds: - format: int64 - type: integer - required: - - seconds + - key type: object - tcpSocket: + x-kubernetes-map-type: atomic + fieldRef: properties: - host: + apiVersion: + type: string + fieldPath: type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true required: - - port - type: object - type: object - preStop: - properties: - exec: - properties: - command: - items: - type: string - type: array - x-kubernetes-list-type: atomic + - fieldPath type: object - httpGet: + x-kubernetes-map-type: atomic + resourceFieldRef: properties: - host: - type: string - httpHeaders: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - path: + containerName: type: string - port: + divisor: anyOf: - type: integer - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ x-kubernetes-int-or-string: true - scheme: + resource: type: string required: - - port - type: object - sleep: - properties: - seconds: - format: int64 - type: integer - required: - - seconds + - resource type: object - tcpSocket: + x-kubernetes-map-type: atomic + secretKeyRef: properties: - host: + key: type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true + name: + default: "" + type: string + optional: + type: boolean required: - - port + - key type: object + x-kubernetes-map-type: atomic type: object + required: + - name type: object - livenessProbe: + type: array + x-kubernetes-list-map-keys: + - name + x-kubernetes-list-type: map + envFrom: + items: properties: - exec: - properties: - command: - items: - type: string - type: array - x-kubernetes-list-type: atomic - type: object - failureThreshold: - format: int32 - type: integer - grpc: + configMapRef: properties: - port: - format: int32 - type: integer - service: + name: default: "" type: string - required: - - port + optional: + type: boolean type: object - httpGet: + x-kubernetes-map-type: atomic + prefix: + type: string + secretRef: properties: - host: + name: + default: "" type: string - httpHeaders: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - path: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - scheme: - type: string - required: - - port - type: object - initialDelaySeconds: - format: int32 - type: integer - periodSeconds: - format: int32 - type: integer - successThreshold: - format: int32 - type: integer - tcpSocket: - properties: - host: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - required: - - port + optional: + type: boolean type: object - terminationGracePeriodSeconds: - format: int64 - type: integer - timeoutSeconds: - format: int32 - type: integer + x-kubernetes-map-type: atomic type: object - name: - type: string - ports: - items: + type: array + x-kubernetes-list-type: atomic + image: + type: string + imagePullPolicy: + type: string + lifecycle: + properties: + postStart: + properties: + exec: + properties: + command: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + httpGet: + properties: + host: + type: string + httpHeaders: + items: + properties: + name: + type: string + value: + type: string + required: + - name + - value + type: object + type: array + x-kubernetes-list-type: atomic + path: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + scheme: + type: string + required: + - port + type: object + sleep: + properties: + seconds: + format: int64 + type: integer + required: + - seconds + type: object + tcpSocket: + properties: + host: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + required: + - port + type: object + type: object + preStop: + properties: + exec: + properties: + command: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + httpGet: + properties: + host: + type: string + httpHeaders: + items: + properties: + name: + type: string + value: + type: string + required: + - name + - value + type: object + type: array + x-kubernetes-list-type: atomic + path: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + scheme: + type: string + required: + - port + type: object + sleep: + properties: + seconds: + format: int64 + type: integer + required: + - seconds + type: object + tcpSocket: + properties: + host: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + required: + - port + type: object + type: object + type: object + livenessProbe: + properties: + exec: + properties: + command: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + failureThreshold: + format: int32 + type: integer + grpc: properties: - containerPort: + port: format: int32 type: integer - hostIP: + service: + default: "" type: string - hostPort: - format: int32 - type: integer - name: + required: + - port + type: object + httpGet: + properties: + host: + type: string + httpHeaders: + items: + properties: + name: + type: string + value: + type: string + required: + - name + - value + type: object + type: array + x-kubernetes-list-type: atomic + path: type: string - protocol: - default: TCP + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + scheme: type: string required: - - containerPort + - port type: object - type: array - x-kubernetes-list-map-keys: - - containerPort - - protocol - x-kubernetes-list-type: map - readinessProbe: + initialDelaySeconds: + format: int32 + type: integer + periodSeconds: + format: int32 + type: integer + successThreshold: + format: int32 + type: integer + tcpSocket: + properties: + host: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + required: + - port + type: object + terminationGracePeriodSeconds: + format: int64 + type: integer + timeoutSeconds: + format: int32 + type: integer + type: object + name: + type: string + ports: + items: properties: - exec: - properties: - command: - items: - type: string - type: array - x-kubernetes-list-type: atomic - type: object - failureThreshold: - format: int32 - type: integer - grpc: - properties: - port: - format: int32 - type: integer - service: - default: "" - type: string - required: - - port - type: object - httpGet: - properties: - host: - type: string - httpHeaders: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - path: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - scheme: - type: string - required: - - port - type: object - initialDelaySeconds: - format: int32 - type: integer - periodSeconds: + containerPort: format: int32 type: integer - successThreshold: + hostIP: + type: string + hostPort: format: int32 type: integer - tcpSocket: - properties: - host: + name: + type: string + protocol: + default: TCP + type: string + required: + - containerPort + type: object + type: array + x-kubernetes-list-map-keys: + - containerPort + - protocol + x-kubernetes-list-type: map + readinessProbe: + properties: + exec: + properties: + command: + items: type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - required: - - port - type: object - terminationGracePeriodSeconds: - format: int64 - type: integer - timeoutSeconds: - format: int32 - type: integer - type: object - resizePolicy: - items: + type: array + x-kubernetes-list-type: atomic + type: object + failureThreshold: + format: int32 + type: integer + grpc: properties: - resourceName: - type: string - restartPolicy: + port: + format: int32 + type: integer + service: + default: "" type: string required: - - resourceName - - restartPolicy + - port type: object - type: array - x-kubernetes-list-type: atomic - resources: - properties: - claims: - items: - properties: - name: - type: string - request: - type: string - required: - - name - type: object - type: array - x-kubernetes-list-map-keys: - - name - x-kubernetes-list-type: map - limits: - additionalProperties: + httpGet: + properties: + host: + type: string + httpHeaders: + items: + properties: + name: + type: string + value: + type: string + required: + - name + - value + type: object + type: array + x-kubernetes-list-type: atomic + path: + type: string + port: anyOf: - type: integer - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ x-kubernetes-int-or-string: true - type: object - requests: - additionalProperties: + scheme: + type: string + required: + - port + type: object + initialDelaySeconds: + format: int32 + type: integer + periodSeconds: + format: int32 + type: integer + successThreshold: + format: int32 + type: integer + tcpSocket: + properties: + host: + type: string + port: anyOf: - type: integer - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ x-kubernetes-int-or-string: true - type: object - type: object - restartPolicy: - type: string - securityContext: + required: + - port + type: object + terminationGracePeriodSeconds: + format: int64 + type: integer + timeoutSeconds: + format: int32 + type: integer + type: object + resizePolicy: + items: properties: - allowPrivilegeEscalation: - type: boolean - appArmorProfile: - properties: - localhostProfile: - type: string - type: - type: string - required: - - type - type: object - capabilities: - properties: - add: - items: - type: string - type: array - x-kubernetes-list-type: atomic - drop: - items: - type: string - type: array - x-kubernetes-list-type: atomic - type: object - privileged: - type: boolean - procMount: + resourceName: type: string - readOnlyRootFilesystem: - type: boolean - runAsGroup: - format: int64 - type: integer - runAsNonRoot: - type: boolean - runAsUser: - format: int64 - type: integer - seLinuxOptions: - properties: - level: - type: string - role: - type: string - type: - type: string - user: - type: string - type: object - seccompProfile: - properties: - localhostProfile: - type: string - type: - type: string - required: - - type - type: object - windowsOptions: - properties: - gmsaCredentialSpec: - type: string - gmsaCredentialSpecName: - type: string - hostProcess: - type: boolean - runAsUserName: - type: string - type: object + restartPolicy: + type: string + required: + - resourceName + - restartPolicy type: object - startupProbe: - properties: - exec: - properties: - command: - items: - type: string - type: array - x-kubernetes-list-type: atomic - type: object - failureThreshold: - format: int32 - type: integer - grpc: - properties: - port: - format: int32 - type: integer - service: - default: "" - type: string - required: - - port - type: object - httpGet: + type: array + x-kubernetes-list-type: atomic + resources: + properties: + claims: + items: properties: - host: - type: string - httpHeaders: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - path: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - scheme: + name: type: string - required: - - port - type: object - initialDelaySeconds: - format: int32 - type: integer - periodSeconds: - format: int32 - type: integer - successThreshold: - format: int32 - type: integer - tcpSocket: - properties: - host: + request: type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true required: - - port + - name type: object - terminationGracePeriodSeconds: - format: int64 - type: integer - timeoutSeconds: - format: int32 - type: integer - type: object - stdin: - type: boolean - stdinOnce: - type: boolean - terminationMessagePath: - type: string - terminationMessagePolicy: - type: string - tty: - type: boolean - volumeDevices: - items: + type: array + x-kubernetes-list-map-keys: + - name + x-kubernetes-list-type: map + limits: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + requests: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + type: object + restartPolicy: + type: string + securityContext: + properties: + allowPrivilegeEscalation: + type: boolean + appArmorProfile: properties: - devicePath: + localhostProfile: type: string - name: + type: type: string required: - - devicePath - - name + - type type: object - type: array - x-kubernetes-list-map-keys: - - devicePath - x-kubernetes-list-type: map - volumeMounts: - items: + capabilities: + properties: + add: + items: + type: string + type: array + x-kubernetes-list-type: atomic + drop: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + privileged: + type: boolean + procMount: + type: string + readOnlyRootFilesystem: + type: boolean + runAsGroup: + format: int64 + type: integer + runAsNonRoot: + type: boolean + runAsUser: + format: int64 + type: integer + seLinuxOptions: properties: - mountPath: + level: type: string - mountPropagation: + role: type: string - name: + type: type: string - readOnly: - type: boolean - recursiveReadOnly: + user: type: string - subPath: + type: object + seccompProfile: + properties: + localhostProfile: type: string - subPathExpr: + type: type: string required: - - mountPath - - name + - type type: object - type: array - x-kubernetes-list-map-keys: - - mountPath - x-kubernetes-list-type: map - workingDir: - type: string - required: - - name - type: object - type: array - dnsConfig: - properties: - nameservers: - items: - type: string - type: array - x-kubernetes-list-type: atomic - options: - items: - properties: - name: - type: string - value: - type: string - type: object - type: array - x-kubernetes-list-type: atomic - searches: - items: - type: string - type: array - x-kubernetes-list-type: atomic - type: object - dnsPolicy: - type: string - enableServiceLinks: - type: boolean - ephemeralContainers: - items: - properties: - args: - items: - type: string - type: array - x-kubernetes-list-type: atomic - command: - items: - type: string - type: array - x-kubernetes-list-type: atomic - env: - items: + windowsOptions: properties: - name: + gmsaCredentialSpec: type: string - value: + gmsaCredentialSpecName: + type: string + hostProcess: + type: boolean + runAsUserName: + type: string + type: object + type: object + startupProbe: + properties: + exec: + properties: + command: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + failureThreshold: + format: int32 + type: integer + grpc: + properties: + port: + format: int32 + type: integer + service: + default: "" type: string - valueFrom: - properties: - configMapKeyRef: - properties: - key: - type: string - name: - default: "" - type: string - optional: - type: boolean - required: - - key - type: object - x-kubernetes-map-type: atomic - fieldRef: - properties: - apiVersion: - type: string - fieldPath: - type: string - required: - - fieldPath - type: object - x-kubernetes-map-type: atomic - resourceFieldRef: - properties: - containerName: - type: string - divisor: - anyOf: - - type: integer - - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ - x-kubernetes-int-or-string: true - resource: - type: string - required: - - resource - type: object - x-kubernetes-map-type: atomic - secretKeyRef: - properties: - key: - type: string - name: - default: "" - type: string - optional: - type: boolean - required: - - key - type: object - x-kubernetes-map-type: atomic - type: object required: - - name + - port type: object - type: array - x-kubernetes-list-map-keys: - - name - x-kubernetes-list-type: map - envFrom: - items: + httpGet: properties: - configMapRef: - properties: - name: - default: "" - type: string - optional: - type: boolean - type: object - x-kubernetes-map-type: atomic - prefix: + host: type: string - secretRef: - properties: - name: - default: "" - type: string - optional: - type: boolean - type: object - x-kubernetes-map-type: atomic + httpHeaders: + items: + properties: + name: + type: string + value: + type: string + required: + - name + - value + type: object + type: array + x-kubernetes-list-type: atomic + path: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + scheme: + type: string + required: + - port type: object - type: array - x-kubernetes-list-type: atomic - image: + initialDelaySeconds: + format: int32 + type: integer + periodSeconds: + format: int32 + type: integer + successThreshold: + format: int32 + type: integer + tcpSocket: + properties: + host: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + required: + - port + type: object + terminationGracePeriodSeconds: + format: int64 + type: integer + timeoutSeconds: + format: int32 + type: integer + type: object + stdin: + type: boolean + stdinOnce: + type: boolean + terminationMessagePath: + type: string + terminationMessagePolicy: + type: string + tty: + type: boolean + volumeDevices: + items: + properties: + devicePath: + type: string + name: + type: string + required: + - devicePath + - name + type: object + type: array + x-kubernetes-list-map-keys: + - devicePath + x-kubernetes-list-type: map + volumeMounts: + items: + properties: + mountPath: + type: string + mountPropagation: + type: string + name: + type: string + readOnly: + type: boolean + recursiveReadOnly: + type: string + subPath: + type: string + subPathExpr: + type: string + required: + - mountPath + - name + type: object + type: array + x-kubernetes-list-map-keys: + - mountPath + x-kubernetes-list-type: map + workingDir: + type: string + required: + - name + type: object + type: array + dnsConfig: + properties: + nameservers: + items: + type: string + type: array + x-kubernetes-list-type: atomic + options: + items: + properties: + name: + type: string + value: + type: string + type: object + type: array + x-kubernetes-list-type: atomic + searches: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + dnsPolicy: + type: string + enableServiceLinks: + type: boolean + ephemeralContainers: + items: + properties: + args: + items: type: string - imagePullPolicy: + type: array + x-kubernetes-list-type: atomic + command: + items: type: string - lifecycle: + type: array + x-kubernetes-list-type: atomic + env: + items: properties: - postStart: + name: + type: string + value: + type: string + valueFrom: properties: - exec: - properties: - command: - items: - type: string - type: array - x-kubernetes-list-type: atomic - type: object - httpGet: + configMapKeyRef: properties: - host: - type: string - httpHeaders: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - path: + key: type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - scheme: + name: + default: "" type: string + optional: + type: boolean required: - - port + - key type: object - sleep: + x-kubernetes-map-type: atomic + fieldRef: properties: - seconds: - format: int64 - type: integer + apiVersion: + type: string + fieldPath: + type: string required: - - seconds + - fieldPath type: object - tcpSocket: + x-kubernetes-map-type: atomic + resourceFieldRef: properties: - host: + containerName: type: string - port: + divisor: anyOf: - type: integer - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ x-kubernetes-int-or-string: true + resource: + type: string required: - - port - type: object - type: object - preStop: - properties: - exec: - properties: - command: - items: - type: string - type: array - x-kubernetes-list-type: atomic + - resource type: object - httpGet: + x-kubernetes-map-type: atomic + secretKeyRef: properties: - host: + key: type: string - httpHeaders: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - path: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - scheme: - type: string - required: - - port - type: object - sleep: - properties: - seconds: - format: int64 - type: integer - required: - - seconds - type: object - tcpSocket: - properties: - host: + name: + default: "" type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true + optional: + type: boolean required: - - port + - key type: object + x-kubernetes-map-type: atomic type: object + required: + - name type: object - livenessProbe: + type: array + x-kubernetes-list-map-keys: + - name + x-kubernetes-list-type: map + envFrom: + items: properties: - exec: - properties: - command: - items: - type: string - type: array - x-kubernetes-list-type: atomic - type: object - failureThreshold: - format: int32 - type: integer - grpc: + configMapRef: properties: - port: - format: int32 - type: integer - service: + name: default: "" type: string - required: - - port - type: object - httpGet: - properties: - host: - type: string - httpHeaders: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - path: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - scheme: - type: string - required: - - port - type: object - initialDelaySeconds: - format: int32 - type: integer - periodSeconds: - format: int32 - type: integer - successThreshold: - format: int32 - type: integer - tcpSocket: - properties: - host: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - required: - - port - type: object - terminationGracePeriodSeconds: - format: int64 - type: integer - timeoutSeconds: - format: int32 - type: integer - type: object - name: - type: string - ports: - items: - properties: - containerPort: - format: int32 - type: integer - hostIP: - type: string - hostPort: - format: int32 - type: integer - name: - type: string - protocol: - default: TCP - type: string - required: - - containerPort - type: object - type: array - x-kubernetes-list-map-keys: - - containerPort - - protocol - x-kubernetes-list-type: map - readinessProbe: - properties: - exec: - properties: - command: - items: - type: string - type: array - x-kubernetes-list-type: atomic + optional: + type: boolean type: object - failureThreshold: - format: int32 - type: integer - grpc: + x-kubernetes-map-type: atomic + prefix: + type: string + secretRef: properties: - port: - format: int32 - type: integer - service: + name: default: "" type: string - required: - - port - type: object - httpGet: - properties: - host: - type: string - httpHeaders: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - path: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - scheme: - type: string - required: - - port - type: object - initialDelaySeconds: - format: int32 - type: integer - periodSeconds: - format: int32 - type: integer - successThreshold: - format: int32 - type: integer - tcpSocket: - properties: - host: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - required: - - port + optional: + type: boolean type: object - terminationGracePeriodSeconds: - format: int64 - type: integer - timeoutSeconds: - format: int32 - type: integer + x-kubernetes-map-type: atomic type: object - resizePolicy: - items: + type: array + x-kubernetes-list-type: atomic + image: + type: string + imagePullPolicy: + type: string + lifecycle: + properties: + postStart: properties: - resourceName: - type: string - restartPolicy: - type: string - required: - - resourceName - - restartPolicy - type: object - type: array - x-kubernetes-list-type: atomic - resources: - properties: - claims: - items: + exec: properties: - name: + command: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + httpGet: + properties: + host: + type: string + httpHeaders: + items: + properties: + name: + type: string + value: + type: string + required: + - name + - value + type: object + type: array + x-kubernetes-list-type: atomic + path: type: string - request: + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + scheme: type: string required: - - name + - port type: object - type: array - x-kubernetes-list-map-keys: - - name - x-kubernetes-list-type: map - limits: - additionalProperties: - anyOf: - - type: integer - - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ - x-kubernetes-int-or-string: true - type: object - requests: - additionalProperties: - anyOf: - - type: integer - - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ - x-kubernetes-int-or-string: true - type: object - type: object - restartPolicy: - type: string - securityContext: - properties: - allowPrivilegeEscalation: - type: boolean - appArmorProfile: - properties: - localhostProfile: - type: string - type: - type: string - required: - - type - type: object - capabilities: - properties: - add: - items: - type: string - type: array - x-kubernetes-list-type: atomic - drop: - items: + sleep: + properties: + seconds: + format: int64 + type: integer + required: + - seconds + type: object + tcpSocket: + properties: + host: type: string - type: array - x-kubernetes-list-type: atomic - type: object - privileged: - type: boolean - procMount: - type: string - readOnlyRootFilesystem: - type: boolean - runAsGroup: - format: int64 - type: integer - runAsNonRoot: - type: boolean - runAsUser: - format: int64 - type: integer - seLinuxOptions: - properties: - level: - type: string - role: - type: string - type: - type: string - user: - type: string - type: object - seccompProfile: - properties: - localhostProfile: - type: string - type: - type: string - required: - - type - type: object - windowsOptions: - properties: - gmsaCredentialSpec: - type: string - gmsaCredentialSpecName: - type: string - hostProcess: - type: boolean - runAsUserName: - type: string - type: object - type: object - startupProbe: - properties: - exec: - properties: - command: - items: + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + required: + - port + type: object + type: object + preStop: + properties: + exec: + properties: + command: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + httpGet: + properties: + host: type: string - type: array - x-kubernetes-list-type: atomic - type: object - failureThreshold: - format: int32 - type: integer - grpc: - properties: - port: - format: int32 - type: integer - service: - default: "" - type: string - required: - - port - type: object - httpGet: - properties: - host: - type: string - httpHeaders: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - path: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - scheme: + httpHeaders: + items: + properties: + name: + type: string + value: + type: string + required: + - name + - value + type: object + type: array + x-kubernetes-list-type: atomic + path: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + scheme: + type: string + required: + - port + type: object + sleep: + properties: + seconds: + format: int64 + type: integer + required: + - seconds + type: object + tcpSocket: + properties: + host: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + required: + - port + type: object + type: object + type: object + livenessProbe: + properties: + exec: + properties: + command: + items: type: string - required: - - port - type: object - initialDelaySeconds: - format: int32 - type: integer - periodSeconds: - format: int32 - type: integer - successThreshold: + type: array + x-kubernetes-list-type: atomic + type: object + failureThreshold: + format: int32 + type: integer + grpc: + properties: + port: + format: int32 + type: integer + service: + default: "" + type: string + required: + - port + type: object + httpGet: + properties: + host: + type: string + httpHeaders: + items: + properties: + name: + type: string + value: + type: string + required: + - name + - value + type: object + type: array + x-kubernetes-list-type: atomic + path: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + scheme: + type: string + required: + - port + type: object + initialDelaySeconds: + format: int32 + type: integer + periodSeconds: + format: int32 + type: integer + successThreshold: + format: int32 + type: integer + tcpSocket: + properties: + host: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + required: + - port + type: object + terminationGracePeriodSeconds: + format: int64 + type: integer + timeoutSeconds: + format: int32 + type: integer + type: object + name: + type: string + ports: + items: + properties: + containerPort: format: int32 type: integer - tcpSocket: - properties: - host: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - required: - - port - type: object - terminationGracePeriodSeconds: - format: int64 - type: integer - timeoutSeconds: + hostIP: + type: string + hostPort: format: int32 type: integer + name: + type: string + protocol: + default: TCP + type: string + required: + - containerPort type: object - stdin: - type: boolean - stdinOnce: - type: boolean - targetContainerName: - type: string - terminationMessagePath: - type: string - terminationMessagePolicy: - type: string - tty: - type: boolean - volumeDevices: - items: + type: array + x-kubernetes-list-map-keys: + - containerPort + - protocol + x-kubernetes-list-type: map + readinessProbe: + properties: + exec: properties: - devicePath: - type: string - name: + command: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + failureThreshold: + format: int32 + type: integer + grpc: + properties: + port: + format: int32 + type: integer + service: + default: "" type: string required: - - devicePath - - name + - port type: object - type: array - x-kubernetes-list-map-keys: - - devicePath - x-kubernetes-list-type: map - volumeMounts: - items: + httpGet: properties: - mountPath: - type: string - mountPropagation: - type: string - name: + host: type: string - readOnly: - type: boolean - recursiveReadOnly: + httpHeaders: + items: + properties: + name: + type: string + value: + type: string + required: + - name + - value + type: object + type: array + x-kubernetes-list-type: atomic + path: type: string - subPath: + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + scheme: type: string - subPathExpr: + required: + - port + type: object + initialDelaySeconds: + format: int32 + type: integer + periodSeconds: + format: int32 + type: integer + successThreshold: + format: int32 + type: integer + tcpSocket: + properties: + host: type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true required: - - mountPath - - name + - port type: object - type: array - x-kubernetes-list-map-keys: - - mountPath - x-kubernetes-list-type: map - workingDir: - type: string - required: - - name - type: object - type: array - hostAliases: - items: - properties: - hostnames: - items: - type: string - type: array - x-kubernetes-list-type: atomic - ip: - type: string - required: - - ip - type: object - type: array - hostIPC: - type: boolean - hostNetwork: - type: boolean - hostPID: - type: boolean - hostUsers: - type: boolean - imagePullSecrets: - items: - properties: - name: - default: "" - type: string - type: object - x-kubernetes-map-type: atomic - type: array - initContainers: - items: - properties: - args: - items: - type: string - type: array - x-kubernetes-list-type: atomic - command: - items: + terminationGracePeriodSeconds: + format: int64 + type: integer + timeoutSeconds: + format: int32 + type: integer + type: object + resizePolicy: + items: + properties: + resourceName: + type: string + restartPolicy: + type: string + required: + - resourceName + - restartPolicy + type: object + type: array + x-kubernetes-list-type: atomic + resources: + properties: + claims: + items: + properties: + name: + type: string + request: + type: string + required: + - name + type: object + type: array + x-kubernetes-list-map-keys: + - name + x-kubernetes-list-type: map + limits: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + requests: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + type: object + restartPolicy: + type: string + securityContext: + properties: + allowPrivilegeEscalation: + type: boolean + appArmorProfile: + properties: + localhostProfile: + type: string + type: + type: string + required: + - type + type: object + capabilities: + properties: + add: + items: + type: string + type: array + x-kubernetes-list-type: atomic + drop: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + privileged: + type: boolean + procMount: type: string - type: array - x-kubernetes-list-type: atomic - env: - items: + readOnlyRootFilesystem: + type: boolean + runAsGroup: + format: int64 + type: integer + runAsNonRoot: + type: boolean + runAsUser: + format: int64 + type: integer + seLinuxOptions: properties: - name: + level: type: string - value: + role: + type: string + type: + type: string + user: + type: string + type: object + seccompProfile: + properties: + localhostProfile: + type: string + type: type: string - valueFrom: - properties: - configMapKeyRef: - properties: - key: - type: string - name: - default: "" - type: string - optional: - type: boolean - required: - - key - type: object - x-kubernetes-map-type: atomic - fieldRef: - properties: - apiVersion: - type: string - fieldPath: - type: string - required: - - fieldPath - type: object - x-kubernetes-map-type: atomic - resourceFieldRef: - properties: - containerName: - type: string - divisor: - anyOf: - - type: integer - - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ - x-kubernetes-int-or-string: true - resource: - type: string - required: - - resource - type: object - x-kubernetes-map-type: atomic - secretKeyRef: - properties: - key: - type: string - name: - default: "" - type: string - optional: - type: boolean - required: - - key - type: object - x-kubernetes-map-type: atomic - type: object required: - - name + - type type: object - type: array - x-kubernetes-list-map-keys: - - name - x-kubernetes-list-type: map - envFrom: - items: + windowsOptions: properties: - configMapRef: - properties: - name: - default: "" - type: string - optional: - type: boolean - type: object - x-kubernetes-map-type: atomic - prefix: + gmsaCredentialSpec: + type: string + gmsaCredentialSpecName: + type: string + hostProcess: + type: boolean + runAsUserName: type: string - secretRef: - properties: - name: - default: "" - type: string - optional: - type: boolean - type: object - x-kubernetes-map-type: atomic type: object - type: array - x-kubernetes-list-type: atomic - image: - type: string - imagePullPolicy: - type: string - lifecycle: - properties: - postStart: - properties: - exec: - properties: - command: - items: - type: string - type: array - x-kubernetes-list-type: atomic - type: object - httpGet: + type: object + startupProbe: + properties: + exec: + properties: + command: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + failureThreshold: + format: int32 + type: integer + grpc: + properties: + port: + format: int32 + type: integer + service: + default: "" + type: string + required: + - port + type: object + httpGet: + properties: + host: + type: string + httpHeaders: + items: properties: - host: - type: string - httpHeaders: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - path: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - scheme: + name: type: string - required: - - port - type: object - sleep: - properties: - seconds: - format: int64 - type: integer - required: - - seconds - type: object - tcpSocket: - properties: - host: + value: type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true required: - - port - type: object - type: object - preStop: - properties: - exec: - properties: - command: - items: - type: string - type: array - x-kubernetes-list-type: atomic + - name + - value type: object - httpGet: - properties: - host: - type: string - httpHeaders: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - path: + type: array + x-kubernetes-list-type: atomic + path: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + scheme: + type: string + required: + - port + type: object + initialDelaySeconds: + format: int32 + type: integer + periodSeconds: + format: int32 + type: integer + successThreshold: + format: int32 + type: integer + tcpSocket: + properties: + host: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + required: + - port + type: object + terminationGracePeriodSeconds: + format: int64 + type: integer + timeoutSeconds: + format: int32 + type: integer + type: object + stdin: + type: boolean + stdinOnce: + type: boolean + targetContainerName: + type: string + terminationMessagePath: + type: string + terminationMessagePolicy: + type: string + tty: + type: boolean + volumeDevices: + items: + properties: + devicePath: + type: string + name: + type: string + required: + - devicePath + - name + type: object + type: array + x-kubernetes-list-map-keys: + - devicePath + x-kubernetes-list-type: map + volumeMounts: + items: + properties: + mountPath: + type: string + mountPropagation: + type: string + name: + type: string + readOnly: + type: boolean + recursiveReadOnly: + type: string + subPath: + type: string + subPathExpr: + type: string + required: + - mountPath + - name + type: object + type: array + x-kubernetes-list-map-keys: + - mountPath + x-kubernetes-list-type: map + workingDir: + type: string + required: + - name + type: object + type: array + hostAliases: + items: + properties: + hostnames: + items: + type: string + type: array + x-kubernetes-list-type: atomic + ip: + type: string + required: + - ip + type: object + type: array + hostIPC: + type: boolean + hostNetwork: + type: boolean + hostPID: + type: boolean + hostUsers: + type: boolean + imagePullSecrets: + items: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + type: array + initContainers: + items: + properties: + args: + items: + type: string + type: array + x-kubernetes-list-type: atomic + command: + items: + type: string + type: array + x-kubernetes-list-type: atomic + env: + items: + properties: + name: + type: string + value: + type: string + valueFrom: + properties: + configMapKeyRef: + properties: + key: type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - scheme: + name: + default: "" type: string + optional: + type: boolean required: - - port + - key type: object - sleep: + x-kubernetes-map-type: atomic + fieldRef: properties: - seconds: - format: int64 - type: integer + apiVersion: + type: string + fieldPath: + type: string required: - - seconds + - fieldPath type: object - tcpSocket: + x-kubernetes-map-type: atomic + resourceFieldRef: properties: - host: + containerName: type: string - port: + divisor: anyOf: - type: integer - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ x-kubernetes-int-or-string: true + resource: + type: string + required: + - resource + type: object + x-kubernetes-map-type: atomic + secretKeyRef: + properties: + key: + type: string + name: + default: "" + type: string + optional: + type: boolean required: - - port + - key type: object + x-kubernetes-map-type: atomic type: object + required: + - name type: object - livenessProbe: + type: array + x-kubernetes-list-map-keys: + - name + x-kubernetes-list-type: map + envFrom: + items: properties: - exec: - properties: - command: - items: - type: string - type: array - x-kubernetes-list-type: atomic - type: object - failureThreshold: - format: int32 - type: integer - grpc: + configMapRef: properties: - port: - format: int32 - type: integer - service: + name: default: "" type: string - required: - - port - type: object - httpGet: - properties: - host: - type: string - httpHeaders: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - path: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - scheme: - type: string - required: - - port + optional: + type: boolean type: object - initialDelaySeconds: - format: int32 - type: integer - periodSeconds: - format: int32 - type: integer - successThreshold: - format: int32 - type: integer - tcpSocket: + x-kubernetes-map-type: atomic + prefix: + type: string + secretRef: properties: - host: + name: + default: "" type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - required: - - port + optional: + type: boolean type: object - terminationGracePeriodSeconds: - format: int64 - type: integer - timeoutSeconds: - format: int32 - type: integer + x-kubernetes-map-type: atomic type: object - name: - type: string - ports: - items: + type: array + x-kubernetes-list-type: atomic + image: + type: string + imagePullPolicy: + type: string + lifecycle: + properties: + postStart: properties: - containerPort: - format: int32 - type: integer - hostIP: - type: string - hostPort: - format: int32 - type: integer - name: - type: string - protocol: - default: TCP - type: string - required: - - containerPort - type: object - type: array - x-kubernetes-list-map-keys: - - containerPort - - protocol - x-kubernetes-list-type: map - readinessProbe: - properties: - exec: - properties: - command: - items: + exec: + properties: + command: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + httpGet: + properties: + host: type: string - type: array - x-kubernetes-list-type: atomic - type: object - failureThreshold: - format: int32 - type: integer - grpc: - properties: - port: - format: int32 - type: integer - service: - default: "" - type: string - required: - - port - type: object - httpGet: - properties: - host: - type: string - httpHeaders: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - path: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - scheme: + httpHeaders: + items: + properties: + name: + type: string + value: + type: string + required: + - name + - value + type: object + type: array + x-kubernetes-list-type: atomic + path: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + scheme: + type: string + required: + - port + type: object + sleep: + properties: + seconds: + format: int64 + type: integer + required: + - seconds + type: object + tcpSocket: + properties: + host: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + required: + - port + type: object + type: object + preStop: + properties: + exec: + properties: + command: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + httpGet: + properties: + host: + type: string + httpHeaders: + items: + properties: + name: + type: string + value: + type: string + required: + - name + - value + type: object + type: array + x-kubernetes-list-type: atomic + path: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + scheme: + type: string + required: + - port + type: object + sleep: + properties: + seconds: + format: int64 + type: integer + required: + - seconds + type: object + tcpSocket: + properties: + host: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + required: + - port + type: object + type: object + type: object + livenessProbe: + properties: + exec: + properties: + command: + items: type: string - required: - - port - type: object - initialDelaySeconds: - format: int32 - type: integer - periodSeconds: - format: int32 - type: integer - successThreshold: + type: array + x-kubernetes-list-type: atomic + type: object + failureThreshold: + format: int32 + type: integer + grpc: + properties: + port: + format: int32 + type: integer + service: + default: "" + type: string + required: + - port + type: object + httpGet: + properties: + host: + type: string + httpHeaders: + items: + properties: + name: + type: string + value: + type: string + required: + - name + - value + type: object + type: array + x-kubernetes-list-type: atomic + path: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + scheme: + type: string + required: + - port + type: object + initialDelaySeconds: + format: int32 + type: integer + periodSeconds: + format: int32 + type: integer + successThreshold: + format: int32 + type: integer + tcpSocket: + properties: + host: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + required: + - port + type: object + terminationGracePeriodSeconds: + format: int64 + type: integer + timeoutSeconds: + format: int32 + type: integer + type: object + name: + type: string + ports: + items: + properties: + containerPort: format: int32 type: integer - tcpSocket: - properties: - host: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - required: - - port - type: object - terminationGracePeriodSeconds: - format: int64 - type: integer - timeoutSeconds: + hostIP: + type: string + hostPort: format: int32 type: integer + name: + type: string + protocol: + default: TCP + type: string + required: + - containerPort type: object - resizePolicy: - items: + type: array + x-kubernetes-list-map-keys: + - containerPort + - protocol + x-kubernetes-list-type: map + readinessProbe: + properties: + exec: properties: - resourceName: - type: string - restartPolicy: + command: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + failureThreshold: + format: int32 + type: integer + grpc: + properties: + port: + format: int32 + type: integer + service: + default: "" type: string required: - - resourceName - - restartPolicy + - port type: object - type: array - x-kubernetes-list-type: atomic - resources: - properties: - claims: - items: - properties: - name: - type: string - request: - type: string - required: - - name - type: object - type: array - x-kubernetes-list-map-keys: - - name - x-kubernetes-list-type: map - limits: - additionalProperties: + httpGet: + properties: + host: + type: string + httpHeaders: + items: + properties: + name: + type: string + value: + type: string + required: + - name + - value + type: object + type: array + x-kubernetes-list-type: atomic + path: + type: string + port: anyOf: - type: integer - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ x-kubernetes-int-or-string: true - type: object - requests: - additionalProperties: + scheme: + type: string + required: + - port + type: object + initialDelaySeconds: + format: int32 + type: integer + periodSeconds: + format: int32 + type: integer + successThreshold: + format: int32 + type: integer + tcpSocket: + properties: + host: + type: string + port: anyOf: - type: integer - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ x-kubernetes-int-or-string: true - type: object - type: object - restartPolicy: - type: string - securityContext: + required: + - port + type: object + terminationGracePeriodSeconds: + format: int64 + type: integer + timeoutSeconds: + format: int32 + type: integer + type: object + resizePolicy: + items: properties: - allowPrivilegeEscalation: - type: boolean - appArmorProfile: + resourceName: + type: string + restartPolicy: + type: string + required: + - resourceName + - restartPolicy + type: object + type: array + x-kubernetes-list-type: atomic + resources: + properties: + claims: + items: properties: - localhostProfile: + name: type: string - type: + request: type: string required: - - type + - name type: object - capabilities: - properties: - add: - items: - type: string - type: array - x-kubernetes-list-type: atomic - drop: - items: - type: string - type: array - x-kubernetes-list-type: atomic - type: object - privileged: - type: boolean - procMount: - type: string - readOnlyRootFilesystem: - type: boolean - runAsGroup: - format: int64 - type: integer - runAsNonRoot: - type: boolean - runAsUser: - format: int64 - type: integer - seLinuxOptions: - properties: - level: - type: string - role: - type: string - type: - type: string - user: - type: string - type: object - seccompProfile: - properties: - localhostProfile: - type: string - type: - type: string - required: - - type - type: object - windowsOptions: - properties: - gmsaCredentialSpec: - type: string - gmsaCredentialSpecName: - type: string - hostProcess: - type: boolean - runAsUserName: - type: string - type: object - type: object - startupProbe: - properties: - exec: - properties: - command: - items: - type: string - type: array - x-kubernetes-list-type: atomic - type: object - failureThreshold: - format: int32 - type: integer - grpc: - properties: - port: - format: int32 - type: integer - service: - default: "" - type: string - required: - - port - type: object - httpGet: - properties: - host: - type: string - httpHeaders: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - path: - type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - scheme: + type: array + x-kubernetes-list-map-keys: + - name + x-kubernetes-list-type: map + limits: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + requests: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + type: object + restartPolicy: + type: string + securityContext: + properties: + allowPrivilegeEscalation: + type: boolean + appArmorProfile: + properties: + localhostProfile: + type: string + type: + type: string + required: + - type + type: object + capabilities: + properties: + add: + items: type: string - required: - - port - type: object - initialDelaySeconds: - format: int32 - type: integer - periodSeconds: - format: int32 - type: integer - successThreshold: - format: int32 - type: integer - tcpSocket: - properties: - host: + type: array + x-kubernetes-list-type: atomic + drop: + items: type: string - port: - anyOf: - - type: integer - - type: string - x-kubernetes-int-or-string: true - required: - - port - type: object - terminationGracePeriodSeconds: - format: int64 - type: integer - timeoutSeconds: - format: int32 - type: integer - type: object - stdin: - type: boolean - stdinOnce: - type: boolean - terminationMessagePath: - type: string - terminationMessagePolicy: - type: string - tty: - type: boolean - volumeDevices: - items: + type: array + x-kubernetes-list-type: atomic + type: object + privileged: + type: boolean + procMount: + type: string + readOnlyRootFilesystem: + type: boolean + runAsGroup: + format: int64 + type: integer + runAsNonRoot: + type: boolean + runAsUser: + format: int64 + type: integer + seLinuxOptions: properties: - devicePath: + level: type: string - name: + role: + type: string + type: + type: string + user: type: string - required: - - devicePath - - name type: object - type: array - x-kubernetes-list-map-keys: - - devicePath - x-kubernetes-list-type: map - volumeMounts: - items: + seccompProfile: properties: - mountPath: + localhostProfile: type: string - mountPropagation: + type: type: string - name: + required: + - type + type: object + windowsOptions: + properties: + gmsaCredentialSpec: type: string - readOnly: + gmsaCredentialSpecName: + type: string + hostProcess: type: boolean - recursiveReadOnly: + runAsUserName: + type: string + type: object + type: object + startupProbe: + properties: + exec: + properties: + command: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + failureThreshold: + format: int32 + type: integer + grpc: + properties: + port: + format: int32 + type: integer + service: + default: "" + type: string + required: + - port + type: object + httpGet: + properties: + host: type: string - subPath: + httpHeaders: + items: + properties: + name: + type: string + value: + type: string + required: + - name + - value + type: object + type: array + x-kubernetes-list-type: atomic + path: type: string - subPathExpr: + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + scheme: type: string required: - - mountPath - - name + - port type: object - type: array - x-kubernetes-list-map-keys: + initialDelaySeconds: + format: int32 + type: integer + periodSeconds: + format: int32 + type: integer + successThreshold: + format: int32 + type: integer + tcpSocket: + properties: + host: + type: string + port: + anyOf: + - type: integer + - type: string + x-kubernetes-int-or-string: true + required: + - port + type: object + terminationGracePeriodSeconds: + format: int64 + type: integer + timeoutSeconds: + format: int32 + type: integer + type: object + stdin: + type: boolean + stdinOnce: + type: boolean + terminationMessagePath: + type: string + terminationMessagePolicy: + type: string + tty: + type: boolean + volumeDevices: + items: + properties: + devicePath: + type: string + name: + type: string + required: + - devicePath + - name + type: object + type: array + x-kubernetes-list-map-keys: + - devicePath + x-kubernetes-list-type: map + volumeMounts: + items: + properties: + mountPath: + type: string + mountPropagation: + type: string + name: + type: string + readOnly: + type: boolean + recursiveReadOnly: + type: string + subPath: + type: string + subPathExpr: + type: string + required: - mountPath - x-kubernetes-list-type: map - workingDir: - type: string - required: - - name - type: object - type: array - nodeName: - type: string - nodeSelector: - additionalProperties: - type: string - type: object - x-kubernetes-map-type: atomic - os: - properties: - name: + - name + type: object + type: array + x-kubernetes-list-map-keys: + - mountPath + x-kubernetes-list-type: map + workingDir: type: string required: - name type: object - overhead: - additionalProperties: - anyOf: - - type: integer - - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ - x-kubernetes-int-or-string: true - type: object - podPlacementPolicy: - default: - name: default - properties: - name: - default: "" + type: array + nodeName: + type: string + nodeSelector: + additionalProperties: + type: string + type: object + x-kubernetes-map-type: atomic + os: + properties: + name: + type: string + required: + - name + type: object + overhead: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + podPlacementPolicy: + default: + name: default + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + preemptionPolicy: + type: string + priority: + format: int32 + type: integer + priorityClassName: + type: string + readinessGates: + items: + properties: + conditionType: type: string + required: + - conditionType type: object - x-kubernetes-map-type: atomic - preemptionPolicy: - type: string - priority: - format: int32 - type: integer - priorityClassName: - type: string - readinessGates: - items: + type: array + restartPolicy: + type: string + runtimeClassName: + type: string + schedulerName: + type: string + securityContext: + properties: + appArmorProfile: properties: - conditionType: + localhostProfile: + type: string + type: type: string required: - - conditionType + - type type: object - type: array - restartPolicy: - type: string - runtimeClassName: - type: string - schedulerName: - type: string - securityContext: - properties: - appArmorProfile: + fsGroup: + format: int64 + type: integer + fsGroupChangePolicy: + type: string + runAsGroup: + format: int64 + type: integer + runAsNonRoot: + type: boolean + runAsUser: + format: int64 + type: integer + seLinuxChangePolicy: + type: string + seLinuxOptions: + properties: + level: + type: string + role: + type: string + type: + type: string + user: + type: string + type: object + seccompProfile: + properties: + localhostProfile: + type: string + type: + type: string + required: + - type + type: object + supplementalGroups: + items: + format: int64 + type: integer + type: array + x-kubernetes-list-type: atomic + supplementalGroupsPolicy: + type: string + sysctls: + items: properties: - localhostProfile: + name: type: string - type: + value: type: string required: - - type + - name + - value type: object - fsGroup: - format: int64 - type: integer - fsGroupChangePolicy: + type: array + x-kubernetes-list-type: atomic + windowsOptions: + properties: + gmsaCredentialSpec: + type: string + gmsaCredentialSpecName: + type: string + hostProcess: + type: boolean + runAsUserName: + type: string + type: object + type: object + serviceAccountName: + type: string + setHostnameAsFQDN: + type: boolean + shareProcessNamespace: + type: boolean + terminationGracePeriodSeconds: + format: int64 + type: integer + tolerations: + items: + properties: + effect: type: string - runAsGroup: - format: int64 - type: integer - runAsNonRoot: - type: boolean - runAsUser: + key: + type: string + operator: + type: string + tolerationSeconds: format: int64 type: integer - seLinuxChangePolicy: + value: type: string - seLinuxOptions: + type: object + type: array + volumes: + items: + properties: + awsElasticBlockStore: properties: - level: + fsType: type: string - role: + partition: + format: int32 + type: integer + readOnly: + type: boolean + volumeID: type: string - type: + required: + - volumeID + type: object + azureDisk: + properties: + cachingMode: type: string - user: + diskName: + type: string + diskURI: type: string + fsType: + default: ext4 + type: string + kind: + type: string + readOnly: + default: false + type: boolean + required: + - diskName + - diskURI type: object - seccompProfile: + azureFile: properties: - localhostProfile: + readOnly: + type: boolean + secretName: type: string - type: + shareName: type: string required: - - type + - secretName + - shareName type: object - supplementalGroups: - items: - format: int64 - type: integer - type: array - x-kubernetes-list-type: atomic - supplementalGroupsPolicy: - type: string - sysctls: - items: - properties: - name: - type: string - value: - type: string - required: - - name - - value - type: object - type: array - x-kubernetes-list-type: atomic - windowsOptions: + cephfs: properties: - gmsaCredentialSpec: - type: string - gmsaCredentialSpecName: + monitors: + items: + type: string + type: array + x-kubernetes-list-type: atomic + path: type: string - hostProcess: + readOnly: type: boolean - runAsUserName: + secretFile: + type: string + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + user: type: string + required: + - monitors type: object - type: object - serviceAccountName: - type: string - setHostnameAsFQDN: - type: boolean - shareProcessNamespace: - type: boolean - terminationGracePeriodSeconds: - format: int64 - type: integer - tolerations: - items: - properties: - effect: - type: string - key: - type: string - operator: - type: string - tolerationSeconds: - format: int64 - type: integer - value: - type: string - type: object - type: array - volumes: - items: - properties: - awsElasticBlockStore: - properties: - fsType: - type: string - partition: - format: int32 - type: integer - readOnly: - type: boolean - volumeID: - type: string - required: - - volumeID - type: object - azureDisk: - properties: - cachingMode: - type: string - diskName: - type: string - diskURI: - type: string - fsType: - default: ext4 - type: string - kind: - type: string - readOnly: - default: false - type: boolean - required: - - diskName - - diskURI - type: object - azureFile: - properties: - readOnly: - type: boolean - secretName: - type: string - shareName: - type: string - required: - - secretName - - shareName - type: object - cephfs: - properties: - monitors: - items: + cinder: + properties: + fsType: + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" type: string - type: array - x-kubernetes-list-type: atomic - path: - type: string - readOnly: - type: boolean - secretFile: - type: string - secretRef: + type: object + x-kubernetes-map-type: atomic + volumeID: + type: string + required: + - volumeID + type: object + configMap: + properties: + defaultMode: + format: int32 + type: integer + items: + items: properties: - name: - default: "" + key: type: string - type: object - x-kubernetes-map-type: atomic - user: - type: string - required: - - monitors - type: object - cinder: - properties: - fsType: - type: string - readOnly: - type: boolean - secretRef: - properties: - name: - default: "" + mode: + format: int32 + type: integer + path: type: string + required: + - key + - path type: object - x-kubernetes-map-type: atomic - volumeID: - type: string - required: - - volumeID - type: object - configMap: - properties: - defaultMode: - format: int32 - type: integer - items: - items: - properties: - key: - type: string - mode: - format: int32 - type: integer - path: - type: string - required: - - key - - path - type: object - type: array - x-kubernetes-list-type: atomic - name: - default: "" - type: string - optional: - type: boolean - type: object - x-kubernetes-map-type: atomic - csi: - properties: - driver: - type: string - fsType: - type: string - nodePublishSecretRef: - properties: - name: - default: "" - type: string - type: object - x-kubernetes-map-type: atomic - readOnly: - type: boolean - volumeAttributes: - additionalProperties: + type: array + x-kubernetes-list-type: atomic + name: + default: "" + type: string + optional: + type: boolean + type: object + x-kubernetes-map-type: atomic + csi: + properties: + driver: + type: string + fsType: + type: string + nodePublishSecretRef: + properties: + name: + default: "" type: string - type: object - required: - - driver - type: object - downwardAPI: - properties: - defaultMode: - format: int32 - type: integer - items: - items: - properties: - fieldRef: - properties: - apiVersion: - type: string - fieldPath: - type: string - required: - - fieldPath - type: object - x-kubernetes-map-type: atomic - mode: - format: int32 - type: integer - path: - type: string - resourceFieldRef: - properties: - containerName: - type: string - divisor: - anyOf: - - type: integer - - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ - x-kubernetes-int-or-string: true - resource: - type: string - required: - - resource - type: object - x-kubernetes-map-type: atomic - required: - - path - type: object - type: array - x-kubernetes-list-type: atomic - type: object - emptyDir: - properties: - medium: + type: object + x-kubernetes-map-type: atomic + readOnly: + type: boolean + volumeAttributes: + additionalProperties: type: string - sizeLimit: - anyOf: - - type: integer - - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ - x-kubernetes-int-or-string: true - type: object - ephemeral: - properties: - volumeClaimTemplate: + type: object + required: + - driver + type: object + downwardAPI: + properties: + defaultMode: + format: int32 + type: integer + items: + items: properties: - metadata: + fieldRef: properties: - annotations: - additionalProperties: - type: string - type: object - generateName: - type: string - labels: - additionalProperties: - type: string - type: object - name: + apiVersion: type: string - namespace: + fieldPath: type: string - ownerReferences: - items: - properties: - apiVersion: - type: string - blockOwnerDeletion: - type: boolean - controller: - type: boolean - kind: - type: string - name: - type: string - uid: - type: string - required: - - apiVersion - - kind - - name - - uid - type: object - x-kubernetes-map-type: atomic - type: array + required: + - fieldPath type: object - spec: + x-kubernetes-map-type: atomic + mode: + format: int32 + type: integer + path: + type: string + resourceFieldRef: properties: - accessModes: - items: - type: string - type: array - x-kubernetes-list-type: atomic - dataSource: - properties: - apiGroup: - type: string - kind: - type: string - name: - type: string - required: - - kind - - name - type: object - x-kubernetes-map-type: atomic - dataSourceRef: + containerName: + type: string + divisor: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + resource: + type: string + required: + - resource + type: object + x-kubernetes-map-type: atomic + required: + - path + type: object + type: array + x-kubernetes-list-type: atomic + type: object + emptyDir: + properties: + medium: + type: string + sizeLimit: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + ephemeral: + properties: + volumeClaimTemplate: + properties: + metadata: + properties: + annotations: + additionalProperties: + type: string + type: object + generateName: + type: string + labels: + additionalProperties: + type: string + type: object + name: + type: string + namespace: + type: string + ownerReferences: + items: properties: - apiGroup: + apiVersion: type: string + blockOwnerDeletion: + type: boolean + controller: + type: boolean kind: type: string name: type: string - namespace: + uid: type: string required: + - apiVersion - kind - name - type: object - resources: - properties: - limits: - additionalProperties: - anyOf: - - type: integer - - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ - x-kubernetes-int-or-string: true - type: object - requests: - additionalProperties: - anyOf: - - type: integer - - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ - x-kubernetes-int-or-string: true - type: object - type: object - selector: - properties: - matchExpressions: - items: - properties: - key: - type: string - operator: - type: string - values: - items: - type: string - type: array - x-kubernetes-list-type: atomic - required: - - key - - operator - type: object - type: array - x-kubernetes-list-type: atomic - matchLabels: - additionalProperties: - type: string - type: object + - uid type: object x-kubernetes-map-type: atomic - storageClassName: - type: string - volumeAttributesClassName: - type: string - volumeMode: - type: string - volumeName: + type: array + type: object + spec: + properties: + accessModes: + items: type: string - type: object - required: - - spec - type: object - type: object - fc: - properties: - fsType: - type: string - lun: - format: int32 - type: integer - readOnly: - type: boolean - targetWWNs: - items: - type: string - type: array - x-kubernetes-list-type: atomic - wwids: - items: - type: string - type: array - x-kubernetes-list-type: atomic - type: object - flexVolume: - properties: - driver: - type: string - fsType: - type: string - options: - additionalProperties: - type: string - type: object - readOnly: - type: boolean - secretRef: - properties: - name: - default: "" - type: string - type: object - x-kubernetes-map-type: atomic - required: - - driver - type: object - flocker: - properties: - datasetName: - type: string - datasetUUID: - type: string - type: object - gcePersistentDisk: - properties: - fsType: - type: string - partition: - format: int32 - type: integer - pdName: - type: string - readOnly: - type: boolean - required: - - pdName - type: object - glusterfs: - properties: - endpoints: - type: string - path: - type: string - readOnly: - type: boolean - required: - - endpoints - - path - type: object - hostPath: - properties: - path: - type: string - type: - type: string - required: - - path - type: object - iscsi: - properties: - chapAuthDiscovery: - type: boolean - chapAuthSession: - type: boolean - fsType: - type: string - initiatorName: - type: string - iqn: - type: string - iscsiInterface: - default: default - type: string - lun: - format: int32 - type: integer - portals: - items: - type: string - type: array - x-kubernetes-list-type: atomic - readOnly: - type: boolean - secretRef: - properties: - name: - default: "" - type: string - type: object - x-kubernetes-map-type: atomic - targetPortal: - type: string - required: - - iqn - - lun - - targetPortal - type: object - name: - type: string - nfs: - properties: - path: - type: string - readOnly: - type: boolean - server: - type: string - required: - - path - - server - type: object - persistentVolumeClaim: - properties: - claimName: - type: string - readOnly: - type: boolean - required: - - claimName - type: object - photonPersistentDisk: - properties: - fsType: - type: string - pdID: - type: string - required: - - pdID - type: object - portworxVolume: - properties: - fsType: - type: string - readOnly: - type: boolean - volumeID: - type: string - required: - - volumeID - type: object - projected: - properties: - defaultMode: - format: int32 - type: integer - sources: - items: - properties: - clusterTrustBundle: + type: array + x-kubernetes-list-type: atomic + dataSource: properties: - labelSelector: - properties: - matchExpressions: - items: - properties: - key: - type: string - operator: - type: string - values: - items: - type: string - type: array - x-kubernetes-list-type: atomic - required: - - key - - operator - type: object - type: array - x-kubernetes-list-type: atomic - matchLabels: - additionalProperties: - type: string - type: object - type: object - x-kubernetes-map-type: atomic - name: + apiGroup: type: string - optional: - type: boolean - path: + kind: type: string - signerName: + name: type: string required: - - path + - kind + - name type: object - configMap: + x-kubernetes-map-type: atomic + dataSourceRef: properties: - items: - items: - properties: - key: - type: string - mode: - format: int32 - type: integer - path: - type: string - required: - - key - - path - type: object - type: array - x-kubernetes-list-type: atomic + apiGroup: + type: string + kind: + type: string name: - default: "" type: string - optional: - type: boolean + namespace: + type: string + required: + - kind + - name type: object - x-kubernetes-map-type: atomic - downwardAPI: + resources: properties: - items: - items: - properties: - fieldRef: - properties: - apiVersion: - type: string - fieldPath: - type: string - required: - - fieldPath - type: object - x-kubernetes-map-type: atomic - mode: - format: int32 - type: integer - path: - type: string - resourceFieldRef: - properties: - containerName: - type: string - divisor: - anyOf: - - type: integer - - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ - x-kubernetes-int-or-string: true - resource: - type: string - required: - - resource - type: object - x-kubernetes-map-type: atomic - required: - - path - type: object - type: array - x-kubernetes-list-type: atomic + limits: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + requests: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object type: object - secret: + selector: properties: - items: + matchExpressions: items: properties: key: type: string - mode: - format: int32 - type: integer - path: + operator: type: string + values: + items: + type: string + type: array + x-kubernetes-list-type: atomic required: - key - - path + - operator type: object type: array x-kubernetes-list-type: atomic - name: - default: "" - type: string - optional: - type: boolean + matchLabels: + additionalProperties: + type: string + type: object type: object x-kubernetes-map-type: atomic - serviceAccountToken: - properties: - audience: - type: string - expirationSeconds: - format: int64 - type: integer - path: - type: string - required: - - path - type: object + storageClassName: + type: string + volumeAttributesClassName: + type: string + volumeMode: + type: string + volumeName: + type: string type: object - type: array - x-kubernetes-list-type: atomic - type: object - quobyte: - properties: - group: - type: string - readOnly: - type: boolean - registry: - type: string - tenant: - type: string - user: - type: string - volume: - type: string - required: - - registry - - volume - type: object - rbd: - properties: - fsType: + required: + - spec + type: object + type: object + fc: + properties: + fsType: + type: string + lun: + format: int32 + type: integer + readOnly: + type: boolean + targetWWNs: + items: type: string - image: + type: array + x-kubernetes-list-type: atomic + wwids: + items: type: string - keyring: - default: /etc/ceph/keyring + type: array + x-kubernetes-list-type: atomic + type: object + flexVolume: + properties: + driver: + type: string + fsType: + type: string + options: + additionalProperties: type: string - monitors: - items: + type: object + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" type: string - type: array - x-kubernetes-list-type: atomic - pool: - default: rbd - type: string - readOnly: - type: boolean - secretRef: - properties: - name: - default: "" - type: string - type: object - x-kubernetes-map-type: atomic - user: - default: admin - type: string - required: - - image - - monitors - type: object - scaleIO: - properties: - fsType: - default: xfs - type: string - gateway: - type: string - protectionDomain: + type: object + x-kubernetes-map-type: atomic + required: + - driver + type: object + flocker: + properties: + datasetName: + type: string + datasetUUID: + type: string + type: object + gcePersistentDisk: + properties: + fsType: + type: string + partition: + format: int32 + type: integer + pdName: + type: string + readOnly: + type: boolean + required: + - pdName + type: object + glusterfs: + properties: + endpoints: + type: string + path: + type: string + readOnly: + type: boolean + required: + - endpoints + - path + type: object + hostPath: + properties: + path: + type: string + type: + type: string + required: + - path + type: object + iscsi: + properties: + chapAuthDiscovery: + type: boolean + chapAuthSession: + type: boolean + fsType: + type: string + initiatorName: + type: string + iqn: + type: string + iscsiInterface: + default: default + type: string + lun: + format: int32 + type: integer + portals: + items: type: string - readOnly: - type: boolean - secretRef: + type: array + x-kubernetes-list-type: atomic + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + targetPortal: + type: string + required: + - iqn + - lun + - targetPortal + type: object + name: + type: string + nfs: + properties: + path: + type: string + readOnly: + type: boolean + server: + type: string + required: + - path + - server + type: object + persistentVolumeClaim: + properties: + claimName: + type: string + readOnly: + type: boolean + required: + - claimName + type: object + photonPersistentDisk: + properties: + fsType: + type: string + pdID: + type: string + required: + - pdID + type: object + portworxVolume: + properties: + fsType: + type: string + readOnly: + type: boolean + volumeID: + type: string + required: + - volumeID + type: object + projected: + properties: + defaultMode: + format: int32 + type: integer + sources: + items: properties: - name: - default: "" - type: string + clusterTrustBundle: + properties: + labelSelector: + properties: + matchExpressions: + items: + properties: + key: + type: string + operator: + type: string + values: + items: + type: string + type: array + x-kubernetes-list-type: atomic + required: + - key + - operator + type: object + type: array + x-kubernetes-list-type: atomic + matchLabels: + additionalProperties: + type: string + type: object + type: object + x-kubernetes-map-type: atomic + name: + type: string + optional: + type: boolean + path: + type: string + signerName: + type: string + required: + - path + type: object + configMap: + properties: + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + name: + default: "" + type: string + optional: + type: boolean + type: object + x-kubernetes-map-type: atomic + downwardAPI: + properties: + items: + items: + properties: + fieldRef: + properties: + apiVersion: + type: string + fieldPath: + type: string + required: + - fieldPath + type: object + x-kubernetes-map-type: atomic + mode: + format: int32 + type: integer + path: + type: string + resourceFieldRef: + properties: + containerName: + type: string + divisor: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + resource: + type: string + required: + - resource + type: object + x-kubernetes-map-type: atomic + required: + - path + type: object + type: array + x-kubernetes-list-type: atomic + type: object + secret: + properties: + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + name: + default: "" + type: string + optional: + type: boolean + type: object + x-kubernetes-map-type: atomic + serviceAccountToken: + properties: + audience: + type: string + expirationSeconds: + format: int64 + type: integer + path: + type: string + required: + - path + type: object type: object - x-kubernetes-map-type: atomic - sslEnabled: - type: boolean - storageMode: - default: ThinProvisioned - type: string - storagePool: - type: string - system: - type: string - volumeName: - type: string - required: - - gateway - - secretRef - - system - type: object - secret: - properties: - defaultMode: - format: int32 - type: integer + type: array + x-kubernetes-list-type: atomic + type: object + quobyte: + properties: + group: + type: string + readOnly: + type: boolean + registry: + type: string + tenant: + type: string + user: + type: string + volume: + type: string + required: + - registry + - volume + type: object + rbd: + properties: + fsType: + type: string + image: + type: string + keyring: + default: /etc/ceph/keyring + type: string + monitors: items: - items: - properties: - key: - type: string - mode: - format: int32 - type: integer - path: - type: string - required: - - key - - path - type: object - type: array - x-kubernetes-list-type: atomic - optional: - type: boolean - secretName: - type: string - type: object - storageos: - properties: - fsType: type: string - readOnly: - type: boolean - secretRef: + type: array + x-kubernetes-list-type: atomic + pool: + default: rbd + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + user: + default: admin + type: string + required: + - image + - monitors + type: object + scaleIO: + properties: + fsType: + default: xfs + type: string + gateway: + type: string + protectionDomain: + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + sslEnabled: + type: boolean + storageMode: + default: ThinProvisioned + type: string + storagePool: + type: string + system: + type: string + volumeName: + type: string + required: + - gateway + - secretRef + - system + type: object + secret: + properties: + defaultMode: + format: int32 + type: integer + items: + items: properties: - name: - default: "" + key: type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path type: object - x-kubernetes-map-type: atomic - volumeName: - type: string - volumeNamespace: - type: string - type: object - vsphereVolume: - properties: - fsType: - type: string - storagePolicyID: - type: string - storagePolicyName: - type: string - volumePath: - type: string - required: - - volumePath - type: object - required: - - name - type: object - type: array - type: object - type: object - replicas: - format: int32 - type: integer - shards: - format: int32 - type: integer - storage: - properties: - accessModes: - items: - type: string - type: array - x-kubernetes-list-type: atomic - dataSource: - properties: - apiGroup: - type: string - kind: - type: string - name: - type: string - required: - - kind - - name - type: object - x-kubernetes-map-type: atomic - dataSourceRef: - properties: - apiGroup: - type: string - kind: - type: string - name: - type: string - namespace: - type: string - required: - - kind - - name - type: object - resources: - properties: - limits: - additionalProperties: - anyOf: - - type: integer - - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ - x-kubernetes-int-or-string: true - type: object - requests: - additionalProperties: - anyOf: - - type: integer - - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ - x-kubernetes-int-or-string: true - type: object - type: object - selector: - properties: - matchExpressions: - items: - properties: - key: - type: string - operator: - type: string - values: - items: + type: array + x-kubernetes-list-type: atomic + optional: + type: boolean + secretName: type: string - type: array - x-kubernetes-list-type: atomic - required: - - key - - operator - type: object - type: array - x-kubernetes-list-type: atomic - matchLabels: - additionalProperties: - type: string + type: object + storageos: + properties: + fsType: + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + volumeName: + type: string + volumeNamespace: + type: string + type: object + vsphereVolume: + properties: + fsType: + type: string + storagePolicyID: + type: string + storagePolicyName: + type: string + volumePath: + type: string + required: + - volumePath + type: object + required: + - name type: object - type: object - x-kubernetes-map-type: atomic - storageClassName: - type: string - volumeAttributesClassName: - type: string - volumeMode: - type: string - volumeName: + type: array + type: object + type: object + replicas: + format: int32 + type: integer + shards: + format: int32 + type: integer + storage: + properties: + accessModes: + items: type: string - type: object - storageType: - enum: - - Durable - - Ephemeral - type: string - type: object - type: array + type: array + x-kubernetes-list-type: atomic + dataSource: + properties: + apiGroup: + type: string + kind: + type: string + name: + type: string + required: + - kind + - name + type: object + x-kubernetes-map-type: atomic + dataSourceRef: + properties: + apiGroup: + type: string + kind: + type: string + name: + type: string + namespace: + type: string + required: + - kind + - name + type: object + resources: + properties: + limits: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + requests: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + type: object + selector: + properties: + matchExpressions: + items: + properties: + key: + type: string + operator: + type: string + values: + items: + type: string + type: array + x-kubernetes-list-type: atomic + required: + - key + - operator + type: object + type: array + x-kubernetes-list-type: atomic + matchLabels: + additionalProperties: + type: string + type: object + type: object + x-kubernetes-map-type: atomic + storageClassName: + type: string + volumeAttributesClassName: + type: string + volumeMode: + type: string + volumeName: + type: string + type: object + storageType: + enum: + - Durable + - Ephemeral + type: string + type: object type: object configSecret: properties: diff --git a/vendor/kubedb.dev/apimachinery/crds/kubedb.com_pgbouncers.yaml b/vendor/kubedb.dev/apimachinery/crds/kubedb.com_pgbouncers.yaml index e8ca184df..f5d464d77 100644 --- a/vendor/kubedb.dev/apimachinery/crds/kubedb.com_pgbouncers.yaml +++ b/vendor/kubedb.dev/apimachinery/crds/kubedb.com_pgbouncers.yaml @@ -171,6 +171,1054 @@ spec: format: int32 type: integer type: object + init: + properties: + archiver: + properties: + encryptionSecret: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + fullDBRepository: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + manifestOptions: + properties: + archiver: + default: false + type: boolean + archiverRef: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + initScript: + default: false + type: boolean + type: object + manifestRepository: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + recoveryTimestamp: + format: date-time + type: string + replicationStrategy: + enum: + - fscopy + - clone + - sync + - none + type: string + required: + - recoveryTimestamp + type: object + initialized: + type: boolean + script: + properties: + awsElasticBlockStore: + properties: + fsType: + type: string + partition: + format: int32 + type: integer + readOnly: + type: boolean + volumeID: + type: string + required: + - volumeID + type: object + azureDisk: + properties: + cachingMode: + type: string + diskName: + type: string + diskURI: + type: string + fsType: + default: ext4 + type: string + kind: + type: string + readOnly: + default: false + type: boolean + required: + - diskName + - diskURI + type: object + azureFile: + properties: + readOnly: + type: boolean + secretName: + type: string + shareName: + type: string + required: + - secretName + - shareName + type: object + cephfs: + properties: + monitors: + items: + type: string + type: array + x-kubernetes-list-type: atomic + path: + type: string + readOnly: + type: boolean + secretFile: + type: string + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + user: + type: string + required: + - monitors + type: object + cinder: + properties: + fsType: + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + volumeID: + type: string + required: + - volumeID + type: object + configMap: + properties: + defaultMode: + format: int32 + type: integer + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + name: + default: "" + type: string + optional: + type: boolean + type: object + x-kubernetes-map-type: atomic + csi: + properties: + driver: + type: string + fsType: + type: string + nodePublishSecretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + readOnly: + type: boolean + volumeAttributes: + additionalProperties: + type: string + type: object + required: + - driver + type: object + downwardAPI: + properties: + defaultMode: + format: int32 + type: integer + items: + items: + properties: + fieldRef: + properties: + apiVersion: + type: string + fieldPath: + type: string + required: + - fieldPath + type: object + x-kubernetes-map-type: atomic + mode: + format: int32 + type: integer + path: + type: string + resourceFieldRef: + properties: + containerName: + type: string + divisor: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + resource: + type: string + required: + - resource + type: object + x-kubernetes-map-type: atomic + required: + - path + type: object + type: array + x-kubernetes-list-type: atomic + type: object + emptyDir: + properties: + medium: + type: string + sizeLimit: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + ephemeral: + properties: + volumeClaimTemplate: + properties: + metadata: + properties: + annotations: + additionalProperties: + type: string + type: object + finalizers: + items: + type: string + type: array + labels: + additionalProperties: + type: string + type: object + name: + type: string + namespace: + type: string + type: object + spec: + properties: + accessModes: + items: + type: string + type: array + x-kubernetes-list-type: atomic + dataSource: + properties: + apiGroup: + type: string + kind: + type: string + name: + type: string + required: + - kind + - name + type: object + x-kubernetes-map-type: atomic + dataSourceRef: + properties: + apiGroup: + type: string + kind: + type: string + name: + type: string + namespace: + type: string + required: + - kind + - name + type: object + resources: + properties: + limits: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + requests: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + type: object + selector: + properties: + matchExpressions: + items: + properties: + key: + type: string + operator: + type: string + values: + items: + type: string + type: array + x-kubernetes-list-type: atomic + required: + - key + - operator + type: object + type: array + x-kubernetes-list-type: atomic + matchLabels: + additionalProperties: + type: string + type: object + type: object + x-kubernetes-map-type: atomic + storageClassName: + type: string + volumeAttributesClassName: + type: string + volumeMode: + type: string + volumeName: + type: string + type: object + required: + - spec + type: object + type: object + fc: + properties: + fsType: + type: string + lun: + format: int32 + type: integer + readOnly: + type: boolean + targetWWNs: + items: + type: string + type: array + x-kubernetes-list-type: atomic + wwids: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + flexVolume: + properties: + driver: + type: string + fsType: + type: string + options: + additionalProperties: + type: string + type: object + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + required: + - driver + type: object + flocker: + properties: + datasetName: + type: string + datasetUUID: + type: string + type: object + gcePersistentDisk: + properties: + fsType: + type: string + partition: + format: int32 + type: integer + pdName: + type: string + readOnly: + type: boolean + required: + - pdName + type: object + git: + properties: + args: + items: + type: string + type: array + authSecret: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + env: + items: + properties: + name: + type: string + value: + type: string + valueFrom: + properties: + configMapKeyRef: + properties: + key: + type: string + name: + default: "" + type: string + optional: + type: boolean + required: + - key + type: object + x-kubernetes-map-type: atomic + fieldRef: + properties: + apiVersion: + type: string + fieldPath: + type: string + required: + - fieldPath + type: object + x-kubernetes-map-type: atomic + resourceFieldRef: + properties: + containerName: + type: string + divisor: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + resource: + type: string + required: + - resource + type: object + x-kubernetes-map-type: atomic + secretKeyRef: + properties: + key: + type: string + name: + default: "" + type: string + optional: + type: boolean + required: + - key + type: object + x-kubernetes-map-type: atomic + type: object + required: + - name + type: object + type: array + resources: + properties: + claims: + items: + properties: + name: + type: string + request: + type: string + required: + - name + type: object + type: array + x-kubernetes-list-map-keys: + - name + x-kubernetes-list-type: map + limits: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + requests: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + type: object + securityContext: + properties: + allowPrivilegeEscalation: + type: boolean + appArmorProfile: + properties: + localhostProfile: + type: string + type: + type: string + required: + - type + type: object + capabilities: + properties: + add: + items: + type: string + type: array + x-kubernetes-list-type: atomic + drop: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + privileged: + type: boolean + procMount: + type: string + readOnlyRootFilesystem: + type: boolean + runAsGroup: + format: int64 + type: integer + runAsNonRoot: + type: boolean + runAsUser: + format: int64 + type: integer + seLinuxOptions: + properties: + level: + type: string + role: + type: string + type: + type: string + user: + type: string + type: object + seccompProfile: + properties: + localhostProfile: + type: string + type: + type: string + required: + - type + type: object + windowsOptions: + properties: + gmsaCredentialSpec: + type: string + gmsaCredentialSpecName: + type: string + hostProcess: + type: boolean + runAsUserName: + type: string + type: object + type: object + required: + - args + type: object + gitRepo: + properties: + directory: + type: string + repository: + type: string + revision: + type: string + required: + - repository + type: object + glusterfs: + properties: + endpoints: + type: string + path: + type: string + readOnly: + type: boolean + required: + - endpoints + - path + type: object + hostPath: + properties: + path: + type: string + type: + type: string + required: + - path + type: object + image: + properties: + pullPolicy: + type: string + reference: + type: string + type: object + iscsi: + properties: + chapAuthDiscovery: + type: boolean + chapAuthSession: + type: boolean + fsType: + type: string + initiatorName: + type: string + iqn: + type: string + iscsiInterface: + default: default + type: string + lun: + format: int32 + type: integer + portals: + items: + type: string + type: array + x-kubernetes-list-type: atomic + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + targetPortal: + type: string + required: + - iqn + - lun + - targetPortal + type: object + nfs: + properties: + path: + type: string + readOnly: + type: boolean + server: + type: string + required: + - path + - server + type: object + persistentVolumeClaim: + properties: + claimName: + type: string + readOnly: + type: boolean + required: + - claimName + type: object + photonPersistentDisk: + properties: + fsType: + type: string + pdID: + type: string + required: + - pdID + type: object + portworxVolume: + properties: + fsType: + type: string + readOnly: + type: boolean + volumeID: + type: string + required: + - volumeID + type: object + projected: + properties: + defaultMode: + format: int32 + type: integer + sources: + items: + properties: + clusterTrustBundle: + properties: + labelSelector: + properties: + matchExpressions: + items: + properties: + key: + type: string + operator: + type: string + values: + items: + type: string + type: array + x-kubernetes-list-type: atomic + required: + - key + - operator + type: object + type: array + x-kubernetes-list-type: atomic + matchLabels: + additionalProperties: + type: string + type: object + type: object + x-kubernetes-map-type: atomic + name: + type: string + optional: + type: boolean + path: + type: string + signerName: + type: string + required: + - path + type: object + configMap: + properties: + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + name: + default: "" + type: string + optional: + type: boolean + type: object + x-kubernetes-map-type: atomic + downwardAPI: + properties: + items: + items: + properties: + fieldRef: + properties: + apiVersion: + type: string + fieldPath: + type: string + required: + - fieldPath + type: object + x-kubernetes-map-type: atomic + mode: + format: int32 + type: integer + path: + type: string + resourceFieldRef: + properties: + containerName: + type: string + divisor: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + resource: + type: string + required: + - resource + type: object + x-kubernetes-map-type: atomic + required: + - path + type: object + type: array + x-kubernetes-list-type: atomic + type: object + secret: + properties: + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + name: + default: "" + type: string + optional: + type: boolean + type: object + x-kubernetes-map-type: atomic + serviceAccountToken: + properties: + audience: + type: string + expirationSeconds: + format: int64 + type: integer + path: + type: string + required: + - path + type: object + type: object + type: array + x-kubernetes-list-type: atomic + type: object + quobyte: + properties: + group: + type: string + readOnly: + type: boolean + registry: + type: string + tenant: + type: string + user: + type: string + volume: + type: string + required: + - registry + - volume + type: object + rbd: + properties: + fsType: + type: string + image: + type: string + keyring: + default: /etc/ceph/keyring + type: string + monitors: + items: + type: string + type: array + x-kubernetes-list-type: atomic + pool: + default: rbd + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + user: + default: admin + type: string + required: + - image + - monitors + type: object + scaleIO: + properties: + fsType: + default: xfs + type: string + gateway: + type: string + protectionDomain: + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + sslEnabled: + type: boolean + storageMode: + default: ThinProvisioned + type: string + storagePool: + type: string + system: + type: string + volumeName: + type: string + required: + - gateway + - secretRef + - system + type: object + scriptPath: + type: string + secret: + properties: + defaultMode: + format: int32 + type: integer + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + optional: + type: boolean + secretName: + type: string + type: object + storageos: + properties: + fsType: + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + volumeName: + type: string + volumeNamespace: + type: string + type: object + vsphereVolume: + properties: + fsType: + type: string + storagePolicyID: + type: string + storagePolicyName: + type: string + volumePath: + type: string + required: + - volumePath + type: object + type: object + waitForInitialRestore: + type: boolean + type: object monitor: properties: agent: diff --git a/vendor/kubedb.dev/apimachinery/crds/kubedb.com_pgpools.yaml b/vendor/kubedb.dev/apimachinery/crds/kubedb.com_pgpools.yaml index db1f6e1be..9aa665a17 100644 --- a/vendor/kubedb.dev/apimachinery/crds/kubedb.com_pgpools.yaml +++ b/vendor/kubedb.dev/apimachinery/crds/kubedb.com_pgpools.yaml @@ -116,6 +116,1054 @@ spec: format: int32 type: integer type: object + init: + properties: + archiver: + properties: + encryptionSecret: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + fullDBRepository: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + manifestOptions: + properties: + archiver: + default: false + type: boolean + archiverRef: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + initScript: + default: false + type: boolean + type: object + manifestRepository: + properties: + name: + type: string + namespace: + type: string + required: + - name + type: object + recoveryTimestamp: + format: date-time + type: string + replicationStrategy: + enum: + - fscopy + - clone + - sync + - none + type: string + required: + - recoveryTimestamp + type: object + initialized: + type: boolean + script: + properties: + awsElasticBlockStore: + properties: + fsType: + type: string + partition: + format: int32 + type: integer + readOnly: + type: boolean + volumeID: + type: string + required: + - volumeID + type: object + azureDisk: + properties: + cachingMode: + type: string + diskName: + type: string + diskURI: + type: string + fsType: + default: ext4 + type: string + kind: + type: string + readOnly: + default: false + type: boolean + required: + - diskName + - diskURI + type: object + azureFile: + properties: + readOnly: + type: boolean + secretName: + type: string + shareName: + type: string + required: + - secretName + - shareName + type: object + cephfs: + properties: + monitors: + items: + type: string + type: array + x-kubernetes-list-type: atomic + path: + type: string + readOnly: + type: boolean + secretFile: + type: string + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + user: + type: string + required: + - monitors + type: object + cinder: + properties: + fsType: + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + volumeID: + type: string + required: + - volumeID + type: object + configMap: + properties: + defaultMode: + format: int32 + type: integer + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + name: + default: "" + type: string + optional: + type: boolean + type: object + x-kubernetes-map-type: atomic + csi: + properties: + driver: + type: string + fsType: + type: string + nodePublishSecretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + readOnly: + type: boolean + volumeAttributes: + additionalProperties: + type: string + type: object + required: + - driver + type: object + downwardAPI: + properties: + defaultMode: + format: int32 + type: integer + items: + items: + properties: + fieldRef: + properties: + apiVersion: + type: string + fieldPath: + type: string + required: + - fieldPath + type: object + x-kubernetes-map-type: atomic + mode: + format: int32 + type: integer + path: + type: string + resourceFieldRef: + properties: + containerName: + type: string + divisor: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + resource: + type: string + required: + - resource + type: object + x-kubernetes-map-type: atomic + required: + - path + type: object + type: array + x-kubernetes-list-type: atomic + type: object + emptyDir: + properties: + medium: + type: string + sizeLimit: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + ephemeral: + properties: + volumeClaimTemplate: + properties: + metadata: + properties: + annotations: + additionalProperties: + type: string + type: object + finalizers: + items: + type: string + type: array + labels: + additionalProperties: + type: string + type: object + name: + type: string + namespace: + type: string + type: object + spec: + properties: + accessModes: + items: + type: string + type: array + x-kubernetes-list-type: atomic + dataSource: + properties: + apiGroup: + type: string + kind: + type: string + name: + type: string + required: + - kind + - name + type: object + x-kubernetes-map-type: atomic + dataSourceRef: + properties: + apiGroup: + type: string + kind: + type: string + name: + type: string + namespace: + type: string + required: + - kind + - name + type: object + resources: + properties: + limits: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + requests: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + type: object + selector: + properties: + matchExpressions: + items: + properties: + key: + type: string + operator: + type: string + values: + items: + type: string + type: array + x-kubernetes-list-type: atomic + required: + - key + - operator + type: object + type: array + x-kubernetes-list-type: atomic + matchLabels: + additionalProperties: + type: string + type: object + type: object + x-kubernetes-map-type: atomic + storageClassName: + type: string + volumeAttributesClassName: + type: string + volumeMode: + type: string + volumeName: + type: string + type: object + required: + - spec + type: object + type: object + fc: + properties: + fsType: + type: string + lun: + format: int32 + type: integer + readOnly: + type: boolean + targetWWNs: + items: + type: string + type: array + x-kubernetes-list-type: atomic + wwids: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + flexVolume: + properties: + driver: + type: string + fsType: + type: string + options: + additionalProperties: + type: string + type: object + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + required: + - driver + type: object + flocker: + properties: + datasetName: + type: string + datasetUUID: + type: string + type: object + gcePersistentDisk: + properties: + fsType: + type: string + partition: + format: int32 + type: integer + pdName: + type: string + readOnly: + type: boolean + required: + - pdName + type: object + git: + properties: + args: + items: + type: string + type: array + authSecret: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + env: + items: + properties: + name: + type: string + value: + type: string + valueFrom: + properties: + configMapKeyRef: + properties: + key: + type: string + name: + default: "" + type: string + optional: + type: boolean + required: + - key + type: object + x-kubernetes-map-type: atomic + fieldRef: + properties: + apiVersion: + type: string + fieldPath: + type: string + required: + - fieldPath + type: object + x-kubernetes-map-type: atomic + resourceFieldRef: + properties: + containerName: + type: string + divisor: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + resource: + type: string + required: + - resource + type: object + x-kubernetes-map-type: atomic + secretKeyRef: + properties: + key: + type: string + name: + default: "" + type: string + optional: + type: boolean + required: + - key + type: object + x-kubernetes-map-type: atomic + type: object + required: + - name + type: object + type: array + resources: + properties: + claims: + items: + properties: + name: + type: string + request: + type: string + required: + - name + type: object + type: array + x-kubernetes-list-map-keys: + - name + x-kubernetes-list-type: map + limits: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + requests: + additionalProperties: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + type: object + type: object + securityContext: + properties: + allowPrivilegeEscalation: + type: boolean + appArmorProfile: + properties: + localhostProfile: + type: string + type: + type: string + required: + - type + type: object + capabilities: + properties: + add: + items: + type: string + type: array + x-kubernetes-list-type: atomic + drop: + items: + type: string + type: array + x-kubernetes-list-type: atomic + type: object + privileged: + type: boolean + procMount: + type: string + readOnlyRootFilesystem: + type: boolean + runAsGroup: + format: int64 + type: integer + runAsNonRoot: + type: boolean + runAsUser: + format: int64 + type: integer + seLinuxOptions: + properties: + level: + type: string + role: + type: string + type: + type: string + user: + type: string + type: object + seccompProfile: + properties: + localhostProfile: + type: string + type: + type: string + required: + - type + type: object + windowsOptions: + properties: + gmsaCredentialSpec: + type: string + gmsaCredentialSpecName: + type: string + hostProcess: + type: boolean + runAsUserName: + type: string + type: object + type: object + required: + - args + type: object + gitRepo: + properties: + directory: + type: string + repository: + type: string + revision: + type: string + required: + - repository + type: object + glusterfs: + properties: + endpoints: + type: string + path: + type: string + readOnly: + type: boolean + required: + - endpoints + - path + type: object + hostPath: + properties: + path: + type: string + type: + type: string + required: + - path + type: object + image: + properties: + pullPolicy: + type: string + reference: + type: string + type: object + iscsi: + properties: + chapAuthDiscovery: + type: boolean + chapAuthSession: + type: boolean + fsType: + type: string + initiatorName: + type: string + iqn: + type: string + iscsiInterface: + default: default + type: string + lun: + format: int32 + type: integer + portals: + items: + type: string + type: array + x-kubernetes-list-type: atomic + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + targetPortal: + type: string + required: + - iqn + - lun + - targetPortal + type: object + nfs: + properties: + path: + type: string + readOnly: + type: boolean + server: + type: string + required: + - path + - server + type: object + persistentVolumeClaim: + properties: + claimName: + type: string + readOnly: + type: boolean + required: + - claimName + type: object + photonPersistentDisk: + properties: + fsType: + type: string + pdID: + type: string + required: + - pdID + type: object + portworxVolume: + properties: + fsType: + type: string + readOnly: + type: boolean + volumeID: + type: string + required: + - volumeID + type: object + projected: + properties: + defaultMode: + format: int32 + type: integer + sources: + items: + properties: + clusterTrustBundle: + properties: + labelSelector: + properties: + matchExpressions: + items: + properties: + key: + type: string + operator: + type: string + values: + items: + type: string + type: array + x-kubernetes-list-type: atomic + required: + - key + - operator + type: object + type: array + x-kubernetes-list-type: atomic + matchLabels: + additionalProperties: + type: string + type: object + type: object + x-kubernetes-map-type: atomic + name: + type: string + optional: + type: boolean + path: + type: string + signerName: + type: string + required: + - path + type: object + configMap: + properties: + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + name: + default: "" + type: string + optional: + type: boolean + type: object + x-kubernetes-map-type: atomic + downwardAPI: + properties: + items: + items: + properties: + fieldRef: + properties: + apiVersion: + type: string + fieldPath: + type: string + required: + - fieldPath + type: object + x-kubernetes-map-type: atomic + mode: + format: int32 + type: integer + path: + type: string + resourceFieldRef: + properties: + containerName: + type: string + divisor: + anyOf: + - type: integer + - type: string + pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ + x-kubernetes-int-or-string: true + resource: + type: string + required: + - resource + type: object + x-kubernetes-map-type: atomic + required: + - path + type: object + type: array + x-kubernetes-list-type: atomic + type: object + secret: + properties: + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + name: + default: "" + type: string + optional: + type: boolean + type: object + x-kubernetes-map-type: atomic + serviceAccountToken: + properties: + audience: + type: string + expirationSeconds: + format: int64 + type: integer + path: + type: string + required: + - path + type: object + type: object + type: array + x-kubernetes-list-type: atomic + type: object + quobyte: + properties: + group: + type: string + readOnly: + type: boolean + registry: + type: string + tenant: + type: string + user: + type: string + volume: + type: string + required: + - registry + - volume + type: object + rbd: + properties: + fsType: + type: string + image: + type: string + keyring: + default: /etc/ceph/keyring + type: string + monitors: + items: + type: string + type: array + x-kubernetes-list-type: atomic + pool: + default: rbd + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + user: + default: admin + type: string + required: + - image + - monitors + type: object + scaleIO: + properties: + fsType: + default: xfs + type: string + gateway: + type: string + protectionDomain: + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + sslEnabled: + type: boolean + storageMode: + default: ThinProvisioned + type: string + storagePool: + type: string + system: + type: string + volumeName: + type: string + required: + - gateway + - secretRef + - system + type: object + scriptPath: + type: string + secret: + properties: + defaultMode: + format: int32 + type: integer + items: + items: + properties: + key: + type: string + mode: + format: int32 + type: integer + path: + type: string + required: + - key + - path + type: object + type: array + x-kubernetes-list-type: atomic + optional: + type: boolean + secretName: + type: string + type: object + storageos: + properties: + fsType: + type: string + readOnly: + type: boolean + secretRef: + properties: + name: + default: "" + type: string + type: object + x-kubernetes-map-type: atomic + volumeName: + type: string + volumeNamespace: + type: string + type: object + vsphereVolume: + properties: + fsType: + type: string + storagePolicyID: + type: string + storagePolicyName: + type: string + volumePath: + type: string + required: + - volumePath + type: object + type: object + waitForInitialRestore: + type: boolean + type: object initConfig: properties: pgpoolConfig: diff --git a/vendor/kubedb.dev/apimachinery/crds/ops.kubedb.com_clickhouseopsrequests.yaml b/vendor/kubedb.dev/apimachinery/crds/ops.kubedb.com_clickhouseopsrequests.yaml index 17fc6dc04..798f6404d 100644 --- a/vendor/kubedb.dev/apimachinery/crds/ops.kubedb.com_clickhouseopsrequests.yaml +++ b/vendor/kubedb.dev/apimachinery/crds/ops.kubedb.com_clickhouseopsrequests.yaml @@ -83,21 +83,126 @@ spec: x-kubernetes-map-type: atomic horizontalScaling: properties: - cluster: + replicas: + format: int32 + type: integer + type: object + restart: + type: object + timeout: + type: string + tls: + properties: + certificates: items: properties: - clusterName: + alias: + type: string + dnsNames: + items: + type: string + type: array + duration: + type: string + emailAddresses: + items: + type: string + type: array + ipAddresses: + items: + type: string + type: array + issuerRef: + properties: + apiGroup: + type: string + kind: + type: string + name: + type: string + required: + - kind + - name + type: object + x-kubernetes-map-type: atomic + privateKey: + properties: + encoding: + enum: + - PKCS1 + - PKCS8 + type: string + type: object + renewBefore: + type: string + secretName: type: string - replicas: - format: int32 - type: integer + subject: + properties: + countries: + items: + type: string + type: array + localities: + items: + type: string + type: array + organizationalUnits: + items: + type: string + type: array + organizations: + items: + type: string + type: array + postalCodes: + items: + type: string + type: array + provinces: + items: + type: string + type: array + serialNumber: + type: string + streetAddresses: + items: + type: string + type: array + type: object + uris: + items: + type: string + type: array + required: + - alias type: object type: array + issuerRef: + properties: + apiGroup: + type: string + kind: + type: string + name: + type: string + required: + - kind + - name + type: object + x-kubernetes-map-type: atomic + remove: + type: boolean + rotateCertificates: + type: boolean + sslVerificationMode: + enum: + - none + - relaxed + - strict + - once + type: string type: object - restart: - type: object - timeout: - type: string type: enum: - Restart @@ -106,6 +211,8 @@ spec: - UpdateVersion - VolumeExpansion - Reconfigure + - ReconfigureTLS + - RotateAuth type: string updateVersion: properties: @@ -114,62 +221,7 @@ spec: type: object verticalScaling: properties: - cluster: - items: - properties: - clusterName: - type: string - node: - properties: - nodeSelectionPolicy: - type: string - resources: - properties: - claims: - items: - properties: - name: - type: string - request: - type: string - required: - - name - type: object - type: array - x-kubernetes-list-map-keys: - - name - x-kubernetes-list-type: map - limits: - additionalProperties: - anyOf: - - type: integer - - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ - x-kubernetes-int-or-string: true - type: object - requests: - additionalProperties: - anyOf: - - type: integer - - type: string - pattern: ^(\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))(([KMGTPE]i)|[numkMGTPE]|([eE](\+|-)?(([0-9]+(\.[0-9]*)?)|(\.[0-9]+))))?$ - x-kubernetes-int-or-string: true - type: object - type: object - topology: - properties: - key: - type: string - value: - type: string - required: - - key - - value - type: object - type: object - type: object - type: array - standalone: + node: properties: nodeSelectionPolicy: type: string diff --git a/vendor/kubedb.dev/apimachinery/crds/ops.kubedb.com_mysqlopsrequests.yaml b/vendor/kubedb.dev/apimachinery/crds/ops.kubedb.com_mysqlopsrequests.yaml index b734e278a..b5c1bce67 100644 --- a/vendor/kubedb.dev/apimachinery/crds/ops.kubedb.com_mysqlopsrequests.yaml +++ b/vendor/kubedb.dev/apimachinery/crds/ops.kubedb.com_mysqlopsrequests.yaml @@ -87,6 +87,15 @@ spec: format: int32 type: integer type: object + migration: + properties: + oldPVReclaimPolicy: + type: string + storageClassName: + type: string + required: + - storageClassName + type: object replicationModeTransformation: properties: certificates: @@ -321,6 +330,7 @@ spec: - ReconfigureTLS - RotateAuth - ReplicationModeTransformation + - StorageMigration type: string updateVersion: properties: diff --git a/vendor/kubedb.dev/apimachinery/crds/ops.kubedb.com_postgresopsrequests.yaml b/vendor/kubedb.dev/apimachinery/crds/ops.kubedb.com_postgresopsrequests.yaml index c8629ee84..c39d4808c 100644 --- a/vendor/kubedb.dev/apimachinery/crds/ops.kubedb.com_postgresopsrequests.yaml +++ b/vendor/kubedb.dev/apimachinery/crds/ops.kubedb.com_postgresopsrequests.yaml @@ -106,6 +106,15 @@ spec: - Asynchronous type: string type: object + migration: + properties: + oldPVReclaimPolicy: + type: string + storageClassName: + type: string + required: + - storageClassName + type: object reconnectStandby: properties: readyTimeOut: @@ -256,6 +265,7 @@ spec: - ReconnectStandby - ForceFailOver - SetRaftKeyPair + - StorageMigration type: string updateVersion: properties: diff --git a/vendor/kubeops.dev/petset/apis/apps/v1/constants.go b/vendor/kubeops.dev/petset/apis/apps/v1/constants.go index 236d9fbe9..d4be6b247 100644 --- a/vendor/kubeops.dev/petset/apis/apps/v1/constants.go +++ b/vendor/kubeops.dev/petset/apis/apps/v1/constants.go @@ -21,4 +21,6 @@ const ( ManifestWorkClusterNameLabel = "open-cluster-management.io/cluster-name" RolePod = "pod" RolePVC = "pvc" + DeletionPolicyAnnotation = GroupName + "/deletion-policy" + DeletionPolicyOrphan = "Orphan" ) diff --git a/vendor/kubeops.dev/petset/apis/apps/v1/placementpolicy_types.go b/vendor/kubeops.dev/petset/apis/apps/v1/placementpolicy_types.go index 9cd00bee7..31397a1b1 100644 --- a/vendor/kubeops.dev/petset/apis/apps/v1/placementpolicy_types.go +++ b/vendor/kubeops.dev/petset/apis/apps/v1/placementpolicy_types.go @@ -64,19 +64,36 @@ type PlacementPolicySpec struct { // +optional Affinity *Affinity `json:"affinity,omitempty"` - // OCM provides spec for distributed pod placements using open cluster management + // ClusterSpreadConstraint provides spec for distributed pod placements // +optional - OCM *OCMSpec `json:"ocm,omitempty"` + ClusterSpreadConstraint *ClusterSpreadConstraint `json:"clusterSpreadConstraint,omitempty"` } -type OCMSpec struct { - DistributionRules []DistributionRule `json:"distributionRules,omitempty"` - SliceName string `json:"sliceName,omitempty"` +// https://kubeslice.io/documentation/open-source/1.4.0/install-kubeslice/yaml/yaml-controller-install#create-project-namespace +// https://kubeslice.io/documentation/open-source/1.4.0/install-kubeslice/yaml/slice-operations/slice-operations-slice-creation#serviceexport-dns + +/* +A cluster cannot be registered to multiple projects. +The KubeSlice worker controller must be deployed in the kubeslice-system namespace. +When a SliceConfig resource is created, KubeSlice generates a Slice resource in the kubeslice-system namespace across all clusters specified in the SliceConfig resource. +When a sliceName is specified in a ServiceExport, the KubeSlice worker controller retrieves the Slice resource from the kubeslice-system namespace and verifies whether the namespace associated with the ServiceExport is onboarded. + +So, the project field is not required in the placementPolicy API . But if want to validate whether the clusters specified in the placementPolicy are included in the SliceConfig's cluster list then we need to include the project name as well. +*/ +type ClusterSpreadConstraint struct { + DistributionRules []DistributionRule `json:"distributionRules"` + Slice KubeSliceConfig `json:"slice"` } type DistributionRule struct { - ClusterName string `json:"clusterName,omitempty"` - Replicas []int32 `json:"replicas,omitempty"` + ClusterName string `json:"clusterName"` + ReplicaIndices []int32 `json:"replicaIndices"` + StorageClassName string `json:"storageClassName,omitempty"` +} + +type KubeSliceConfig struct { + ProjectNamespace string `json:"projectNamespace"` + SliceName string `json:"sliceName"` } type ZoneSpreadConstraint struct { diff --git a/vendor/kubeops.dev/petset/apis/apps/v1/zz_generated.deepcopy.go b/vendor/kubeops.dev/petset/apis/apps/v1/zz_generated.deepcopy.go index d63a7f2e1..a7181543f 100644 --- a/vendor/kubeops.dev/petset/apis/apps/v1/zz_generated.deepcopy.go +++ b/vendor/kubeops.dev/petset/apis/apps/v1/zz_generated.deepcopy.go @@ -51,11 +51,35 @@ func (in *Affinity) DeepCopy() *Affinity { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ClusterSpreadConstraint) DeepCopyInto(out *ClusterSpreadConstraint) { + *out = *in + if in.DistributionRules != nil { + in, out := &in.DistributionRules, &out.DistributionRules + *out = make([]DistributionRule, len(*in)) + for i := range *in { + (*in)[i].DeepCopyInto(&(*out)[i]) + } + } + out.Slice = in.Slice + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ClusterSpreadConstraint. +func (in *ClusterSpreadConstraint) DeepCopy() *ClusterSpreadConstraint { + if in == nil { + return nil + } + out := new(ClusterSpreadConstraint) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *DistributionRule) DeepCopyInto(out *DistributionRule) { *out = *in - if in.Replicas != nil { - in, out := &in.Replicas, &out.Replicas + if in.ReplicaIndices != nil { + in, out := &in.ReplicaIndices, &out.ReplicaIndices *out = make([]int32, len(*in)) copy(*out, *in) } @@ -72,6 +96,22 @@ func (in *DistributionRule) DeepCopy() *DistributionRule { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *KubeSliceConfig) DeepCopyInto(out *KubeSliceConfig) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new KubeSliceConfig. +func (in *KubeSliceConfig) DeepCopy() *KubeSliceConfig { + if in == nil { + return nil + } + out := new(KubeSliceConfig) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *NodeAffinityRule) DeepCopyInto(out *NodeAffinityRule) { *out = *in @@ -111,29 +151,6 @@ func (in *NodeSpreadConstraint) DeepCopy() *NodeSpreadConstraint { return out } -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *OCMSpec) DeepCopyInto(out *OCMSpec) { - *out = *in - if in.DistributionRules != nil { - in, out := &in.DistributionRules, &out.DistributionRules - *out = make([]DistributionRule, len(*in)) - for i := range *in { - (*in)[i].DeepCopyInto(&(*out)[i]) - } - } - return -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new OCMSpec. -func (in *OCMSpec) DeepCopy() *OCMSpec { - if in == nil { - return nil - } - out := new(OCMSpec) - in.DeepCopyInto(out) - return out -} - // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *PetSet) DeepCopyInto(out *PetSet) { *out = *in @@ -328,9 +345,9 @@ func (in *PlacementPolicySpec) DeepCopyInto(out *PlacementPolicySpec) { *out = new(Affinity) (*in).DeepCopyInto(*out) } - if in.OCM != nil { - in, out := &in.OCM, &out.OCM - *out = new(OCMSpec) + if in.ClusterSpreadConstraint != nil { + in, out := &in.ClusterSpreadConstraint, &out.ClusterSpreadConstraint + *out = new(ClusterSpreadConstraint) (*in).DeepCopyInto(*out) } return diff --git a/vendor/kubeops.dev/petset/crds/apps.k8s.appscode.com_placementpolicies.yaml b/vendor/kubeops.dev/petset/crds/apps.k8s.appscode.com_placementpolicies.yaml index f2a8e5de3..47d4eeae7 100644 --- a/vendor/kubeops.dev/petset/crds/apps.k8s.appscode.com_placementpolicies.yaml +++ b/vendor/kubeops.dev/petset/crds/apps.k8s.appscode.com_placementpolicies.yaml @@ -87,37 +87,53 @@ spec: type: object type: array type: object - nodeSpreadConstraint: - properties: - maxSkew: - default: 1 - format: int32 - type: integer - whenUnsatisfiable: - default: DoNotSchedule - type: string - required: - - maxSkew - - whenUnsatisfiable - type: object - ocm: - description: OCM provides spec for distributed pod placements using - open cluster management + clusterSpreadConstraint: + description: ClusterSpreadConstraint provides spec for distributed + pod placements properties: distributionRules: items: properties: clusterName: type: string - replicas: + replicaIndices: items: format: int32 type: integer type: array + storageClassName: + type: string + required: + - clusterName + - replicaIndices type: object type: array - sliceName: + slice: + properties: + projectNamespace: + type: string + sliceName: + type: string + required: + - projectNamespace + - sliceName + type: object + required: + - distributionRules + - slice + type: object + nodeSpreadConstraint: + properties: + maxSkew: + default: 1 + format: int32 + type: integer + whenUnsatisfiable: + default: DoNotSchedule type: string + required: + - maxSkew + - whenUnsatisfiable type: object zoneSpreadConstraint: properties: diff --git a/vendor/modules.txt b/vendor/modules.txt index 461ec2b45..98a3ffe09 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -782,8 +782,8 @@ github.com/klauspost/compress/internal/le github.com/klauspost/compress/internal/snapref github.com/klauspost/compress/zstd github.com/klauspost/compress/zstd/internal/xxhash -# github.com/klauspost/cpuid/v2 v2.0.9 -## explicit; go 1.13 +# github.com/klauspost/cpuid/v2 v2.2.5 +## explicit; go 1.15 github.com/klauspost/cpuid/v2 # github.com/kubernetes-csi/external-snapshotter/client/v8 v8.2.0 ## explicit; go 1.22.0 @@ -1645,8 +1645,8 @@ kmodules.xyz/prober/api/v1 kmodules.xyz/resource-metadata/apis/node kmodules.xyz/resource-metadata/apis/node/v1alpha1 kmodules.xyz/resource-metadata/crds -# kubedb.dev/apimachinery v0.57.0 -## explicit; go 1.23.6 +# kubedb.dev/apimachinery v0.58.0 +## explicit; go 1.24.0 kubedb.dev/apimachinery/apis kubedb.dev/apimachinery/apis/archiver/v1alpha1 kubedb.dev/apimachinery/apis/autoscaling @@ -1690,8 +1690,8 @@ kubedb.dev/apimachinery/client/clientset/versioned/typed/ui/v1alpha1 kubedb.dev/apimachinery/crds kubedb.dev/apimachinery/pkg/double_optin kubedb.dev/apimachinery/pkg/factory -# kubedb.dev/db-client-go v0.12.0 -## explicit; go 1.23.6 +# kubedb.dev/db-client-go v0.13.0 +## explicit; go 1.24.0 kubedb.dev/db-client-go/elasticsearch kubedb.dev/db-client-go/redis # kubeops.dev/csi-driver-cacerts v0.1.0 @@ -1699,8 +1699,8 @@ kubedb.dev/db-client-go/redis kubeops.dev/csi-driver-cacerts/apis/cacerts kubeops.dev/csi-driver-cacerts/apis/cacerts/v1alpha1 kubeops.dev/csi-driver-cacerts/crds -# kubeops.dev/petset v0.0.11 -## explicit; go 1.23.6 +# kubeops.dev/petset v0.0.12 +## explicit; go 1.24.0 kubeops.dev/petset/apis/apps/v1 kubeops.dev/petset/client/clientset/versioned kubeops.dev/petset/client/clientset/versioned/scheme