diff --git a/.gitignore b/.gitignore index 89942d9ee..02fa518f0 100644 --- a/.gitignore +++ b/.gitignore @@ -1,560 +1,560 @@ -*.orig -*.filters -*.sln -*.vcxproj -*.xcodeproj -build - -# Created by https://www.gitignore.io/api/linux,osx,sublimetext,windows,jetbrains,vim,emacs,cmake,c++,cuda,visualstudio,webstorm,eclipse,xcode - -### Linux ### -*~ - -# KDE directory preferences -.directory - -# Linux trash folder which might appear on any partition or disk -.Trash-* - - -### OSX ### -.DS_Store -.AppleDouble -.LSOverride - -# Icon must end with two \r -Icon - -# Thumbnails -._* - -# Files that might appear in the root of a volume -.DocumentRevisions-V100 -.fseventsd -.Spotlight-V100 -.TemporaryItems -.Trashes -.VolumeIcon.icns - -# Directories potentially created on remote AFP share -.AppleDB -.AppleDesktop -Network Trash Folder -Temporary Items -.apdisk - - -### SublimeText ### -# cache files for sublime text -*.tmlanguage.cache -*.tmPreferences.cache -*.stTheme.cache - -# workspace files are user-specific -*.sublime-workspace - -# project files should be checked into the repository, unless a significant -# proportion of contributors will probably not be using SublimeText -# *.sublime-project - -# sftp configuration file -sftp-config.json - - -### Windows ### -# Windows image file caches -Thumbs.db -ehthumbs.db - -# Folder config file -Desktop.ini - -# Recycle Bin used on file shares -$RECYCLE.BIN/ - -# Windows Installer files -*.cab -*.msi -*.msm -*.msp - -# Windows shortcuts -*.lnk - - -### JetBrains ### -# Covers JetBrains IDEs: IntelliJ, RubyMine, PhpStorm, AppCode, PyCharm, CLion, Android Studio - -*.iml - -## Directory-based project format: -#.idea/ -# if you remove the above rule, at least ignore the following: - -# User-specific stuff: -.idea/workspace.xml -.idea/tasks.xml -.idea/dictionaries - -# Sensitive or high-churn files: -.idea/dataSources.ids -.idea/dataSources.xml -.idea/sqlDataSources.xml -.idea/dynamic.xml -.idea/uiDesigner.xml - -# Gradle: -.idea/gradle.xml -.idea/libraries - -# Mongo Explorer plugin: -.idea/mongoSettings.xml - -## File-based project format: -*.ipr -*.iws - -## Plugin-specific files: - -# IntelliJ -/out/ - -# mpeltonen/sbt-idea plugin -.idea_modules/ - -# JIRA plugin -atlassian-ide-plugin.xml - -# Crashlytics plugin (for Android Studio and IntelliJ) -com_crashlytics_export_strings.xml -crashlytics.properties -crashlytics-build.properties - - -### Vim ### -[._]*.s[a-w][a-z] -[._]s[a-w][a-z] -*.un~ -Session.vim -.netrwhist -*~ - - -### Emacs ### -# -*- mode: gitignore; -*- -*~ -\#*\# -/.emacs.desktop -/.emacs.desktop.lock -*.elc -auto-save-list -tramp -.\#* - -# Org-mode -.org-id-locations -*_archive - -# flymake-mode -*_flymake.* - -# eshell files -/eshell/history -/eshell/lastdir - -# elpa packages -/elpa/ - -# reftex files -*.rel - -# AUCTeX auto folder -/auto/ - -# cask packages -.cask/ - - -### CMake ### -CMakeCache.txt -CMakeFiles -CMakeScripts -Makefile -cmake_install.cmake -install_manifest.txt - - -### C++ ### -# Compiled Object files -*.slo -*.lo -*.o -*.obj - -# Precompiled Headers -*.gch -*.pch - -# Compiled Dynamic libraries -*.so -*.dylib -*.dll - -# Fortran module files -*.mod - -# Compiled Static libraries -*.lai -*.la -*.a -*.lib - -# Executables -*.exe -*.out -*.app - - -### CUDA ### -*.i -*.ii -*.gpu -*.ptx -*.cubin -*.fatbin - - -### VisualStudio ### -## Ignore Visual Studio temporary files, build results, and -## files generated by popular Visual Studio add-ons. - -# User-specific files -*.suo -*.user -*.userosscache -*.sln.docstates - -# User-specific files (MonoDevelop/Xamarin Studio) -*.userprefs - -# Build results -[Dd]ebug/ -[Dd]ebugPublic/ -[Rr]elease/ -[Rr]eleases/ -x64/ -x86/ -build/ -bld/ -[Bb]in/ -[Oo]bj/ - -# Visual Studio 2015 cache/options directory -.vs/ -# Uncomment if you have tasks that create the project's static files in wwwroot -#wwwroot/ - -# MSTest test Results -[Tt]est[Rr]esult*/ -[Bb]uild[Ll]og.* - -# NUNIT -*.VisualState.xml -TestResult.xml - -# Build Results of an ATL Project -[Dd]ebugPS/ -[Rr]eleasePS/ -dlldata.c - -# DNX -project.lock.json -artifacts/ - -*_i.c -*_p.c -*_i.h -*.ilk -*.meta -*.obj -*.pch -*.pdb -*.pgc -*.pgd -*.rsp -*.sbr -*.tlb -*.tli -*.tlh -*.tmp -*.tmp_proj -*.log -*.vspscc -*.vssscc -.builds -*.pidb -*.svclog -*.scc - -# Chutzpah Test files -_Chutzpah* - -# Visual C++ cache files -ipch/ -*.aps -*.ncb -*.opensdf -*.sdf -*.cachefile - -# Visual Studio profiler -*.psess -*.vsp -*.vspx - -# TFS 2012 Local Workspace -$tf/ - -# Guidance Automation Toolkit -*.gpState - -# ReSharper is a .NET coding add-in -_ReSharper*/ -*.[Rr]e[Ss]harper -*.DotSettings.user - -# JustCode is a .NET coding add-in -.JustCode - -# TeamCity is a build add-in -_TeamCity* - -# DotCover is a Code Coverage Tool -*.dotCover - -# NCrunch -_NCrunch_* -.*crunch*.local.xml -nCrunchTemp_* - -# MightyMoose -*.mm.* -AutoTest.Net/ - -# Web workbench (sass) -.sass-cache/ - -# Installshield output folder -[Ee]xpress/ - -# DocProject is a documentation generator add-in -DocProject/buildhelp/ -DocProject/Help/*.HxT -DocProject/Help/*.HxC -DocProject/Help/*.hhc -DocProject/Help/*.hhk -DocProject/Help/*.hhp -DocProject/Help/Html2 -DocProject/Help/html - -# Click-Once directory -publish/ - -# Publish Web Output -*.[Pp]ublish.xml -*.azurePubxml -# TODO: Comment the next line if you want to checkin your web deploy settings -# but database connection strings (with potential passwords) will be unencrypted -*.pubxml -*.publishproj - -# NuGet Packages -*.nupkg -# The packages folder can be ignored because of Package Restore -**/packages/* -# except build/, which is used as an MSBuild target. -!**/packages/build/ -# Uncomment if necessary however generally it will be regenerated when needed -#!**/packages/repositories.config - -# Windows Azure Build Output -csx/ -*.build.csdef - -# Windows Store app package directory -AppPackages/ - -# Visual Studio cache files -# files ending in .cache can be ignored -*.[Cc]ache -# but keep track of directories ending in .cache -!*.[Cc]ache/ - -# Others -ClientBin/ -[Ss]tyle[Cc]op.* -~$* -*~ -*.dbmdl -*.dbproj.schemaview -*.pfx -*.publishsettings -node_modules/ -orleans.codegen.cs - -# RIA/Silverlight projects -Generated_Code/ - -# Backup & report files from converting an old project file -# to a newer Visual Studio version. Backup files are not needed, -# because we have git ;-) -_UpgradeReport_Files/ -Backup*/ -UpgradeLog*.XML -UpgradeLog*.htm - -# SQL Server files -*.mdf -*.ldf - -# Business Intelligence projects -*.rdl.data -*.bim.layout -*.bim_*.settings - -# Microsoft Fakes -FakesAssemblies/ - -# Node.js Tools for Visual Studio -.ntvs_analysis.dat - -# Visual Studio 6 build log -*.plg - -# Visual Studio 6 workspace options file -*.opt - -# Visual Studio LightSwitch build output -**/*.HTMLClient/GeneratedArtifacts -**/*.DesktopClient/GeneratedArtifacts -**/*.DesktopClient/ModelManifest.xml -**/*.Server/GeneratedArtifacts -**/*.Server/ModelManifest.xml -_Pvt_Extensions - - -### WebStorm ### -# Covers JetBrains IDEs: IntelliJ, RubyMine, PhpStorm, AppCode, PyCharm, CLion, Android Studio - -*.iml - -## Directory-based project format: -.idea/ -# if you remove the above rule, at least ignore the following: - -# User-specific stuff: -# .idea/workspace.xml -# .idea/tasks.xml -# .idea/dictionaries - -# Sensitive or high-churn files: -# .idea/dataSources.ids -# .idea/dataSources.xml -# .idea/sqlDataSources.xml -# .idea/dynamic.xml -# .idea/uiDesigner.xml - -# Gradle: -# .idea/gradle.xml -# .idea/libraries - -# Mongo Explorer plugin: -# .idea/mongoSettings.xml - -## File-based project format: -*.ipr -*.iws - -## Plugin-specific files: - -# IntelliJ -/out/ - -# mpeltonen/sbt-idea plugin -.idea_modules/ - -# JIRA plugin -atlassian-ide-plugin.xml - -# Crashlytics plugin (for Android Studio and IntelliJ) -com_crashlytics_export_strings.xml -crashlytics.properties -crashlytics-build.properties - - -### Eclipse ### -*.pydevproject -.metadata -.gradle -bin/ -tmp/ -*.tmp -*.bak -*.swp -*~.nib -local.properties -.settings/ -.loadpath - -# Eclipse Core -#.project - -# External tool builders -.externalToolBuilders/ - -# Locally stored "Eclipse launch configurations" -#*.launch - -# CDT-specific -#.cproject - -# JDT-specific (Eclipse Java Development Tools) -.classpath - -# Java annotation processor (APT) -.factorypath - -# PDT-specific -.buildpath - -# sbteclipse plugin -.target - -# TeXlipse plugin -.texlipse - - -### Xcode ### -# Xcode -# -# gitignore contributors: remember to update Global/Xcode.gitignore, Objective-C.gitignore & Swift.gitignore - -## Build generated -build/ -DerivedData - -## Various settings -*.pbxuser -!default.pbxuser -*.mode1v3 -!default.mode1v3 -*.mode2v3 -!default.mode2v3 -*.perspectivev3 -!default.perspectivev3 -xcuserdata - -## Other -*.xccheckout -*.moved-aside -*.xcuserstate +*.orig +*.filters +*.sln +*.vcxproj +*.xcodeproj +build + +# Created by https://www.gitignore.io/api/linux,osx,sublimetext,windows,jetbrains,vim,emacs,cmake,c++,cuda,visualstudio,webstorm,eclipse,xcode + +### Linux ### +*~ + +# KDE directory preferences +.directory + +# Linux trash folder which might appear on any partition or disk +.Trash-* + + +### OSX ### +.DS_Store +.AppleDouble +.LSOverride + +# Icon must end with two \r +Icon + + +# Thumbnails +._* + +# Files that might appear in the root of a volume +.DocumentRevisions-V100 +.fseventsd +.Spotlight-V100 +.TemporaryItems +.Trashes +.VolumeIcon.icns + +# Directories potentially created on remote AFP share +.AppleDB +.AppleDesktop +Network Trash Folder +Temporary Items +.apdisk + + +### SublimeText ### +# cache files for sublime text +*.tmlanguage.cache +*.tmPreferences.cache +*.stTheme.cache + +# workspace files are user-specific +*.sublime-workspace + +# project files should be checked into the repository, unless a significant +# proportion of contributors will probably not be using SublimeText +# *.sublime-project + +# sftp configuration file +sftp-config.json + + +### Windows ### +# Windows image file caches +Thumbs.db +ehthumbs.db + +# Folder config file +Desktop.ini + +# Recycle Bin used on file shares +$RECYCLE.BIN/ + +# Windows Installer files +*.cab +*.msi +*.msm +*.msp + +# Windows shortcuts +*.lnk + + +### JetBrains ### +# Covers JetBrains IDEs: IntelliJ, RubyMine, PhpStorm, AppCode, PyCharm, CLion, Android Studio + +*.iml + +## Directory-based project format: +#.idea/ +# if you remove the above rule, at least ignore the following: + +# User-specific stuff: +.idea/workspace.xml +.idea/tasks.xml +.idea/dictionaries + +# Sensitive or high-churn files: +.idea/dataSources.ids +.idea/dataSources.xml +.idea/sqlDataSources.xml +.idea/dynamic.xml +.idea/uiDesigner.xml + +# Gradle: +.idea/gradle.xml +.idea/libraries + +# Mongo Explorer plugin: +.idea/mongoSettings.xml + +## File-based project format: +*.ipr +*.iws + +## Plugin-specific files: + +# IntelliJ +/out/ + +# mpeltonen/sbt-idea plugin +.idea_modules/ + +# JIRA plugin +atlassian-ide-plugin.xml + +# Crashlytics plugin (for Android Studio and IntelliJ) +com_crashlytics_export_strings.xml +crashlytics.properties +crashlytics-build.properties + + +### Vim ### +[._]*.s[a-w][a-z] +[._]s[a-w][a-z] +*.un~ +Session.vim +.netrwhist +*~ + + +### Emacs ### +# -*- mode: gitignore; -*- +*~ +\#*\# +/.emacs.desktop +/.emacs.desktop.lock +*.elc +auto-save-list +tramp +.\#* + +# Org-mode +.org-id-locations +*_archive + +# flymake-mode +*_flymake.* + +# eshell files +/eshell/history +/eshell/lastdir + +# elpa packages +/elpa/ + +# reftex files +*.rel + +# AUCTeX auto folder +/auto/ + +# cask packages +.cask/ + + +### CMake ### +CMakeCache.txt +CMakeFiles +CMakeScripts +Makefile +cmake_install.cmake +install_manifest.txt + + +### C++ ### +# Compiled Object files +*.slo +*.lo +*.o + +# Precompiled Headers +*.gch +*.pch + +# Compiled Dynamic libraries +*.so +*.dylib +*.dll + +# Fortran module files +*.mod + +# Compiled Static libraries +*.lai +*.la +*.a +*.lib + +# Executables +*.exe +*.out +*.app + + +### CUDA ### +*.i +*.ii +*.gpu +*.ptx +*.cubin +*.fatbin + + +### VisualStudio ### +## Ignore Visual Studio temporary files, build results, and +## files generated by popular Visual Studio add-ons. + +# User-specific files +*.suo +*.user +*.userosscache +*.sln.docstates + +# User-specific files (MonoDevelop/Xamarin Studio) +*.userprefs + +# Build results +[Dd]ebug/ +[Dd]ebugPublic/ +[Rr]elease/ +[Rr]eleases/ +x64/ +x86/ +build/ +bld/ +[Bb]in/ +[Oo]bj/ + +# Visual Studio 2015 cache/options directory +.vs/ +# Uncomment if you have tasks that create the project's static files in wwwroot +#wwwroot/ + +# MSTest test Results +[Tt]est[Rr]esult*/ +[Bb]uild[Ll]og.* + +# NUNIT +*.VisualState.xml +TestResult.xml + +# Build Results of an ATL Project +[Dd]ebugPS/ +[Rr]eleasePS/ +dlldata.c + +# DNX +project.lock.json +artifacts/ + +*_i.c +*_p.c +*_i.h +*.ilk +*.meta +*.pch +*.pdb +*.pgc +*.pgd +*.rsp +*.sbr +*.tlb +*.tli +*.tlh +*.tmp +*.tmp_proj +*.log +*.vspscc +*.vssscc +.builds +*.pidb +*.svclog +*.scc + +# Chutzpah Test files +_Chutzpah* + +# Visual C++ cache files +ipch/ +*.aps +*.ncb +*.opensdf +*.sdf +*.cachefile + +# Visual Studio profiler +*.psess +*.vsp +*.vspx + +# TFS 2012 Local Workspace +$tf/ + +# Guidance Automation Toolkit +*.gpState + +# ReSharper is a .NET coding add-in +_ReSharper*/ +*.[Rr]e[Ss]harper +*.DotSettings.user + +# JustCode is a .NET coding add-in +.JustCode + +# TeamCity is a build add-in +_TeamCity* + +# DotCover is a Code Coverage Tool +*.dotCover + +# NCrunch +_NCrunch_* +.*crunch*.local.xml +nCrunchTemp_* + +# MightyMoose +*.mm.* +AutoTest.Net/ + +# Web workbench (sass) +.sass-cache/ + +# Installshield output folder +[Ee]xpress/ + +# DocProject is a documentation generator add-in +DocProject/buildhelp/ +DocProject/Help/*.HxT +DocProject/Help/*.HxC +DocProject/Help/*.hhc +DocProject/Help/*.hhk +DocProject/Help/*.hhp +DocProject/Help/Html2 +DocProject/Help/html + +# Click-Once directory +publish/ + +# Publish Web Output +*.[Pp]ublish.xml +*.azurePubxml +# TODO: Comment the next line if you want to checkin your web deploy settings +# but database connection strings (with potential passwords) will be unencrypted +*.pubxml +*.publishproj + +# NuGet Packages +*.nupkg +# The packages folder can be ignored because of Package Restore +**/packages/* +# except build/, which is used as an MSBuild target. +!**/packages/build/ +# Uncomment if necessary however generally it will be regenerated when needed +#!**/packages/repositories.config + +# Windows Azure Build Output +csx/ +*.build.csdef + +# Windows Store app package directory +AppPackages/ + +# Visual Studio cache files +# files ending in .cache can be ignored +*.[Cc]ache +# but keep track of directories ending in .cache +!*.[Cc]ache/ + +# Others +ClientBin/ +[Ss]tyle[Cc]op.* +~$* +*~ +*.dbmdl +*.dbproj.schemaview +*.pfx +*.publishsettings +node_modules/ +orleans.codegen.cs + +# RIA/Silverlight projects +Generated_Code/ + +# Backup & report files from converting an old project file +# to a newer Visual Studio version. Backup files are not needed, +# because we have git ;-) +_UpgradeReport_Files/ +Backup*/ +UpgradeLog*.XML +UpgradeLog*.htm + +# SQL Server files +*.mdf +*.ldf + +# Business Intelligence projects +*.rdl.data +*.bim.layout +*.bim_*.settings + +# Microsoft Fakes +FakesAssemblies/ + +# Node.js Tools for Visual Studio +.ntvs_analysis.dat + +# Visual Studio 6 build log +*.plg + +# Visual Studio 6 workspace options file +*.opt + +# Visual Studio LightSwitch build output +**/*.HTMLClient/GeneratedArtifacts +**/*.DesktopClient/GeneratedArtifacts +**/*.DesktopClient/ModelManifest.xml +**/*.Server/GeneratedArtifacts +**/*.Server/ModelManifest.xml +_Pvt_Extensions + + +### WebStorm ### +# Covers JetBrains IDEs: IntelliJ, RubyMine, PhpStorm, AppCode, PyCharm, CLion, Android Studio + +*.iml + +## Directory-based project format: +.idea/ +# if you remove the above rule, at least ignore the following: + +# User-specific stuff: +# .idea/workspace.xml +# .idea/tasks.xml +# .idea/dictionaries + +# Sensitive or high-churn files: +# .idea/dataSources.ids +# .idea/dataSources.xml +# .idea/sqlDataSources.xml +# .idea/dynamic.xml +# .idea/uiDesigner.xml + +# Gradle: +# .idea/gradle.xml +# .idea/libraries + +# Mongo Explorer plugin: +# .idea/mongoSettings.xml + +## File-based project format: +*.ipr +*.iws + +## Plugin-specific files: + +# IntelliJ +/out/ + +# mpeltonen/sbt-idea plugin +.idea_modules/ + +# JIRA plugin +atlassian-ide-plugin.xml + +# Crashlytics plugin (for Android Studio and IntelliJ) +com_crashlytics_export_strings.xml +crashlytics.properties +crashlytics-build.properties + + +### Eclipse ### +*.pydevproject +.metadata +.gradle +bin/ +tmp/ +*.tmp +*.bak +*.swp +*~.nib +local.properties +.settings/ +.loadpath + +# Eclipse Core +#.project + +# External tool builders +.externalToolBuilders/ + +# Locally stored "Eclipse launch configurations" +#*.launch + +# CDT-specific +#.cproject + +# JDT-specific (Eclipse Java Development Tools) +.classpath + +# Java annotation processor (APT) +.factorypath + +# PDT-specific +.buildpath + +# sbteclipse plugin +.target + +# TeXlipse plugin +.texlipse + + +### Xcode ### +# Xcode +# +# gitignore contributors: remember to update Global/Xcode.gitignore, Objective-C.gitignore & Swift.gitignore + +## Build generated +build/ +DerivedData + +## Various settings +*.pbxuser +!default.pbxuser +*.mode1v3 +!default.mode1v3 +*.mode2v3 +!default.mode2v3 +*.perspectivev3 +!default.perspectivev3 +xcuserdata + +## Other +*.xccheckout +*.moved-aside +*.xcuserstate +CUDAPathTracer.zip diff --git a/CMakeLists.txt b/CMakeLists.txt index d3d976c13..0d6e1008b 100644 --- a/CMakeLists.txt +++ b/CMakeLists.txt @@ -1,95 +1,135 @@ -cmake_minimum_required(VERSION 3.0) +cmake_minimum_required(VERSION 3.24) +project(cis565_path_tracer LANGUAGES CUDA CXX) -project(cis565_path_tracer) +set_property(GLOBAL PROPERTY USE_FOLDERS ON) set(CMAKE_MODULE_PATH "${CMAKE_SOURCE_DIR}/cmake" ${CMAKE_MODULE_PATH}) -# Set up include and lib paths -set(EXTERNAL "external") -include_directories("${EXTERNAL}") -include_directories("${EXTERNAL}/include") -if(${CMAKE_SYSTEM_NAME} MATCHES "Darwin") - set(EXTERNAL_LIB_PATH "${EXTERNAL}/lib/osx") -elseif(${CMAKE_SYSTEM_NAME} MATCHES "Linux") - set(EXTERNAL_LIB_PATH "${EXTERNAL}/lib/linux" "/usr/lib64") -elseif(WIN32) - set(EXTERNAL_LIB_PATH "${EXTERNAL}/lib/win") -endif() -link_directories(${EXTERNAL_LIB_PATH}) -list(APPEND CMAKE_LIBRARY_PATH "${EXTERNAL_LIB_PATH}") - - -# Find up and set up core dependency libs - -set(GLFW_INCLUDE_DIR "${EXTERNAL}/include") -set(GLFW_LIBRARY_DIR "${CMAKE_LIBRARY_PATH}") -find_library(GLFW_LIBRARY "glfw3" HINTS "${GLFW_LIBRARY_DIR}") - -set(GLEW_INCLUDE_DIR "${EXTERNAL}/include") -set(GLEW_LIBRARY_DIR "${CMAKE_LIBRARY_PATH}") -add_definitions(-DGLEW_STATIC) -find_package(GLEW) +set(CMAKE_ARCHIVE_OUTPUT_DIRECTORY ${CMAKE_BINARY_DIR}/lib) +set(CMAKE_LIBRARY_OUTPUT_DIRECTORY ${CMAKE_BINARY_DIR}/lib) +set(CMAKE_RUNTIME_OUTPUT_DIRECTORY ${CMAKE_BINARY_DIR}/bin) -find_package(OpenGL) +# Enable C++17 for host code +set(CMAKE_CXX_STANDARD 17) +set(CMAKE_CUDA_STANDARD 17) +set(CMAKE_CUDA_STANDARD_REQUIRED ON) -set(CORELIBS - "${GLFW_LIBRARY}" - "${OPENGL_LIBRARY}" - "${GLEW_LIBRARY}" - ) - -# Enable C++11 for host code -set(CMAKE_CXX_STANDARD 11) - -# Enable CUDA debug info in debug mode builds -list(APPEND CUDA_NVCC_FLAGS_DEBUG -G -g) - -# OSX-specific hacks/fixes -if(${CMAKE_SYSTEM_NAME} MATCHES "Darwin") - list(APPEND CORELIBS "-framework IOKit") - list(APPEND CORELIBS "-framework Cocoa") - list(APPEND CORELIBS "-framework CoreVideo") +# Set a default build type if none was specified +if(NOT CMAKE_BUILD_TYPE AND NOT CMAKE_CONFIGURATION_TYPES) + SET(CMAKE_BUILD_TYPE Release CACHE STRING "Choose the type of build." FORCE) + # Set the possible values of build type for cmake-gui + SET_PROPERTY(CACHE CMAKE_BUILD_TYPE PROPERTY STRINGS "Debug" "Release" "MinSizeRel" "RelWithDebInfo") endif() -# Linux-specific hacks/fixes -if(${CMAKE_SYSTEM_NAME} MATCHES "Linux") - list(APPEND CMAKE_EXE_LINKER_FLAGS "-lX11 -lXxf86vm -lXrandr -lXi") -endif() - -if (WIN32) - list(APPEND CORELIBS legacy_stdio_definitions.lib) -endif() - -# Crucial magic for CUDA linking -find_package(Threads REQUIRED) -find_package(CUDA 8.0 REQUIRED) - -set(CUDA_ATTACH_VS_BUILD_RULE_TO_CUDA_FILE ON) -set(CUDA_SEPARABLE_COMPILATION ON) - -if(${CMAKE_SYSTEM_NAME} MATCHES "Darwin") - set(CUDA_PROPAGATE_HOST_FLAGS OFF) -endif() +find_package(OpenGL REQUIRED) +find_package(CUDAToolkit REQUIRED) + +if(UNIX) + include_directories("${CMAKE_CUDA_TOOLKIT_INCLUDE_DIRECTORIES}") + find_package(glfw3 REQUIRED) + find_package(GLEW REQUIRED) + set(GL_LIBRARIES glfw ${GLEW_LIBRARIES} ${OPENGL_LIBRARIES}) +else(UNIX) + include_directories("${CUDAToolkit_INCLUDE_DIRS}") + set(EXTERNAL "${CMAKE_SOURCE_DIR}/external") + + set(GLFW_ROOT_DIR ${EXTERNAL}) + set(GLFW_USE_STATIC_LIBS ON) + find_package(GLFW REQUIRED) + + set(GLEW_ROOT_DIR ${EXTERNAL}) + set(GLEW_USE_STATIC_LIBS ON) + find_package(GLEW REQUIRED) + + add_definitions(${GLEW_DEFINITIONS}) + include_directories(${GLEW_INCLUDE_DIR} ${GLFW_INCLUDE_DIR}) + set(GL_LIBRARIES ${GLEW_LIBRARY} ${GLFW_LIBRARY} ${OPENGL_LIBRARY}) +endif(UNIX) + +set(GLM_ROOT_DIR "${CMAKE_SOURCE_DIR}/external") +find_package(GLM REQUIRED) +include_directories(${GLM_INCLUDE_DIRS}) + + + +set(TINYGLTF_DIR ${CMAKE_SOURCE_DIR}/external/tinygltf) + +add_library(tinygltf_impl STATIC + ${CMAKE_SOURCE_DIR}/src/third_party/tinygltf_impl.cpp +) +target_include_directories(tinygltf_impl PUBLIC ${TINYGLTF_DIR}) + +set(headers + src/image.h + src/interactions.h + src/intersections.h + src/glslUtility.hpp + src/pathtrace.h + src/scene.h + src/sceneStructs.h + src/utilities.h +) + +set(sources + src/main.cpp + src/stb.cpp + src/image.cpp + src/glslUtility.cpp + src/pathtrace.cu + src/intersections.cu + src/interactions.cu + src/scene.cpp + src/utilities.cpp +) + +set(imgui_headers + src/ImGui/imconfig.h + src/ImGui/imgui.h + src/ImGui/imgui_impl_glfw.h + src/ImGui/imgui_impl_opengl3.h + src/ImGui/imgui_impl_opengl3_loader.h + src/ImGui/imgui_internal.h + src/ImGui/imstb_rectpack.h + src/ImGui/imstb_textedit.h + src/ImGui/imstb_truetype.h +) + +set(imgui_sources + src/ImGui/imgui.cpp + src/ImGui/imgui_demo.cpp + src/ImGui/imgui_draw.cpp + src/ImGui/imgui_impl_glfw.cpp + src/ImGui/imgui_impl_opengl3.cpp + src/ImGui/imgui_tables.cpp + src/ImGui/imgui_widgets.cpp +) + +list(SORT headers) +list(SORT sources) +list(SORT imgui_headers) +list(SORT imgui_sources) + +source_group("Headers" FILES ${headers}) +source_group("Sources" FILES ${sources}) +source_group("ImGui\\Headers" FILES ${imgui_headers}) +source_group("ImGui\\Sources" FILES ${imgui_sources}) + +#add_subdirectory(src/ImGui) +add_subdirectory(stream_compaction) # TODO: uncomment if using your stream compaction + +add_executable(${CMAKE_PROJECT_NAME} ${sources} ${headers} ${imgui_sources} ${imgui_headers} "src/mesh_loader.h" "src/mesh_loader.cpp") +target_include_directories(${CMAKE_PROJECT_NAME} PRIVATE ${TINYGLTF_DIR}) +target_link_libraries(${CMAKE_PROJECT_NAME} + PRIVATE + ${GL_LIBRARIES} + stream_compaction + tinygltf_impl +) +set_target_properties(${CMAKE_PROJECT_NAME} PROPERTIES CUDA_SEPARABLE_COMPILATION ON) +set_target_properties(${CMAKE_PROJECT_NAME} PROPERTIES CUDA_ARCHITECTURES native) -include_directories(.) -#add_subdirectory(stream_compaction) # TODO: uncomment if using your stream compaction -add_subdirectory(src) +target_compile_options(${CMAKE_PROJECT_NAME} PRIVATE "$<$,$>:-G;-src-in-ptx>") +target_compile_options(${CMAKE_PROJECT_NAME} PRIVATE "$<$,$>:-lineinfo;-src-in-ptx>") -cuda_add_executable(${CMAKE_PROJECT_NAME} - "src/main.h" - "src/main.cpp" - ) +set_property(DIRECTORY ${CMAKE_CURRENT_SOURCE_DIR} PROPERTY VS_STARTUP_PROJECT ${CMAKE_PROJECT_NAME}) -target_link_libraries(${CMAKE_PROJECT_NAME} - src - #stream_compaction # TODO: uncomment if using your stream compaction - ${CORELIBS} - ) - -add_custom_command( - TARGET ${CMAKE_PROJECT_NAME} - POST_BUILD - COMMAND ${CMAKE_COMMAND} -E copy_directory - ${CMAKE_SOURCE_DIR}/shaders - ${CMAKE_BINARY_DIR}/shaders - ) diff --git a/CMakeSettings.json b/CMakeSettings.json new file mode 100644 index 000000000..e4ba72b63 --- /dev/null +++ b/CMakeSettings.json @@ -0,0 +1,27 @@ +{ + "configurations": [ + { + "name": "x64-Debug", + "generator": "Ninja", + "configurationType": "Debug", + "inheritEnvironments": [ "msvc_x64_x64" ], + "buildRoot": "${projectDir}\\out\\build\\${name}", + "installRoot": "${projectDir}\\out\\install\\${name}", + "cmakeCommandArgs": "", + "buildCommandArgs": "", + "ctestCommandArgs": "" + }, + { + "name": "x64-Release", + "generator": "Ninja", + "configurationType": "Release", + "buildRoot": "${projectDir}\\out\\build\\${name}", + "installRoot": "${projectDir}\\out\\install\\${name}", + "cmakeCommandArgs": "", + "buildCommandArgs": "", + "ctestCommandArgs": "", + "inheritEnvironments": [ "msvc_x64_x64" ], + "variables": [] + } + ] +} \ No newline at end of file diff --git a/INSTRUCTION.md b/INSTRUCTION.md index 31c967adb..848bbe028 100644 --- a/INSTRUCTION.md +++ b/INSTRUCTION.md @@ -1,192 +1,202 @@ -Proj 3 CUDA Path Tracer - Instructions -======================== +# Project 3 CUDA Path Tracer - Instructions -This is due **Sunday October 1** at midnight. +This is due **Tuesday September 30th** at 11:59pm. You can update your README through **Thursday October 2nd** at 11:59pm. -Pathtracing Primer: https://docs.google.com/presentation/d/1q3h2GVDorEFzmESNfFwR6mODnzS6WbftiVsvaFNGihQ/ +This project involves a significant bit of running time to generate high-quality images, so be sure to take that into account. You will receive an additional 2 days (due Thursday, October 2nd) for "README and Scene" only updates. However, the standard project requirements for READMEs still apply for the October 1st deadline. You may use these two extra days to improve your images, charts, performance analysis, etc. + +If you plan to use late days on this project (which we recommend), they can be applied to the code deadline (which will also push back the README deadline), or they can be applied to just the README deadline. For example, you can use one late day to push the code deadline to October 1st and the README deadline to October 2nd, and then use another late day to push the README deadline further to October 4th, for a total of two late days used. + +[Link to "Pathtracing Primer" Recitation Slides](https://docs.google.com/presentation/d/1rr6zFbpVkdMEkxBK4QLN4_tBRo168SJA_bMi2GkBB6I/edit?usp=drive_link) **Summary:** -In this project, you'll implement a CUDA-based path tracer capable of rendering -globally-illuminated images very quickly. -Since in this class we are concerned with working in GPU programming, -performance, and the generation of actual beautiful images (and not with -mundane programming tasks like I/O), this project includes base code for -loading a scene description file, described below, and various other things -that generally make up a framework for previewing and saving images. - -The core renderer is left for you to implement. Finally, note that, while this -base code is meant to serve as a strong starting point for a CUDA path tracer, -you are not required to use it if you don't want to. You may also change any -part of the base code as you please. **This is YOUR project.** - -**Recommendation:** Every image you save should automatically get a different -filename. Don't delete all of them! For the benefit of your README, keep a -bunch of them around so you can pick a few to document your progress at the -end. Outtakes are highly appreciated! - -### Contents + +In this project, you'll implement a CUDA-based path tracer capable of rendering globally-illuminated images very quickly. Since in this class we are concerned with working in GPU programming, performance, and the generation of actual beautiful images (and not with mundane programming tasks like I/O), this project includes base code for loading a scene description file, described below, and various other things that generally make up a framework for previewing and saving images. + +The core renderer is left for you to implement. Finally, note that, while this base code is meant to serve as a strong starting point for a CUDA path tracer, you are not required to use it if you don't want to. You may change any part of the base code as you please, or even start from scratch. **This is YOUR project.** + +**Recommendations:** + +* Every image you save should automatically get a different filename. Don't delete all of them! For the benefit of your README, keep a bunch of them around so you can pick a few to document your progress at the end. Outtakes are highly appreciated! +* Remember to save your debug images - these will make for a great README. +* Also remember to save and share your bloopers. Every image has a story to tell and we want to hear about it. + +## Contents * `src/` C++/CUDA source files. -* `scenes/` Example scene description files. -* `img/` Renders of example scene description files. - (These probably won't match precisely with yours.) +* `scenes/` Example scene description JSON files. +* `img/` Renders of example scene description files. (These probably won't match precisely with yours.) * `external/` Includes and static libraries for 3rd party libraries. +## Running the code -### Running the code - -The main function requires a scene description file. Call the program with -one as an argument: `cis565_path_tracer scenes/sphere.txt`. -(In Visual Studio, `../scenes/sphere.txt`.) +The main function requires a scene description file. Call the program with one as an argument: `cis565_path_tracer scenes/sphere.json`. (In Visual Studio, `../scenes/sphere.json`.) -If you are using Visual Studio, you can set this in the Debugging > Command -Arguments section in the Project properties. Make sure you get the path right - -read the console for errors. +If you are using Visual Studio, you can set this in the `Debugging > Command Arguments` section in the `Project Properties`. Make sure you get the path right - read the console for errors. -#### Controls +### Controls * Esc to save an image and exit. * S to save an image. Watch the console for the output filename. -* Space to re-center the camera at the original scene lookAt point -* left mouse button to rotate the camera -* right mouse button on the vertical axis to zoom in/out -* middle mouse button to move the LOOKAT point in the scene's X/Z plane +* Space to re-center the camera at the original scene lookAt point. +* Left mouse button to rotate the camera. +* Right mouse button on the vertical axis to zoom in/out. +* Middle mouse button to move the LOOKAT point in the scene's X/Z plane. ## Requirements -**Ask in the google group for clarifications.** - In this project, you are given code for: -* Loading and reading the scene description format -* Sphere and box intersection functions -* Support for saving images -* Working CUDA-GL interop for previewing your render while it's running +* Loading and reading the scene description format. +* Sphere and box intersection functions. +* Support for saving images. +* Working CUDA-GL interop for previewing your render while it's running. * A skeleton renderer with: - * Naive ray-scene intersection - * A "fake" shading kernel that colors rays based on the material and intersection properties - but does NOT compute a new ray based on the BSDF + * Naive ray-scene intersection. + * A "fake" shading kernel that colors rays based on the material and intersection properties but does NOT compute a new ray based on the BSDF. + +**Ask in Ed Discussion for clarifications.** -##### Part 1 - Core Features +### Part 1 - Core Features You will need to implement the following features: + * A shading kernel with BSDF evaluation for: - * Ideal Diffuse surfaces (using provided cosine-weighted scatter function, see below.) [PBRT 8.3]. - * Perfectly specular-reflective (mirrored) surfaces (e.g. using `glm::reflect`). - * See notes on diffuse/specular in `scatterRay` and on imperfect specular below. -* Path continuation/termination using Stream Compaction from Project 2 + * Ideal diffuse surfaces (using provided cosine-weighted scatter function, see below.) [PBRTv4 9.2](https://pbr-book.org/4ed/Reflection_Models/Diffuse_Reflection) * After you have a [basic pathtracer up and running](img/REFERENCE_cornell.5000samp.png), -implement a means of making rays/pathSegments/intersections contiguous in memory -by material type. This should be easily toggleable. - * Consider the problems with coloring every path segment in a buffer and performing - BSDF evaluation using one big shading kernel: - different materials/BSDF evaluations within the kernel will take different - amounts of time to complete. - * Sort the rays/path segments so that rays/paths interacting with the same material - are contiguous in memory before shading. How does this impact performance? Why? -* A toggleable option to cache the first bounce intersections for re-use across all -subsequent iterations. Provide performance benefit analysis across different -max ray depths. - -##### Part 2 - Make Your Pathtracer Unique! - -You are required to choose and implement at least 2 of the following features. -If you find other good references for these features, share them! -**Extra credit**: implement more features on top of the 2 required ones, -with point value up to +20/100 at the grader's discretion -(based on difficulty and coolness). - -* Work-efficient stream compaction using shared memory across - multiple blocks. (See - [*GPU Gems 3*, Chapter 39](http://http.developer.nvidia.com/GPUGems3/gpugems3_ch39.html).) - Note that this is not an option if you implemented shared memory stream - compaction as extra credit for Project 2. -* 2 of these 3 smaller features: - * Refraction (e.g. glass/water) [PBRT 8.2] with Frensel effects using - [Schlick's approximation](https://en.wikipedia.org/wiki/Schlick's_approximation) - or more accurate methods [PBRT 8.5]. You can use `glm::refract` for - Snell's law. - * Recommended but not required: non-perfect specular surfaces. (See below.) - * Physically-based depth-of-field (by jittering rays within an aperture) - [PBRT 6.2.3]. - * Stochastic Sampled Antialiasing. See Paul Bourke's [notes](http://paulbourke.net/miscellaneous/aliasing/). - Keep in mind how this influences the first-bounce cache in part 1. -* Texture mapping [PBRT 10.4] and Bump mapping [PBRT 9.3]. + implement a means of making rays/pathSegments/intersections contiguous in memory by material type. This should be easily toggleable. + * Consider the problems with coloring every path segment in a buffer and performing BSDF evaluation using one big shading kernel: different materials/BSDF evaluations within the kernel will take different amounts of time to complete. + * Sort the rays/path segments so that rays/paths interacting with the same material are contiguous in memory before shading. How does this impact performance? Why? +* Lastly, implement stochastic sampled antialiasing. See the "Stochastic Sampling" section in Paul Bourke's [notes](https://paulbourke.net/miscellaneous/raytracing/). + +### Part 2 - Make Your Pathtracer Unique! + +The following features are a non-exhaustive list of features you can choose from based on your own interests and motivation. Each feature has an associated score (represented in emoji numbers, eg. :five:). + +**You are required to implement additional features of your choosing from the list below totalling up to minimum 10 score points.** + +An example set of optional features is: + +* Mesh Loading - :four: points +* Refraction - :two: points +* Depth of field - :two: points +* Final rays post processing - :three: points + +This list is not comprehensive. If you have a particular idea you would like to implement (e.g. acceleration structures, etc.), please post on Ed. + +**Extra credit**: implement more features on top of the above required ones, with point value up to +25/100 at the grader's discretion (based on difficulty and coolness), generally. + +#### Visual Improvements + +* :two: Refraction (e.g. glass/water) [PBRTv4 9.3](https://pbr-book.org/4ed/Reflection_Models/Specular_Reflection_and_Transmission) with Frensel effects using [Schlick's approximation](https://en.wikipedia.org/wiki/Schlick's_approximation) or more accurate methods [PBRTv4 9.5](https://pbr-book.org/4ed/Reflection_Models/Dielectric_BSDF.html). You can use `glm::refract` for Snell's law. + * Recommended but not required: non-perfect specular surfaces (see "Imperfect Specular Lighting" below). +* :two: Physically-based depth-of-field (by jittering rays within an aperture). [PBRTv4 5.2.3](https://pbr-book.org/4ed/Cameras_and_Film/Projective_Camera_Models#TheThinLensModelandDepthofField) +* :four: Procedural Shapes & Textures. + * You must generate a minimum of two different complex shapes procedurally. (Not primitives) + * You must be able to shade object with a minimum of two different textures +* :five: (:six: if combined with Arbitrary Mesh Loading) Texture mapping [PBRTv4 10.4](https://pbr-book.org/4ed/Textures_and_Materials/Image_Texture) and bump mapping [PBRTv3 9.3](https://www.pbr-book.org/3ed-2018/Materials/Bump_Mapping.html). * Implement file-loaded textures AND a basic procedural texture * Provide a performance comparison between the two -* Direct lighting (by taking a final ray directly to a random point on an - emissive object acting as a light source). Or more advanced [PBRT 15.1.1]. -* Some method of defining object motion, and motion blur by averaging samples - at different times in the animation. -* Subsurface scattering [PBRT 5.6.2, 11.6]. -* [Better hemisphere sampling methods](http://graphics.ucsd.edu/courses/cse168_s14/ucsd/CSE168_11_Random.pdf) -* Arbitrary mesh loading and rendering (e.g. `obj` files) with -toggleable bounding volume intersection culling - * You can find models online or export them from your favorite 3D modeling application. - With approval, you may use a third-party loading code to bring the data - into C++. [tinyObj](http://syoyo.github.io/tinyobjloader/) is highly recommended. +* :two: Direct lighting by taking a final ray directly to a random point on an emissive object acting as a light source). Or more advanced [PBRTv4 13.4](https://pbr-book.org/4ed/Light_Transport_I_Surface_Reflection/A_Better_Path_Tracer). +* :four: Subsurface scattering [PBRTv3 5.6.2](https://www.pbr-book.org/3ed-2018/Color_and_Radiometry/Surface_Reflection#TheBSSRDF), [11.4](https://www.pbr-book.org/3ed-2018/Volume_Scattering/The_BSSRDF.html). +* :three: [Better random number sequences for Monte Carlo ray tracing](https://cseweb.ucsd.edu/classes/sp17/cse168-a/CSE168_07_Random.pdf) +* :three: Some method of defining object motion, and motion blur by averaging samples at different times in the animation. +* :three: Use final rays to apply post-processing shaders. Please post your ideas on Piazza before starting. + +#### Mesh Improvements + +* Arbitrary mesh loading and rendering (e.g. glTF 2.0 (preferred) or `obj` files) with toggleable bounding volume intersection culling + + * :four: glTF + + * :two: OBJ + + * For other formats, please check on the class forum + + * You can find models online or export them from your favorite 3D modeling application. With approval, you may use a third-party loading code to bring the data into C++. + + * [tinygltf](https://github.com/syoyo/tinygltf/) is highly recommended for glTF. + * [tinyObj](https://github.com/syoyo/tinyobjloader) is highly recommended for OBJ. + * [obj2gltf](https://github.com/CesiumGS/obj2gltf) can be used to convert OBJ to glTF files. You can find similar projects for FBX and other formats. + * You can use the triangle intersection function `glm::intersectRayTriangle`. - * bounding volume intersection culling: reduce the number of rays that have to - be checked against the entire mesh by first checking rays against a volume - that completely bounds the mesh. For full credit, provide performance analysis - with and without this optimization. -* Hierarchical spatial datastructures - for better ray/scene intersection testing - * Octree recommended - this feature is more about traversal on the GPU than perfect tree structure - * CPU-side datastructure construction is sufficient - GPU-side construction was - a [final project.](https://github.com/jeremynewlin/Accel) + + * Bounding volume intersection culling: reduce the number of rays that have to be checked against the entire mesh by first checking rays against a volume that completely bounds the mesh. For full credit, provide performance analysis with and without this optimization. + + > Note: This goes great with the Hierarcical Spatial Data Structures. + +#### Performance Improvements + +* :one: Implement Russian roulette path termination, which terminates unimportant paths early without introducing bias. Make sure to include a performance evaluation with and without it enabled, especially for closed scenes. [PBRTv3 13.7](https://pbr-book.org/3ed-2018/Monte_Carlo_Integration/Russian_Roulette_and_Splitting) +* :two: Work-efficient stream compaction using shared memory across multiple blocks. (See [*GPU Gems 3*, Chapter 39](https://developer.nvidia.com/gpugems/gpugems3/part-vi-gpu-computing/chapter-39-parallel-prefix-sum-scan-cuda).) + * Note that you will NOT receieve extra credit for this if you implemented shared memory stream compaction as extra credit for Project 2. +* :six: Hierarchical spatial data structures - for better ray/scene intersection testing + * BVH or Octree recommended - this feature is more about traversal on the GPU than perfect tree structure + * CPU-side data structure construction is sufficient - GPU-side construction was a [final project.](https://github.com/jeremynewlin/Accel) * Make sure this is toggleable for performance comparisons - * If implemented in conjunction with Arbitrary mesh loading, this qualifies as the -toggleable bounding volume intersection culling. + * If implemented in conjunction with Arbitrary mesh loading (required for this year), this qualifies as the toggleable bounding volume intersection culling. * See below for more resources -* [Waverfont pathtracing](https://research.nvidia.com/publication/megakernels-considered-harmful-wavefront-path-tracing-gpus): -Group rays by material without a sorting pass. A sane implementation will -require considerable refactoring, since every supported material suddenly needs -its own kernel. +* :six: [Wavefront pathtracing](https://research.nvidia.com/publication/megakernels-considered-harmful-wavefront-path-tracing-gpus): + Group rays by material without a sorting pass. A sane implementation will require considerable refactoring, since every supported material suddenly needs its own kernel. +* :three: [*Open Image AI Denoiser or an alternative approve image denoiser*](https://github.com/OpenImageDenoise/oidn) Open Image Denoiser is an image denoiser which works by applying a filter on Monte-Carlo-based pathtracer output. The denoiser runs on the CPU and takes in path tracer output from 1spp to beyond. In order to get full credit for this, you must pass in at least one extra buffer along with the [raw "beauty" buffer](https://github.com/OpenImageDenoise/oidn#open-image-denoise-overview). **Ex:** Beauty + Normals. + * Part of this extra credit is figuring out where the filter should be called, and how you should manage the data for the filter step. + * It is important to note that integrating this is not as simple as it may seem at first glance. Library integration, buffer creation, device compatibility, and more are all real problems which will appear, and it may be hard to debug them. Please only try this if you have finished the Part 2 early and would like extra points. While this is difficult, the result would be a significantly faster resolution of the path traced image. +* :five: Re-startable Path tracing: Save some application state (iteration number, samples so far, acceleration structure) so you can start and stop rendering instead of leaving your computer running for hours at end (which will happen in this project) +* :five: Switch the project from using CUDA-OpenGL Interop to using CUDA-Vulkan interop (this is a really great one for those of you interested in doing Vulkan). Talk to TAs if you are planning to pursue this. + +#### Optimization + +**For those of you that are not as interested in the topic of rendering**, we encourage you to focus on optimizing the basic path tracer using GPU programming techniques and more advanced CUDA features. +In addition to the core features, we do recommend at least implementing an OBJ mesh loader before focusing on optimization so that you can load in heavy geometries to start seeing performance hit. +Please refer to the course materials (especially the CUDA Performance lecture) and the [CUDA's Best Practice Guide](https://docs.nvidia.com/cuda/pdf/CUDA_C_Best_Practices_Guide.pdf) on how to optimize CUDA performance. +Some examples include: + +* Use shared memory to improve memory bandwidth +* Use intrinsinc functions to improve instruction throughput +* Use CUDA streams and/or graph for concurrent kernel executions + +For each specific optimization technique, please post on Ed Discussion so we can determine the appropriate points to award. -This 'extra features' list is not comprehensive. If you have a particular idea -you would like to implement (e.g. acceleration structures, etc.), please -contact us first. +## Analysis For each extra feature, you must provide the following analysis: -* Overview write-up of the feature -* Performance impact of the feature +* Overview write-up of the feature along with before/after images. +* Performance impact of the feature. * If you did something to accelerate the feature, what did you do and why? -* Compare your GPU version of the feature to a HYPOTHETICAL CPU version - (you don't have to implement it!) Does it benefit or suffer from being - implemented on the GPU? +* Compare your GPU version of the feature to a HYPOTHETICAL CPU version (you don't have to implement it!). Does it benefit or suffer from being implemented on the GPU? * How might this feature be optimized beyond your current implementation? ## Base Code Tour You'll be working in the following files. Look for important parts of the code: -search for `CHECKITOUT`. You'll have to implement parts labeled with `TODO`. -(But don't let these constrain you - you have free rein!) -* `src/pathtrace.cu`: path tracing kernels, device functions, and calling code - * `pathtraceInit` initializes the path tracer state - it should copy - scene data (e.g. geometry, materials) from `Scene`. +* Search for `CHECKITOUT`. + +* You'll have to implement parts labeled with `TODO`. (But don't let these constrain you - you have free rein!) + +* `src/pathtrace.h`/`cu`: path tracing kernels, device functions, and calling code + + * `pathtraceInit` initializes the path tracer state - it should copy scene data (e.g. geometry, materials) from `Scene`. * `pathtraceFree` frees memory allocated by `pathtraceInit` - * `pathtrace` performs one iteration of the rendering - it handles kernel - launches, memory copies, transferring some data, etc. + * `pathtrace` performs one iteration of the rendering - it handles kernel launches, memory copies, transferring some data, etc. * See comments for a low-level path tracing recap. -* `src/intersections.h`: ray intersection functions - * `boxIntersectionTest` and `sphereIntersectionTest`, which take in a ray and - a geometry object and return various properties of the intersection. -* `src/interactions.h`: ray scattering functions - * `calculateRandomDirectionInHemisphere`: a cosine-weighted random direction - in a hemisphere. Needed for implementing diffuse surfaces. - * `scatterRay`: this function should perform all ray scattering, and will - call `calculateRandomDirectionInHemisphere`. See comments for details. -* `src/main.cpp`: you don't need to do anything here, but you can change the - program to save `.hdr` image files, if you want (for postprocessing). -* `stream_compaction`: A dummy folder into which you should place your - Stream Compaction implementation from Project 2. It should be sufficient to copy the files - from [here](https://github.com/CIS565-Fall-2017/Project2-Stream-Compaction/tree/master/stream_compaction) + +* `src/intersections.h`/`cu`: ray intersection functions + + * `boxIntersectionTest` and `sphereIntersectionTest`, which take in a ray and a geometry object and return various properties of the intersection. + +* `src/interactions.h`/`cu`: ray scattering functions + + * `calculateRandomDirectionInHemisphere`: a cosine-weighted random direction in a hemisphere. Needed for implementing diffuse surfaces. + * `scatterRay`: this function should perform all ray scattering, and will call `calculateRandomDirectionInHemisphere`. See comments for details. + +* `src/main.cpp`: you don't need to do anything here, but you can change the program to save `.hdr` image files, if you want (for postprocessing). + +* `stream_compaction`: A dummy folder into which you should place your Stream Compaction implementation from Project 2. It should be sufficient to copy the files from [here](https://github.com/CIS5650-Fall-2024/Project2-Stream-Compaction/tree/main/stream_compaction) ### Generating random numbers -``` +```cpp thrust::default_random_engine rng(hash(index)); thrust::uniform_real_distribution u01(0, 1); float result = u01(rng); @@ -195,49 +205,33 @@ float result = u01(rng); There is a convenience function for generating a random engine using a combination of index, iteration, and depth as the seed: -``` -thrust::default_random_engine rng = random_engine(iter, index, depth); +```cpp +thrust::default_random_engine rng = makeSeededRandomEngine(iter, index, path.remainingBounces); ``` ### Imperfect specular lighting -In path tracing, like diffuse materials, specular materials are -simulated using a probability distribution instead computing the -strength of a ray bounce based on angles. +In path tracing, like diffuse materials, specular materials are simulated using a probability distribution instead computing the strength of a ray bounce based on angles. -Equations 7, 8, and 9 of -[*GPU Gems 3*, Chapter 20](http://http.developer.nvidia.com/GPUGems3/gpugems3_ch20.html) -give the formulas for generating a random specular ray. (Note that -there is a typographical error: χ in the text = ξ in the formulas.) +Equations 7, 8, and 9 of [*GPU Gems 3*, Chapter 20](https://developer.nvidia.com/gpugems/gpugems3/part-iii-rendering/chapter-20-gpu-based-importance-sampling) give the formulas for generating a random specular ray. (Note that there is a typographical error: χ in the text = ξ in the formulas.) -Also see the notes in `scatterRay` for probability splits between -diffuse/specular/other material types. +Also see the notes in `scatterRay` for probability splits between diffuse/specular/other material types. -See also: PBRT 8.2.2. +See also: [PBRTv3 8.2.2](https://www.pbr-book.org/3ed-2018/Reflection_Models/Specular_Reflection_and_Transmission#SpecularReflection). ### Hierarchical spatial datastructures -One method for avoiding checking a ray against every primitive in the scene or -every triangle in a mesh is to bin the primitives in a hierarchical spatial -datastructure such as an [octree](https://en.wikipedia.org/wiki/Octree). -Ray-primitive intersection then involves recursively testing the ray against -bounding volumes at different levels in the tree until a leaf containing a -subset of primitives/triangles is reached, at which point the ray is checked -against all the primitives/triangles in the leaf. - -* We highly recommend building the datastructure on the CPU and encapsulating -the tree buffers into their own struct, with its own dedicated GPU memory -management functions. -* We highly recommend working through your tree construction algorithm by hand -with a couple cases before writing any actual code. +One method for avoiding checking a ray against every primitive in the scene or every triangle in a mesh is to bin the primitives in a hierarchical spatial datastructure such as an [octree](https://en.wikipedia.org/wiki/Octree). + +Ray-primitive intersection then involves recursively testing the ray against bounding volumes at different levels in the tree until a leaf containing a subset of primitives/triangles is reached, at which point the ray is checked against all the primitives/triangles in the leaf. + +* We highly recommend building the datastructure on the CPU and encapsulating the tree buffers into their own struct, with its own dedicated GPU memory management functions. +* We highly recommend working through your tree construction algorithm by hand with a couple cases before writing any actual code. * How does the algorithm distribute triangles uniformly distributed in space? - * What if the model is a perfect axis-aligned cube with 12 triangles in 6 faces? - This test can often bring up numerous edge cases! + * What if the model is a perfect axis-aligned cube with 12 triangles in 6 faces? This test can often bring up numerous edge cases! * Note that traversal on the GPU must be coded iteratively! -* Good execution on the GPU requires tuning the maximum tree depth. Make this -configurable from the start. -* If a primitive spans more than one leaf cell in the datastructure, it is -sufficient for this project to count the primitive in each leaf cell. +* Good execution on the GPU requires tuning the maximum tree depth. Make this configurable from the start. +* If a primitive spans more than one leaf cell in the datastructure, it is sufficient for this project to count the primitive in each leaf cell. ### Handling Long-Running CUDA Threads @@ -245,134 +239,156 @@ By default, your GPU driver will probably kill a CUDA kernel if it runs for more > The easiest way to disable TDR for Cuda programming, assuming you have the NVIDIA Nsight tools installed, is to open the Nsight Monitor, click on "Nsight Monitor options", and under "General" set "WDDM TDR enabled" to false. This will change the registry setting for you. Close and reboot. Any change to the TDR registry setting won't take effect until you reboot. [Stack Overflow](http://stackoverflow.com/questions/497685/cuda-apps-time-out-fail-after-several-seconds-how-to-work-around-this) -### Notes on GLM +### Scene File Format + +> Note: The Scene File Format and sample scene files are provided as a starting point. You are encouraged to create your own unique scene files, or even modify the scene file format in its entirety. Be sure to document any changes in your readme. -This project uses GLM for linear algebra. +This project uses a JSON-based scene description format to define all components of a scene, such as materials, objects, lights, and camera settings. The scene file is structured as a JSON object with clearly organized sections for different elements, providing a clean and extendable format. -On NVIDIA cards pre-Fermi (pre-DX12), you may have issues with mat4-vec4 -multiplication. If you have one of these cards, be careful! If you have issues, -you might need to grab `cudamat4` and `multiplyMV` from the -[Fall 2014 project](https://github.com/CIS565-Fall-2014/Project3-Pathtracer). -Let us know if you need to do this. +### Materials -### Scene File Format +Materials are defined under the `"Materials"` section. Each material have a unique name and belongs to a material type such as `"Diffuse"`, `"Specular"`, or `"Emitting"`. + +For each type of material, it can have different properties such as: + +- `"RGB"`: An array of three float values defining the material’s color. +- `"EMITTANCE"`: A float value for emissive materials, which defines the light emission strength (optional, present only for emitting materials). +- `"ROUGHNESS"`: A float value indicating surface roughness, used for specular materials. -This project uses a custom scene description format. Scene files are flat text -files that describe all geometry, materials, lights, cameras, and render -settings inside of the scene. Items in the format are delimited by new lines, -and comments can be added using C-style `// comments`. - -Materials are defined in the following fashion: - -* MATERIAL (material ID) //material header -* RGB (float r) (float g) (float b) //diffuse color -* SPECX (float specx) //specular exponent -* SPECRGB (float r) (float g) (float b) //specular color -* REFL (bool refl) //reflectivity flag, 0 for no, 1 for yes -* REFR (bool refr) //refractivity flag, 0 for no, 1 for yes -* REFRIOR (float ior) //index of refraction for Fresnel effects -* EMITTANCE (float emittance) //the emittance strength of the material. Material is a light source iff emittance > 0. - -Cameras are defined in the following fashion: - -* CAMERA //camera header -* RES (float x) (float y) //resolution -* FOVY (float fovy) //vertical field of view half-angle. the horizonal angle is calculated from this and the reslution -* ITERATIONS (float interations) //how many iterations to refine the image -* DEPTH (int depth) //maximum depth (number of times the path will bounce) -* FILE (string filename) //file to output render to upon completion -* EYE (float x) (float y) (float z) //camera's position in worldspace -* LOOKAT (float x) (float y) (float z) //point in space that the camera orbits around and points at -* UP (float x) (float y) (float z) //camera's up vector - -Objects are defined in the following fashion: - -* OBJECT (object ID) //object header -* (cube OR sphere OR mesh) //type of object, can be either "cube", "sphere", or - "mesh". Note that cubes and spheres are unit sized and centered at the - origin. -* material (material ID) //material to assign this object -* TRANS (float transx) (float transy) (float transz) //translation -* ROTAT (float rotationx) (float rotationy) (float rotationz) //rotation -* SCALE (float scalex) (float scaley) (float scalez) //scale - -Two examples are provided in the `scenes/` directory: a single emissive sphere, -and a simple cornell box made using cubes for walls and lights and a sphere in -the middle. +Example: + +``` +"diffuse_red": { + "TYPE": "Diffuse", + "RGB": [0.85, 0.35, 0.35] +} +``` + +### Camera + +The camera configuration is defined in the `"Camera"` section. It includes settings for resolution, field of view, iterations for rendering, and camera orientation. + +- `"RES"`: An array representing the resolution of the output image in pixels. +- `"FOVY"`: The vertical field of view, in degrees. +- `"ITERATIONS"`: The number of iterations to refine the image during rendering. +- `"DEPTH"`: The maximum path tracing depth. +- `"FILE"`: The filename for the rendered output. +- `"EYE"`: The position of the camera in world coordinates. +- `"LOOKAT"`: The point in space the camera is directed at. +- `"UP"`: The up vector defining the camera's orientation. + +Example: + +``` +"Camera": { + "RES": [800, 800], + "FOVY": 45.0, + "ITERATIONS": 5000, + "DEPTH": 8, + "FILE": "cornell", + "EYE": [0.0, 5.0, 10.5], + "LOOKAT": [0.0, 5.0, 0.0], + "UP": [0.0, 1.0, 0.0] +} +``` + +### Objects + +Objects in the scene are defined as an array of entries under the `"Objects"` section. Each object contains: + +- `"TYPE"`: The type of object, such as `"cube"` or `"sphere"`. +- `"MATERIAL"`: The material assigned to the object, referencing one of the materials defined earlier. +- `"TRANS"`: An array for the translation (position) of the object. +- `"ROTAT"`: An array for the rotation of the object in degrees. +- `"SCALE"`: An array for the scale of the object. + +Example: + +``` +{ + "TYPE": "cube", + "MATERIAL": "diffuse_red", + "TRANS": [-5.0, 5.0, 0.0], + "ROTAT": [0.0, 0.0, 0.0], + "SCALE": [0.01, 10.0, 10.0] +} +``` + +This JSON format is flexible and can be easily extended to accommodate new features, such as additional material properties or object types. ## Third-Party Code Policy -* Use of any third-party code must be approved by asking on our Google Group. -* If it is approved, all students are welcome to use it. Generally, we approve - use of third-party code that is not a core part of the project. For example, - for the path tracer, we would approve using a third-party library for loading - models, but would not approve copying and pasting a CUDA function for doing - refraction. +* Use of any third-party code must be approved by asking on our Ed Discussion. +* If it is approved, all students are welcome to use it. Generally, we approve use of third-party code that is not a core part of the project. For example, for the path tracer, we would approve using a third-party library for loading models, but would not approve copying and pasting a CUDA function for doing refraction. * Third-party code **MUST** be credited in README.md. -* Using third-party code without its approval, including using another - student's code, is an academic integrity violation, and will, at minimum, - result in you receiving an F for the semester. +* Using third-party code without its approval, including using another student's code, is an academic integrity violation, and will, at minimum, result in you receiving an F for the semester. +* You may use third-party 3D models and scenes in your projects. Be sure to provide the right attribution as requested by the creators. ## README Please see: [**TIPS FOR WRITING AN AWESOME README**](https://github.com/pjcozzi/Articles/blob/master/CIS565/GitHubRepo/README.md) * Sell your project. -* Assume the reader has a little knowledge of path tracing - don't go into - detail explaining what it is. Focus on your project. -* Don't talk about it like it's an assignment - don't say what is and isn't - "extra" or "extra credit." Talk about what you accomplished. +* Assume the reader has a little knowledge of path tracing - don't go into detail explaining what it is. Focus on your project. +* Don't talk about it like it's an assignment - don't say what is and isn't "extra" or "extra credit." Talk about what you accomplished. * Use this to document what you've done. -* *DO NOT* leave the README to the last minute! It is a crucial part of the - project, and we will not be able to grade you without a good README. +* Your cover image should *NOT* be a Cornell box - show something more interesting! + * If you are heavily customizing it, seek pre-approval via Ed Discussion. +* *DO NOT* leave the README to the last minute! + * It is a crucial part of the project, and we will not be able to grade you without a good README. + * Generating images will take time. Be sure to account for it! In addition: * This is a renderer, so include images that you've made! * Be sure to back your claims for optimization with numbers and comparisons. * If you reference any other material, please provide a link to it. -* You wil not be graded on how fast your path tracer runs, but getting close to - real-time is always nice! -* If you have a fast GPU renderer, it is very good to show case this with a - video to show interactivity. If you do so, please include a link! +* You wil not be graded on how fast your path tracer runs, but getting close to real-time is always nice! +* If you have a fast GPU renderer, it is very good to show case this with a video to show interactivity. If you do so, please include a link! ### Analysis -* Stream compaction helps most after a few bounces. Print and plot the - effects of stream compaction within a single iteration (i.e. the number of - unterminated rays after each bounce) and evaluate the benefits you get from - stream compaction. -* Compare scenes which are open (like the given cornell box) and closed - (i.e. no light can escape the scene). Again, compare the performance effects - of stream compaction! Remember, stream compaction only affects rays which - terminate, so what might you expect? -* For optimizations that target specific kernels, we recommend using - stacked bar graphs to convey total execution time and improvements in - individual kernels. For example: +* Stream compaction helps most after a few bounces. Print and plot the effects of stream compaction within a single iteration (i.e. the number of unterminated rays after each bounce) and evaluate the benefits you get from stream compaction. - ![Clearly the Macchiato is optimal.](img/stacked_bar_graph.png) +* Compare scenes which are open (like the given cornell box) and closed (i.e. no light can escape the scene). Again, compare the performance effects of stream compaction! Remember, stream compaction only affects rays which terminate, so what might you expect? +* For optimizations that target specific kernels, we recommend using stacked bar graphs to convey total execution time and improvements in individual kernels. For example: + + ![Clearly the Macchiato is optimal.](img/stacked_bar_graph.png) + Timings from NSight should be very useful for generating these kinds of charts. ## Submit -If you have modified any of the `CMakeLists.txt` files at all (aside from the -list of `SOURCE_FILES`), mentions it explicity. -Beware of any build issues discussed on the Google Group. +If you have modified any of the `CMakeLists.txt` files at all (aside from the list of `SOURCE_FILES`), mentions it explicity. + +Beware of any build issues discussed on the Piazza. Open a GitHub pull request so that we can see that you have finished. + The title should be "Project 3: YOUR NAME". -The template of the comment section of your pull request is attached below, you can do some copy and paste: + +The template of the comment section of your pull request is attached below, you can do some copy and paste: * [Repo Link](https://link-to-your-repo) * (Briefly) Mentions features that you've completed. Especially those bells and whistles you want to highlight - * Feature 0 - * Feature 1 - * ... + * Feature 0 + * Feature 1 + * ... * Feedback on the project itself, if any. ## References -* [PBRT] Physically Based Rendering, Second Edition: From Theory To Implementation. Pharr, Matt and Humphreys, Greg. 2010. -* Antialiasing and Raytracing. Chris Cooksey and Paul Bourke, http://paulbourke.net/miscellaneous/aliasing/ +* [PBRTv3] [Physically Based Rendering: From Theory to Implementation (pbr-book.org)](https://www.pbr-book.org/3ed-2018/contents) +* [PBRTv4] [Physically Based Rendering: From Theory to Implementation (pbr-book.org)](https://pbr-book.org/4ed/contents) +* Antialiasing and Raytracing. Chris Cooksey and Paul Bourke, https://paulbourke.net/miscellaneous/raytracing/ * [Sampling notes](http://graphics.ucsd.edu/courses/cse168_s14/) from Steve Rotenberg and Matteo Mannino, University of California, San Diego, CSE168: Rendering Algorithms +* Path Tracer Readme Samples (non-exhaustive list): + * https://github.com/byumjin/Project3-CUDA-Path-Tracer + * https://github.com/lukedan/Project3-CUDA-Path-Tracer + * https://github.com/botforge/CUDA-Path-Tracer + * https://github.com/taylornelms15/Project3-CUDA-Path-Tracer + * https://github.com/emily-vo/cuda-pathtrace + * https://github.com/ascn/toki + * https://github.com/gracelgilbert/Project3-CUDA-Path-Tracer + * https://github.com/vasumahesh1/Project3-CUDA-Path-Tracer diff --git a/LM.2026-04-05_06-01-27z.9samp.png b/LM.2026-04-05_06-01-27z.9samp.png new file mode 100644 index 000000000..94d24f5a1 Binary files /dev/null and b/LM.2026-04-05_06-01-27z.9samp.png differ diff --git a/README.md b/README.md index 110697ce7..243f636d6 100644 --- a/README.md +++ b/README.md @@ -3,11 +3,314 @@ CUDA Path Tracer **University of Pennsylvania, CIS 565: GPU Programming and Architecture, Project 3** -* (TODO) YOUR NAME HERE -* Tested on: (TODO) Windows 22, i7-2222 @ 2.22GHz 22GB, GTX 222 222MB (Moore 2222 Lab) +* - Muqiao Lei + + [LinkedIn](https://www.linkedin.com/in/muqiao-lei-633304242/) · [GitHub](https://github.com/rmurdock41) + + - Tested on: Windows 10, 11th Gen Intel(R) Core(TM) i7-11800H @ 2.30GHz 2.30 GHz, NVIDIA GeForce RTX 3060 Laptop GPU (Personal Computer) -### (TODO: Your README) -*DO NOT* leave the README to the last minute! It is a crucial part of the -project, and we will not be able to grade you without a good README. +**A CUDA-based path tracer implementing glTF model loading, refractive materials, depth of field, and BVH acceleration. Optimized using Russian Roulette path termination and various GPU performance techniques.** + +![Cover Image](img/top.png) + +*[Lady Maria from BLoodborne], 5000 samples, rendered with BVH acceleration* + +--- + +## Visual Features + +### Refraction + +Implemented **refraction effects** based on Snell's law with Fresnel calculations using Schlick's approximation. Supports transparent materials like glass and water with light bending and internal reflections. Implemented rough refractive surfaces that can simulate effects like frosted glass. + +| Clear Glass (IOR 1.5, roughness=0) | Colored Glass | Rough Glass (frosted effect) | +| --- | --- | --- | +| ![Clear Glass](img/ior1p5.png) | ![Colored Glass](img/coloredGlass.png) | ![Rough Glass](img/fGlass.png) | + +**Implementation Details:** + +Used `glm::refract` to calculate ideal refraction direction and **Schlick's approximation** to compute Fresnel reflection coefficient. The system probabilistically chooses between reflection and refraction based on the Fresnel coefficient, correctly handling total internal reflection cases. + +For **roughness** implementation, the material.roughness parameter controls surface roughness by importance sampling around the ideal reflection or refraction direction. The sampling uses a modified Phong distribution model where higher roughness values produce stronger light scattering, creating realistic frosted effects. + +**Analysis:** + +Refractive materials cause light to undergo multiple reflections and refractions inside transparent objects, forming complex light paths. Each refraction event requires computing Fresnel coefficients and probabilistically determining reflection versus refraction. Rough refractive surfaces perturb the ideal refraction direction through importance sampling, producing realistic frosted glass effects. In scenes with multiple refractive objects, rays can bounce multiple times between transparent surfaces - for example, light entering a glass sphere, reflecting internally, refracting out, then entering another nearby glass object. + +### Specular Reflection + +Implemented perfect specular reflection materials with roughness parameter support, simulating effects from perfect mirrors to rough metallic surfaces. + +Specular Reflection + +**Implementation Details:** + +Used `glm::reflect` to calculate ideal reflection direction, with material.roughness parameter controlling surface roughness. For perfect mirrors (roughness=0), rays bounce strictly according to the law of reflection. When roughness is greater than 0, importance sampling is performed around the ideal reflection direction using a modified Phong distribution model. Sampling uses a `cosθ^k` distribution where `k = 1/(α²) - 1` and `α = roughness`. Higher roughness values produce larger scattering ranges for reflected rays, with surfaces exhibiting more diffuse characteristics. The system supports material.hasReflective parameter to control reflection strength, enabling partial reflection effects. Material color acts as the Fresnel term for reflection, affecting the color of reflected light. + +### Depth of Field + +Implemented physically-based thin lens camera model to simulate realistic depth of field effects by sampling on the aperture. + +| No DOF | with DOF | +| ---------------------------- | ------------------------------ | +| ![No DOF](img/withoutRR.png) | ![Large Aperture](img/DOF.png) | + +**Implementation Details:** + +Used concentric disk sampling to generate ray origins on the aperture plane, which maps a square to a unit disk, avoiding waste from traditional rejection sampling and providing more uniform distribution. All rays pass through the same point on the focal plane to achieve focus effects. + +The system provides two configurable parameters: apertureRadius controls blur strength, and focalDistance controls focus position. The implementation flow calculates the standard camera ray direction first, then computes the ray's intersection with the focal plane, samples an offset point on the aperture using concentric disk sampling, and finally shoots a ray from the offset point toward the focal plane intersection point. + +**Analysis:** + +Depth of field only affects the ray generation stage without impacting subsequent intersection testing and shading, resulting in minimal performance overhead. Aperture size has almost no performance impact as computation cost remains constant regardless of aperture size, only the ray origin positions differ. This overhead primarily comes from additional random number generation, focal plane intersection calculation, and ray direction renormalization, all of which are simple arithmetic operations. The performance characteristics of depth of field are independent of scene type (open or closed) because it only modifies ray origins and directions without affecting ray propagation behavior within the scene. + +Data shows that both open and closed scenes experience consistent overhead. This makes depth of field a cost-effective choice for enhancing rendering realism, significantly improving visual quality with negligible impact on frame rate. + +### Antialiasing + +Implemented stochastic sampled antialiasing by randomly jittering ray positions within each pixel to reduce aliasing artifacts. + +**Implementation Details:** + +In the `generateRayFromCamera` kernel, each ray receives a random offset within its pixel. Random numbers `jx` and `jy` in the range [0, 1) are generated using `thrust::uniform_real_distribution` and applied to the sub-pixel coordinate calculation. The random number generator is seeded using `makeSeededRandomEngine` based on iteration number and pixel index, ensuring different jitter patterns across iterations. Over multiple iterations, the random jittering samples different positions within each pixel, averaging to produce smooth edges. + +**Performance Impact:** + +Antialiasing has negligible performance impact (<1%), as it only involves two additional random number generations and simple floating-point operations per ray. These operations occur during the ray generation stage and are insignificant compared to subsequent BVH traversal and shading computations. + +--- + +## glTF Model Loading + +Implemented complete glTF 2.0 model loading and rendering using TinyGLTF library, supporting import and rendering of arbitrary triangle meshes. + +| Stanford Bunny (69,451 tris) | Lady Maria (1,013,600 tris) | +| ---------------------------- | ----------------------------- | +| ![Bunny](img/withoutRR.png) | ![Lady Maria](img/glTFLM.png) | + +**Implementation Details:** + +Implemented complete glTF 2.0 file parsing and geometry data extraction pipeline. The system reads mesh data from glTF files, extracts vertex positions and index information, and transforms triangles to world coordinate space. Each loaded mesh constructs an AABB bounding box on the CPU side for subsequent BVH acceleration structure building. Supports model translation, rotation, and scaling transformations, correctly converting model coordinates to scene space through transformation matrices. All triangle data is uniformly stored in GPU memory, with each triangle recording its three vertex positions and material ID. The system manages mesh instances in the scene as MESH-type Geom objects, recording the offset and count of triangles in the global array for subsequent intersection testing. + +**Analysis:** + +glTF model loading itself has no direct impact on runtime performance as model parsing and data upload are completed during initialization. Runtime performance primarily depends on triangle count and intersection testing efficiency. For models like Stanford Bunny with approximately 70,000 triangles and Lady Maria with over 1 million triangles, BVH acceleration structures have critical performance implications (see BVH section for detailed performance analysis). Triangle data is stored in contiguous arrays on GPU, favoring cache hits and reducing memory access latency. The advantage of glTF format lies in its standardization and widespread support, allowing convenient export from various 3D modeling software and supporting complex scene hierarchies and material definitions. + +--- + +## Performance Optimizations + +### Bounding Volume Hierarchy (BVH) + +Implemented hierarchical spatial acceleration structure using axis-aligned bounding boxes (AABB), dramatically reducing ray-triangle intersection tests. Uses Surface Area Heuristic (SAH) for CPU-side BVH construction and iterative stack-based traversal on GPU. + +| With BVH | Without BVH | +| ---------------------------------- | ---------------------------------------- | +| ![Bunny with BVH](img/withBVH.png) | ![Bunny without BVH](img/withoutBVH.png) | + +| *With Tris BVH* | Without Tris BVH | +| ---------------------------------------- | ------------------------------------------- | +| ![BVH Visualization](img/withTriBVH.png) | ![Performance Chart](img/withoutTriBVH.png) | + +**Implementation Details:** + +Constructed BVH tree recursively on CPU using Surface Area Heuristic for optimal split plane selection. During construction, first computes AABB bounding boxes and centroids for all primitives, then selects the axis with maximum centroid distribution as the split axis, using median split strategy to partition primitives into two groups. Leaf nodes contain at most 4 primitives to balance tree depth and leaf complexity. After construction, BVH nodes and primitive indices are uploaded to GPU memory. GPU traversal uses iteration rather than recursion, employing a fixed-size stack (64 levels) to store nodes awaiting visit. For each ray, starting from the root node, performs AABB intersection test first; if intersected, continues traversing child nodes or tests primitives in leaf nodes. System implements two-level BVH structure: scene-level BVH accelerates intersection tests between different objects, mesh-level BVH accelerates triangle intersection tests within individual meshes. + +**Performance Analysis:** + +| Scene | Triangle Count | Scene Type | Without BVH | With BVH | Speedup | +| -------------- | -------------- | ---------- | ----------- | -------- | ------- | +| MultiBall | - | Open | 40 fps | 55 fps | 38% | +| MultiBall | - | Closed | 10 fps | 19 fps | 90% | +| Cube | 12 | Open | 60 fps | 60 fps | - | +| Cube | 12 | Closed | 44 fps | 44 fps | - | +| Stanford Bunny | 69,451 | Open | 0.4 fps | 32 fps | 80x | +| Stanford Bunny | 69,451 | Closed | 1.7 fps | 97 fps | 57x | +| Lady Maria | 1,013,600 | Open | <0.1 fps | 15 fps | - | +| Lady Maria | 1,013,600 | Closed | <0.1 fps | 37 fps | - | + +![](img/BVHchart.png) + +**BVH Statistics:** + +| Scene | Triangle Count | Mesh BVH Nodes | Scene BVH Nodes | +| -------------- | -------------- | -------------- | --------------- | +| Multiball | - | - | 43 | +| Stanford Bunny | 69,451 | 40,597 | 3 | +| Lady Maria | 1,013,600 | 524,287 | 3 | + +*Note: Mesh BVH nodes accelerate triangle intersection tests within individual models, Scene BVH nodes accelerate intersection tests between different objects in the scene* + +**Analysis:** + +BVH acceleration structure reduces linear search complexity from O(n) to O(log n) through spatial hierarchy partitioning. For simple models like the cube with only 12 triangles, BVH traversal overhead may exceed saved intersection testing time, resulting in negligible acceleration. However, when triangle count increases to tens of thousands, BVH advantages become significantly apparent. + +For Stanford Bunny with 70,000 triangles, BVH reduces average triangles tested per ray from 69,451 to tens, achieving several to tenfold performance improvement. For Lady Maria with 1 million triangles, rendering without BVH is nearly impossible (<1 fps), while BVH provides tens to hundreds of times speedup, enabling real-time rendering. + +Comparing open and closed scenes shows that BVH acceleration effectiveness is largely independent of scene type, as BVH primarily optimizes the intersection testing stage rather than ray bouncing behavior. Closed scenes have lower baseline FPS due to more ray bounces, but BVH speedup ratios remain similar across both scene types. Two-level BVH structure enables efficient handling of scenes with multiple complex models: scene-level BVH quickly locates potentially intersected objects, mesh-level BVH rapidly finds intersected triangles within objects. Iterative traversal on GPU avoids recursion overhead and stack overflow issues, with fixed 64-level stack satisfying most scene requirements. AABB intersection testing uses slab method, computationally simple and efficient, suitable for GPU's SIMD architecture. + +### Russian Roulette Path Termination + +Probabilistically terminates paths based on their energy contribution, reducing computation while maintaining unbiased results. + +| RR minDepth=1 | RR minDepth=3 | No RR | +| ------------------------------------------------------ | ------------------------------------------------------ | ------------------------------------------------------------- | +| RR1 | RR3 | NoRR | + +**Implementation Details:** + +Implemented probability-based termination strategy using path throughput. The system provides a configurable minimum bounce depth (minDepth) parameter, preventing path termination before reaching this depth to ensure basic lighting effects. Starting from minDepth, survival probability is calculated based on path energy contribution, computed as the maximum component of the path color and clamped between 0.05 and 0.99 to avoid premature or ineffective termination. For each ray, a random number is compared with survival probability; if the random number exceeds survival probability, the path is terminated, otherwise the path color is divided by survival probability for energy compensation to maintain unbiasedness. This strategy allows high-contribution paths to continue tracing while low-contribution paths terminate early, saving computational resources. + +**Performance Analysis:** + +**Open Scene :** + +| Configuration | FPS | vs No RR | +| --------------- | ------ | -------- | +| No RR | 92 fps | - | +| RR (minDepth=1) | 92 fps | +XX% | +| RR (minDepth=3) | 91 fps | +XX% | + +**Closed Scene :** + +| Configuration | FPS | vs No RR | +| --------------- | ------ | -------- | +| No RR | 32 fps | - | +| RR (minDepth=1) | 37 fps | +XX% | +| RR (minDepth=3) | 36 fps | +XX% | + +![rrChart.png](img/rrChart.png) + +**Analysis:** + +Russian Roulette shows scene-dependent performance characteristics. In open scenes, the optimization provides negligible benefit (0% to -1%), while in closed scenes it achieves meaningful improvements (+13-16%). Open scenes show minimal or slightly negative impact from Russian Roulette. With a baseline of 92 fps, rays already escape scene boundaries quickly, naturally terminating within a few bounces. The overhead of Russian Roulette calculations (survival probability computation, random number generation, energy compensation) outweighs any computational savings from early termination. Most rays that would be terminated by RR have already exited the scene through natural means. Closed scenes demonstrate clear benefits from Russian Roulette, with 13-16% performance improvement. Rays remain trapped within the enclosed environment and continue bouncing until reaching maximum depth or absorption. Russian Roulette provides an additional termination mechanism based on energy contribution, allowing low-contribution paths to exit early rather than consuming resources for negligible visual impact. The minDepth=1 configuration achieves slightly higher gains (+16%) by allowing earlier termination, while minDepth=3 (+13%) ensures more complete light transport at the cost of marginally lower performance. The performance difference between minDepth=1 and minDepth=3 is minimal in both scene types (1-3% variation), indicating that the first few bounces contribute significantly to the final image and are rarely terminated even with aggressive RR settings. Visual quality remains indistinguishable across all configurations at 5000 samples, validating Russian Roulette's unbiased nature through energy compensation. + +**Conclusion:** + + Russian Roulette is most effective in closed scenes where rays have long path lengths. For open scenes with naturally short paths, the optimization overhead may exceed benefits. The technique maintains image quality through proper energy compensation while providing meaningful performance gains in appropriate scenarios. + +### Material Sorting + +Implemented ray sorting by material type before shading to group rays interacting with the same material in contiguous memory, improving GPU warp coherence and reducing thread divergence. + +**Implementation Details:** + +The material sorting system uses a three-stage pipeline for each bounce. First, each ray is assigned a material key based on its intersection, with missed rays assigned `INT_MAX` to sort them to the end of the array. Then `thrust::stable_sort_by_key` sorts material keys while maintaining ray indices. Finally, `thrust::gather` reorders both `PathSegment` and `ShadeableIntersection` arrays according to the sorted indices. The system supports runtime toggling via `SetMaterialSortEnabled()`. + +**Performance Analysis:** + +| Scene Type | Material Count | Without Sorting | With Sorting | Performance Change | +| -------------------- | ------------------------------- | --------------- | ------------ | ------------------ | +| Cornell Box (Closed) | 3 (diffuse, specular, emissive) | 44 fps | 29 fps | -34% | +| Cornell Box + Bunny | 3 (diffuse, bunny, emissive) | 43 fps | 32 fps | -25% | +| Simple Open Scene | 20+ materials | 51 fps | 42 fps | -18% | + +![materialSort.png](img/materialSort.png) + +**Analysis:** + +Material sorting performs as a negative optimization across all test scenes, with performance degradation ranging from 18% to 34%. Even in the complex open scene with over 20 material types, sorting still causes an 18% performance loss. + +The Cornell Box closed scene shows the largest performance degradation (-34%). With only 3 material types, material distribution is already relatively concentrated, resulting in low baseline warp divergence. The overhead from sorting operations each bounce (`buildMaterialKeys`, `thrust::stable_sort_by_key`, two `thrust::gather` calls) exceeds any benefits from reduced divergence. The higher baseline framerate (44 fps) means shorter frame time, making sorting's fixed overhead represent a larger fraction of total time. + +The Bunny scene shows 25% performance degradation. With the same 3 material types, but 69,451 triangles causing BVH traversal to dominate execution time, material shading represents only a small fraction of total time. Even complete elimination of material shading divergence has limited impact on overall performance. Sorting overhead cannot be offset by shading optimizations. + +The simple open scene contains 20+ different materials (multiple refractive types, specular variations, roughness changes), theoretically the most favorable case for material sorting. However, it still shows 18% performance degradation. Despite high material diversity, the O(n log n) complexity and global memory access overhead of sorting still exceed the benefits from reduced warp divergence. This scene has the highest baseline framerate (51 fps), indicating lighter computational burden, making sorting overhead's relative impact more apparent. + +**Conclusion:** + +Material sorting is a negative optimization across all test scenes. Even with over 20 material types, sorting overhead exceeds its benefits. This indicates that in the current implementation, the fixed cost of sorting operations (memory access, sorting algorithm itself) is too high to be offset by warp coherence improvements. This optimization is disabled by default across all scenes. + +### Stream Compaction + +Implemented work-efficient stream compaction using the scan-based algorithm from Project 2 to remove terminated paths and improve GPU utilization. + +**Implementation Details:** + +Stream compaction uses a three-kernel pipeline to remove dead rays. `kernFlagAlive` marks each path as alive (1) or terminated (0) based on `remainingBounces > 0`, with terminated paths having their colors set to zero. `scanDevice` performs a parallel prefix sum on the flag array to compute output indices for alive rays, using the work-efficient scan implementation from Project 2. `kernScatterPaths` scatters alive rays to the computed indices, compacting them into contiguous memory. Both `PathSegment` and `ShadeableIntersection` arrays are compacted to maintain correspondence. Before compaction, the `accumulateTerminated` kernel atomically adds terminated ray colors to the output image, ensuring no light contributions are lost. + +**Performance Analysis:** + +| Scene Type | Without Compaction | With Compaction | Speedup | +| -------------------- | ------------------ | --------------- | ------- | +| Cornell Box (Closed) | 44 fps | 52 fps | +18% | +| Cornell Box + Bunny | 30 fps | 32 fps | +7% | +| Simple Open Scene | 13 fps | 48 fps | +269% | + +![streamCompact.png](img/streamCompact.png) + +**Analysis:** + +Stream compaction's performance improvement varies significantly across scenes, ranging from 7% to 269%, reflecting fundamental differences in scene geometry and ray termination patterns. + +The simple open scene shows the largest performance improvement (+269%). This scene contains nested refractive spheres and multiple material types but no enclosing walls, causing many rays to escape scene boundaries after early bounces. Without compaction, terminated rays still occupy GPU resources executing useless kernel calls. Compaction begins reducing ray count from early bounces, significantly decreasing computation in subsequent bounces. The low baseline framerate (13 fps) indicates severe computational waste without compaction. + +The Cornell Box closed scene achieves moderate improvement (+18%). In the enclosed environment, rays remain trapped and can only terminate by reaching maximum depth, hitting light sources, or through Russian Roulette. Rays terminate gradually over multiple bounces, with compaction benefits accumulating in later bounces. The higher baseline framerate (44 fps) indicates the scene itself has lighter computational burden, limiting compaction's absolute gains. + +The Bunny scene shows minimal improvement (+7%). The Stanford Bunny contains 69,451 triangles, with BVH traversal and triangle intersection tests dominating execution time. While stream compaction reduces ray count, each remaining ray still requires expensive BVH traversal. Compaction primarily optimizes material shading and memory access, which represent a smaller fraction of total execution time. The lower baseline framerate (30 fps) reflects that geometric complexity, not ray management, is the primary bottleneck. + +**Conclusion:** + +Stream compaction provides positive gains across all test scenes but is highly dependent on scene characteristics. Open scenes achieve extreme benefits from rapid ray escape, closed simple scenes gain steady improvements, and geometrically complex scenes show limited gains due to other bottlenecks. This optimization is enabled by default across all scenes. + +#### Ray Survival Analysis + +To evaluate stream compaction's effectiveness, we measured the number of active rays after each bounce in a single iteration. + +| Bounce | Open Scene Active Rays | Open Scene % Alive | Closed Scene Active Rays | Closed Scene % Alive | +| ------ | ---------------------- | ------------------ | ------------------------ | -------------------- | +| 1 | 344,766 | 53.9% | 522,846 | 81.7% | +| 2 | 163,001 | 25.5% | 363,060 | 56.7% | +| 3 | 94,276 | 14.7% | 285,269 | 44.6% | +| 4 | 52,515 | 8.2% | 232,608 | 36.3% | +| 5 | 23,149 | 3.6% | 190,829 | 29.8% | +| 6 | 11,514 | 1.8% | 156,449 | 24.4% | +| 7 | 6,577 | 1.0% | 129,115 | 20.2% | +| 8 | 0 | 0.0% | 0 | 0.0% | + +Ray Survival Comparison + +Ray Survival Comparison + +**Analysis:** + +In open scenes, rays rapidly escape scene boundaries. Nearly half of all rays terminate after the first bounce, with over 90% eliminated by bounce 4. Stream compaction dramatically reduces the number of rays processed in subsequent kernels from early bounces onward. + +In closed scenes, rays remain trapped within the enclosure and continue bouncing. Over 80% of rays remain active after the first bounce, with one-third still alive at bounce 4. Rays repeatedly interact with surfaces in the confined space, causing stream compaction benefits to accumulate gradually. + +This difference in ray termination patterns directly explains the performance data. Open scenes achieve massive acceleration (+269%) through aggressive early compaction, while closed scenes gain moderate improvement (+18%) due to slower ray termination. + +Stream compaction eliminates a critical GPU inefficiency: terminated rays still occupy memory and trigger kernel execution. At bounce 4 in the open scene, processing 640,000 rays when only 8% are actually active represents massive computational waste. Stream compaction removes these dead rays, focusing GPU resources on meaningful computation. + +--- + +## Third-Party Code and Assets + +This project uses the following third-party libraries and assets: + +### Libraries + +- **[TinyGLTF](https://github.com/syoyo/tinygltf)** - glTF 2.0 model loading library for parsing and loading glTF mesh files + +- **[GLM](https://github.com/g-truc/glm)** - OpenGL Mathematics library for vector and matrix operations + +### 3D Models + +- **[Bloodborne - Lady Maria of the Astral Clocktower](https://sketchfab.com/3d-models/bloodborne-lady-maria-of-the-astral-clocktower-ad406857d8c64115aba721ee98b666bb)** by [Redeemer](https://sketchfab.com/redeemer_3d) - Used for high-polygon mesh rendering demonstration and BVH performance testing + +- **[Stanford Bunny](http://graphics.stanford.edu/data/3Dscanrep/)** - Stanford Computer Graphics Laboratory, used for BVH performance testing + +### Base Code + +This project builds upon the CIS 565 CUDA Path Tracer base code provided by the University of Pennsylvania, including OpenGL/CUDA interop framework, scene loading infrastructure, and basic ray-triangle intersection functions. + +All other implementations (BVH construction, material shading, Russian Roulette, stream compaction, etc.) are original work completed for this project. + +--- + +## CMakeLists.txt Modifications + +The CMakeLists.txt was modified to support glTF model loading and enable stream compaction functionality. Key changes include: added `find_package(CUDAToolkit REQUIRED)` to explicitly locate the CUDA toolkit; created a `tinygltf_impl` static library for glTF parsing; uncommented `add_subdirectory(stream_compaction)` to enable Project 2's stream compaction implementation; added `mesh_loader.h` and `mesh_loader.cpp` files to the executable; included the TinyGLTF directory in the main program's include paths; linked both `stream_compaction` and `tinygltf_impl` libraries; and added CUDA include directories for Windows platforms to ensure header file accessibility. These modifications enable the project to load and render complex mesh models in glTF format while utilizing efficient stream compaction optimization. diff --git a/cmake/CMakeParseArguments.cmake b/cmake/CMakeParseArguments.cmake deleted file mode 100644 index 8553f38f5..000000000 --- a/cmake/CMakeParseArguments.cmake +++ /dev/null @@ -1,161 +0,0 @@ -#.rst: -# CMakeParseArguments -# ------------------- -# -# -# -# CMAKE_PARSE_ARGUMENTS( -# args...) -# -# CMAKE_PARSE_ARGUMENTS() is intended to be used in macros or functions -# for parsing the arguments given to that macro or function. It -# processes the arguments and defines a set of variables which hold the -# values of the respective options. -# -# The argument contains all options for the respective macro, -# i.e. keywords which can be used when calling the macro without any -# value following, like e.g. the OPTIONAL keyword of the install() -# command. -# -# The argument contains all keywords for this macro -# which are followed by one value, like e.g. DESTINATION keyword of the -# install() command. -# -# The argument contains all keywords for this -# macro which can be followed by more than one value, like e.g. the -# TARGETS or FILES keywords of the install() command. -# -# When done, CMAKE_PARSE_ARGUMENTS() will have defined for each of the -# keywords listed in , and -# a variable composed of the given -# followed by "_" and the name of the respective keyword. These -# variables will then hold the respective value from the argument list. -# For the keywords this will be TRUE or FALSE. -# -# All remaining arguments are collected in a variable -# _UNPARSED_ARGUMENTS, this can be checked afterwards to see -# whether your macro was called with unrecognized parameters. -# -# As an example here a my_install() macro, which takes similar arguments -# as the real install() command: -# -# :: -# -# function(MY_INSTALL) -# set(options OPTIONAL FAST) -# set(oneValueArgs DESTINATION RENAME) -# set(multiValueArgs TARGETS CONFIGURATIONS) -# cmake_parse_arguments(MY_INSTALL "${options}" "${oneValueArgs}" -# "${multiValueArgs}" ${ARGN} ) -# ... -# -# -# -# Assume my_install() has been called like this: -# -# :: -# -# my_install(TARGETS foo bar DESTINATION bin OPTIONAL blub) -# -# -# -# After the cmake_parse_arguments() call the macro will have set the -# following variables: -# -# :: -# -# MY_INSTALL_OPTIONAL = TRUE -# MY_INSTALL_FAST = FALSE (this option was not used when calling my_install() -# MY_INSTALL_DESTINATION = "bin" -# MY_INSTALL_RENAME = "" (was not used) -# MY_INSTALL_TARGETS = "foo;bar" -# MY_INSTALL_CONFIGURATIONS = "" (was not used) -# MY_INSTALL_UNPARSED_ARGUMENTS = "blub" (no value expected after "OPTIONAL" -# -# -# -# You can then continue and process these variables. -# -# Keywords terminate lists of values, e.g. if directly after a -# one_value_keyword another recognized keyword follows, this is -# interpreted as the beginning of the new option. E.g. -# my_install(TARGETS foo DESTINATION OPTIONAL) would result in -# MY_INSTALL_DESTINATION set to "OPTIONAL", but MY_INSTALL_DESTINATION -# would be empty and MY_INSTALL_OPTIONAL would be set to TRUE therefor. - -#============================================================================= -# Copyright 2010 Alexander Neundorf -# -# Distributed under the OSI-approved BSD License (the "License"); -# see accompanying file Copyright.txt for details. -# -# This software is distributed WITHOUT ANY WARRANTY; without even the -# implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. -# See the License for more information. -#============================================================================= -# (To distribute this file outside of CMake, substitute the full -# License text for the above reference.) - - -if(__CMAKE_PARSE_ARGUMENTS_INCLUDED) - return() -endif() -set(__CMAKE_PARSE_ARGUMENTS_INCLUDED TRUE) - - -function(CMAKE_PARSE_ARGUMENTS prefix _optionNames _singleArgNames _multiArgNames) - # first set all result variables to empty/FALSE - foreach(arg_name ${_singleArgNames} ${_multiArgNames}) - set(${prefix}_${arg_name}) - endforeach() - - foreach(option ${_optionNames}) - set(${prefix}_${option} FALSE) - endforeach() - - set(${prefix}_UNPARSED_ARGUMENTS) - - set(insideValues FALSE) - set(currentArgName) - - # now iterate over all arguments and fill the result variables - foreach(currentArg ${ARGN}) - list(FIND _optionNames "${currentArg}" optionIndex) # ... then this marks the end of the arguments belonging to this keyword - list(FIND _singleArgNames "${currentArg}" singleArgIndex) # ... then this marks the end of the arguments belonging to this keyword - list(FIND _multiArgNames "${currentArg}" multiArgIndex) # ... then this marks the end of the arguments belonging to this keyword - - if(${optionIndex} EQUAL -1 AND ${singleArgIndex} EQUAL -1 AND ${multiArgIndex} EQUAL -1) - if(insideValues) - if("${insideValues}" STREQUAL "SINGLE") - set(${prefix}_${currentArgName} ${currentArg}) - set(insideValues FALSE) - elseif("${insideValues}" STREQUAL "MULTI") - list(APPEND ${prefix}_${currentArgName} ${currentArg}) - endif() - else() - list(APPEND ${prefix}_UNPARSED_ARGUMENTS ${currentArg}) - endif() - else() - if(NOT ${optionIndex} EQUAL -1) - set(${prefix}_${currentArg} TRUE) - set(insideValues FALSE) - elseif(NOT ${singleArgIndex} EQUAL -1) - set(currentArgName ${currentArg}) - set(${prefix}_${currentArgName}) - set(insideValues "SINGLE") - elseif(NOT ${multiArgIndex} EQUAL -1) - set(currentArgName ${currentArg}) - set(${prefix}_${currentArgName}) - set(insideValues "MULTI") - endif() - endif() - - endforeach() - - # propagate the result variables to the caller: - foreach(arg_name ${_singleArgNames} ${_multiArgNames} ${_optionNames}) - set(${prefix}_${arg_name} ${${prefix}_${arg_name}} PARENT_SCOPE) - endforeach() - set(${prefix}_UNPARSED_ARGUMENTS ${${prefix}_UNPARSED_ARGUMENTS} PARENT_SCOPE) - -endfunction() diff --git a/cmake/FindCUDA.cmake b/cmake/FindCUDA.cmake deleted file mode 100644 index f4b078310..000000000 --- a/cmake/FindCUDA.cmake +++ /dev/null @@ -1,1806 +0,0 @@ -#.rst: -# FindCUDA -# -------- -# -# Tools for building CUDA C files: libraries and build dependencies. -# -# This script locates the NVIDIA CUDA C tools. It should work on linux, -# windows, and mac and should be reasonably up to date with CUDA C -# releases. -# -# This script makes use of the standard find_package arguments of -# , REQUIRED and QUIET. CUDA_FOUND will report if an -# acceptable version of CUDA was found. -# -# The script will prompt the user to specify CUDA_TOOLKIT_ROOT_DIR if -# the prefix cannot be determined by the location of nvcc in the system -# path and REQUIRED is specified to find_package(). To use a different -# installed version of the toolkit set the environment variable -# CUDA_BIN_PATH before running cmake (e.g. -# CUDA_BIN_PATH=/usr/local/cuda1.0 instead of the default -# /usr/local/cuda) or set CUDA_TOOLKIT_ROOT_DIR after configuring. If -# you change the value of CUDA_TOOLKIT_ROOT_DIR, various components that -# depend on the path will be relocated. -# -# It might be necessary to set CUDA_TOOLKIT_ROOT_DIR manually on certain -# platforms, or to use a cuda runtime not installed in the default -# location. In newer versions of the toolkit the cuda library is -# included with the graphics driver- be sure that the driver version -# matches what is needed by the cuda runtime version. -# -# The following variables affect the behavior of the macros in the -# script (in alphebetical order). Note that any of these flags can be -# changed multiple times in the same directory before calling -# CUDA_ADD_EXECUTABLE, CUDA_ADD_LIBRARY, CUDA_COMPILE, CUDA_COMPILE_PTX, -# CUDA_COMPILE_FATBIN, CUDA_COMPILE_CUBIN or CUDA_WRAP_SRCS:: -# -# CUDA_64_BIT_DEVICE_CODE (Default matches host bit size) -# -- Set to ON to compile for 64 bit device code, OFF for 32 bit device code. -# Note that making this different from the host code when generating object -# or C files from CUDA code just won't work, because size_t gets defined by -# nvcc in the generated source. If you compile to PTX and then load the -# file yourself, you can mix bit sizes between device and host. -# -# CUDA_ATTACH_VS_BUILD_RULE_TO_CUDA_FILE (Default ON) -# -- Set to ON if you want the custom build rule to be attached to the source -# file in Visual Studio. Turn OFF if you add the same cuda file to multiple -# targets. -# -# This allows the user to build the target from the CUDA file; however, bad -# things can happen if the CUDA source file is added to multiple targets. -# When performing parallel builds it is possible for the custom build -# command to be run more than once and in parallel causing cryptic build -# errors. VS runs the rules for every source file in the target, and a -# source can have only one rule no matter how many projects it is added to. -# When the rule is run from multiple targets race conditions can occur on -# the generated file. Eventually everything will get built, but if the user -# is unaware of this behavior, there may be confusion. It would be nice if -# this script could detect the reuse of source files across multiple targets -# and turn the option off for the user, but no good solution could be found. -# -# CUDA_BUILD_CUBIN (Default OFF) -# -- Set to ON to enable and extra compilation pass with the -cubin option in -# Device mode. The output is parsed and register, shared memory usage is -# printed during build. -# -# CUDA_BUILD_EMULATION (Default OFF for device mode) -# -- Set to ON for Emulation mode. -D_DEVICEEMU is defined for CUDA C files -# when CUDA_BUILD_EMULATION is TRUE. -# -# CUDA_GENERATED_OUTPUT_DIR (Default CMAKE_CURRENT_BINARY_DIR) -# -- Set to the path you wish to have the generated files placed. If it is -# blank output files will be placed in CMAKE_CURRENT_BINARY_DIR. -# Intermediate files will always be placed in -# CMAKE_CURRENT_BINARY_DIR/CMakeFiles. -# -# CUDA_HOST_COMPILATION_CPP (Default ON) -# -- Set to OFF for C compilation of host code. -# -# CUDA_HOST_COMPILER (Default CMAKE_C_COMPILER, $(VCInstallDir)/bin for VS) -# -- Set the host compiler to be used by nvcc. Ignored if -ccbin or -# --compiler-bindir is already present in the CUDA_NVCC_FLAGS or -# CUDA_NVCC_FLAGS_ variables. For Visual Studio targets -# $(VCInstallDir)/bin is a special value that expands out to the path when -# the command is run from withing VS. -# -# CUDA_NVCC_FLAGS -# CUDA_NVCC_FLAGS_ -# -- Additional NVCC command line arguments. NOTE: multiple arguments must be -# semi-colon delimited (e.g. --compiler-options;-Wall) -# -# CUDA_PROPAGATE_HOST_FLAGS (Default ON) -# -- Set to ON to propagate CMAKE_{C,CXX}_FLAGS and their configuration -# dependent counterparts (e.g. CMAKE_C_FLAGS_DEBUG) automatically to the -# host compiler through nvcc's -Xcompiler flag. This helps make the -# generated host code match the rest of the system better. Sometimes -# certain flags give nvcc problems, and this will help you turn the flag -# propagation off. This does not affect the flags supplied directly to nvcc -# via CUDA_NVCC_FLAGS or through the OPTION flags specified through -# CUDA_ADD_LIBRARY, CUDA_ADD_EXECUTABLE, or CUDA_WRAP_SRCS. Flags used for -# shared library compilation are not affected by this flag. -# -# CUDA_SEPARABLE_COMPILATION (Default OFF) -# -- If set this will enable separable compilation for all CUDA runtime object -# files. If used outside of CUDA_ADD_EXECUTABLE and CUDA_ADD_LIBRARY -# (e.g. calling CUDA_WRAP_SRCS directly), -# CUDA_COMPUTE_SEPARABLE_COMPILATION_OBJECT_FILE_NAME and -# CUDA_LINK_SEPARABLE_COMPILATION_OBJECTS should be called. -# -# CUDA_SOURCE_PROPERTY_FORMAT -# -- If this source file property is set, it can override the format specified -# to CUDA_WRAP_SRCS (OBJ, PTX, CUBIN, or FATBIN). If an input source file -# is not a .cu file, setting this file will cause it to be treated as a .cu -# file. See documentation for set_source_files_properties on how to set -# this property. -# -# CUDA_USE_STATIC_CUDA_RUNTIME (Default ON) -# -- When enabled the static version of the CUDA runtime library will be used -# in CUDA_LIBRARIES. If the version of CUDA configured doesn't support -# this option, then it will be silently disabled. -# -# CUDA_VERBOSE_BUILD (Default OFF) -# -- Set to ON to see all the commands used when building the CUDA file. When -# using a Makefile generator the value defaults to VERBOSE (run make -# VERBOSE=1 to see output), although setting CUDA_VERBOSE_BUILD to ON will -# always print the output. -# -# The script creates the following macros (in alphebetical order):: -# -# CUDA_ADD_CUFFT_TO_TARGET( cuda_target ) -# -- Adds the cufft library to the target (can be any target). Handles whether -# you are in emulation mode or not. -# -# CUDA_ADD_CUBLAS_TO_TARGET( cuda_target ) -# -- Adds the cublas library to the target (can be any target). Handles -# whether you are in emulation mode or not. -# -# CUDA_ADD_EXECUTABLE( cuda_target file0 file1 ... -# [WIN32] [MACOSX_BUNDLE] [EXCLUDE_FROM_ALL] [OPTIONS ...] ) -# -- Creates an executable "cuda_target" which is made up of the files -# specified. All of the non CUDA C files are compiled using the standard -# build rules specified by CMAKE and the cuda files are compiled to object -# files using nvcc and the host compiler. In addition CUDA_INCLUDE_DIRS is -# added automatically to include_directories(). Some standard CMake target -# calls can be used on the target after calling this macro -# (e.g. set_target_properties and target_link_libraries), but setting -# properties that adjust compilation flags will not affect code compiled by -# nvcc. Such flags should be modified before calling CUDA_ADD_EXECUTABLE, -# CUDA_ADD_LIBRARY or CUDA_WRAP_SRCS. -# -# CUDA_ADD_LIBRARY( cuda_target file0 file1 ... -# [STATIC | SHARED | MODULE] [EXCLUDE_FROM_ALL] [OPTIONS ...] ) -# -- Same as CUDA_ADD_EXECUTABLE except that a library is created. -# -# CUDA_BUILD_CLEAN_TARGET() -# -- Creates a convience target that deletes all the dependency files -# generated. You should make clean after running this target to ensure the -# dependency files get regenerated. -# -# CUDA_COMPILE( generated_files file0 file1 ... [STATIC | SHARED | MODULE] -# [OPTIONS ...] ) -# -- Returns a list of generated files from the input source files to be used -# with ADD_LIBRARY or ADD_EXECUTABLE. -# -# CUDA_COMPILE_PTX( generated_files file0 file1 ... [OPTIONS ...] ) -# -- Returns a list of PTX files generated from the input source files. -# -# CUDA_COMPILE_FATBIN( generated_files file0 file1 ... [OPTIONS ...] ) -# -- Returns a list of FATBIN files generated from the input source files. -# -# CUDA_COMPILE_CUBIN( generated_files file0 file1 ... [OPTIONS ...] ) -# -- Returns a list of CUBIN files generated from the input source files. -# -# CUDA_COMPUTE_SEPARABLE_COMPILATION_OBJECT_FILE_NAME( output_file_var -# cuda_target -# object_files ) -# -- Compute the name of the intermediate link file used for separable -# compilation. This file name is typically passed into -# CUDA_LINK_SEPARABLE_COMPILATION_OBJECTS. output_file_var is produced -# based on cuda_target the list of objects files that need separable -# compilation as specified by object_files. If the object_files list is -# empty, then output_file_var will be empty. This function is called -# automatically for CUDA_ADD_LIBRARY and CUDA_ADD_EXECUTABLE. Note that -# this is a function and not a macro. -# -# CUDA_INCLUDE_DIRECTORIES( path0 path1 ... ) -# -- Sets the directories that should be passed to nvcc -# (e.g. nvcc -Ipath0 -Ipath1 ... ). These paths usually contain other .cu -# files. -# -# -# -# CUDA_LINK_SEPARABLE_COMPILATION_OBJECTS( output_file_var cuda_target -# nvcc_flags object_files) -# -# -- Generates the link object required by separable compilation from the given -# object files. This is called automatically for CUDA_ADD_EXECUTABLE and -# CUDA_ADD_LIBRARY, but can be called manually when using CUDA_WRAP_SRCS -# directly. When called from CUDA_ADD_LIBRARY or CUDA_ADD_EXECUTABLE the -# nvcc_flags passed in are the same as the flags passed in via the OPTIONS -# argument. The only nvcc flag added automatically is the bitness flag as -# specified by CUDA_64_BIT_DEVICE_CODE. Note that this is a function -# instead of a macro. -# -# CUDA_WRAP_SRCS ( cuda_target format generated_files file0 file1 ... -# [STATIC | SHARED | MODULE] [OPTIONS ...] ) -# -- This is where all the magic happens. CUDA_ADD_EXECUTABLE, -# CUDA_ADD_LIBRARY, CUDA_COMPILE, and CUDA_COMPILE_PTX all call this -# function under the hood. -# -# Given the list of files (file0 file1 ... fileN) this macro generates -# custom commands that generate either PTX or linkable objects (use "PTX" or -# "OBJ" for the format argument to switch). Files that don't end with .cu -# or have the HEADER_FILE_ONLY property are ignored. -# -# The arguments passed in after OPTIONS are extra command line options to -# give to nvcc. You can also specify per configuration options by -# specifying the name of the configuration followed by the options. General -# options must preceed configuration specific options. Not all -# configurations need to be specified, only the ones provided will be used. -# -# OPTIONS -DFLAG=2 "-DFLAG_OTHER=space in flag" -# DEBUG -g -# RELEASE --use_fast_math -# RELWITHDEBINFO --use_fast_math;-g -# MINSIZEREL --use_fast_math -# -# For certain configurations (namely VS generating object files with -# CUDA_ATTACH_VS_BUILD_RULE_TO_CUDA_FILE set to ON), no generated file will -# be produced for the given cuda file. This is because when you add the -# cuda file to Visual Studio it knows that this file produces an object file -# and will link in the resulting object file automatically. -# -# This script will also generate a separate cmake script that is used at -# build time to invoke nvcc. This is for several reasons. -# -# 1. nvcc can return negative numbers as return values which confuses -# Visual Studio into thinking that the command succeeded. The script now -# checks the error codes and produces errors when there was a problem. -# -# 2. nvcc has been known to not delete incomplete results when it -# encounters problems. This confuses build systems into thinking the -# target was generated when in fact an unusable file exists. The script -# now deletes the output files if there was an error. -# -# 3. By putting all the options that affect the build into a file and then -# make the build rule dependent on the file, the output files will be -# regenerated when the options change. -# -# This script also looks at optional arguments STATIC, SHARED, or MODULE to -# determine when to target the object compilation for a shared library. -# BUILD_SHARED_LIBS is ignored in CUDA_WRAP_SRCS, but it is respected in -# CUDA_ADD_LIBRARY. On some systems special flags are added for building -# objects intended for shared libraries. A preprocessor macro, -# _EXPORTS is defined when a shared library compilation is -# detected. -# -# Flags passed into add_definitions with -D or /D are passed along to nvcc. -# -# -# -# The script defines the following variables:: -# -# CUDA_VERSION_MAJOR -- The major version of cuda as reported by nvcc. -# CUDA_VERSION_MINOR -- The minor version. -# CUDA_VERSION -# CUDA_VERSION_STRING -- CUDA_VERSION_MAJOR.CUDA_VERSION_MINOR -# -# CUDA_TOOLKIT_ROOT_DIR -- Path to the CUDA Toolkit (defined if not set). -# CUDA_SDK_ROOT_DIR -- Path to the CUDA SDK. Use this to find files in the -# SDK. This script will not directly support finding -# specific libraries or headers, as that isn't -# supported by NVIDIA. If you want to change -# libraries when the path changes see the -# FindCUDA.cmake script for an example of how to clear -# these variables. There are also examples of how to -# use the CUDA_SDK_ROOT_DIR to locate headers or -# libraries, if you so choose (at your own risk). -# CUDA_INCLUDE_DIRS -- Include directory for cuda headers. Added automatically -# for CUDA_ADD_EXECUTABLE and CUDA_ADD_LIBRARY. -# CUDA_LIBRARIES -- Cuda RT library. -# CUDA_CUFFT_LIBRARIES -- Device or emulation library for the Cuda FFT -# implementation (alternative to: -# CUDA_ADD_CUFFT_TO_TARGET macro) -# CUDA_CUBLAS_LIBRARIES -- Device or emulation library for the Cuda BLAS -# implementation (alterative to: -# CUDA_ADD_CUBLAS_TO_TARGET macro). -# CUDA_cudart_static_LIBRARY -- Statically linkable cuda runtime library. -# Only available for CUDA version 5.5+ -# CUDA_cupti_LIBRARY -- CUDA Profiling Tools Interface library. -# Only available for CUDA version 4.0+. -# CUDA_curand_LIBRARY -- CUDA Random Number Generation library. -# Only available for CUDA version 3.2+. -# CUDA_cusolver_LIBRARY -- CUDA Direct Solver library. -# Only available for CUDA version 7.0+. -# CUDA_cusparse_LIBRARY -- CUDA Sparse Matrix library. -# Only available for CUDA version 3.2+. -# CUDA_npp_LIBRARY -- NVIDIA Performance Primitives lib. -# Only available for CUDA version 4.0+. -# CUDA_nppc_LIBRARY -- NVIDIA Performance Primitives lib (core). -# Only available for CUDA version 5.5+. -# CUDA_nppi_LIBRARY -- NVIDIA Performance Primitives lib (image processing). -# Only available for CUDA version 5.5+. -# CUDA_npps_LIBRARY -- NVIDIA Performance Primitives lib (signal processing). -# Only available for CUDA version 5.5+. -# CUDA_nvcuvenc_LIBRARY -- CUDA Video Encoder library. -# Only available for CUDA version 3.2+. -# Windows only. -# CUDA_nvcuvid_LIBRARY -- CUDA Video Decoder library. -# Only available for CUDA version 3.2+. -# Windows only. -# - -# James Bigler, NVIDIA Corp (nvidia.com - jbigler) -# Abe Stephens, SCI Institute -- http://www.sci.utah.edu/~abe/FindCuda.html -# -# Copyright (c) 2008 - 2009 NVIDIA Corporation. All rights reserved. -# -# Copyright (c) 2007-2009 -# Scientific Computing and Imaging Institute, University of Utah -# -# This code is licensed under the MIT License. See the FindCUDA.cmake script -# for the text of the license. - -# The MIT License -# -# License for the specific language governing rights and limitations under -# Permission is hereby granted, free of charge, to any person obtaining a -# copy of this software and associated documentation files (the "Software"), -# to deal in the Software without restriction, including without limitation -# the rights to use, copy, modify, merge, publish, distribute, sublicense, -# and/or sell copies of the Software, and to permit persons to whom the -# Software is furnished to do so, subject to the following conditions: -# -# The above copyright notice and this permission notice shall be included -# in all copies or substantial portions of the Software. -# -# THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS -# OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -# FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL -# THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -# LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING -# FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER -# DEALINGS IN THE SOFTWARE. -# -############################################################################### - -# FindCUDA.cmake - -# This macro helps us find the location of helper files we will need the full path to -macro(CUDA_FIND_HELPER_FILE _name _extension) - set(_full_name "${_name}.${_extension}") - # CMAKE_CURRENT_LIST_FILE contains the full path to the file currently being - # processed. Using this variable, we can pull out the current path, and - # provide a way to get access to the other files we need local to here. - get_filename_component(CMAKE_CURRENT_LIST_DIR "${CMAKE_CURRENT_LIST_FILE}" PATH) - set(CUDA_${_name} "${CMAKE_CURRENT_LIST_DIR}/FindCUDA/${_full_name}") - if(NOT EXISTS "${CUDA_${_name}}") - set(error_message "${_full_name} not found in ${CMAKE_CURRENT_LIST_DIR}/FindCUDA") - if(CUDA_FIND_REQUIRED) - message(FATAL_ERROR "${error_message}") - else() - if(NOT CUDA_FIND_QUIETLY) - message(STATUS "${error_message}") - endif() - endif() - endif() - # Set this variable as internal, so the user isn't bugged with it. - set(CUDA_${_name} ${CUDA_${_name}} CACHE INTERNAL "Location of ${_full_name}" FORCE) -endmacro() - -##################################################################### -## CUDA_INCLUDE_NVCC_DEPENDENCIES -## - -# So we want to try and include the dependency file if it exists. If -# it doesn't exist then we need to create an empty one, so we can -# include it. - -# If it does exist, then we need to check to see if all the files it -# depends on exist. If they don't then we should clear the dependency -# file and regenerate it later. This covers the case where a header -# file has disappeared or moved. - -macro(CUDA_INCLUDE_NVCC_DEPENDENCIES dependency_file) - set(CUDA_NVCC_DEPEND) - set(CUDA_NVCC_DEPEND_REGENERATE FALSE) - - - # Include the dependency file. Create it first if it doesn't exist . The - # INCLUDE puts a dependency that will force CMake to rerun and bring in the - # new info when it changes. DO NOT REMOVE THIS (as I did and spent a few - # hours figuring out why it didn't work. - if(NOT EXISTS ${dependency_file}) - file(WRITE ${dependency_file} "#FindCUDA.cmake generated file. Do not edit.\n") - endif() - # Always include this file to force CMake to run again next - # invocation and rebuild the dependencies. - #message("including dependency_file = ${dependency_file}") - include(${dependency_file}) - - # Now we need to verify the existence of all the included files - # here. If they aren't there we need to just blank this variable and - # make the file regenerate again. -# if(DEFINED CUDA_NVCC_DEPEND) -# message("CUDA_NVCC_DEPEND set") -# else() -# message("CUDA_NVCC_DEPEND NOT set") -# endif() - if(CUDA_NVCC_DEPEND) - #message("CUDA_NVCC_DEPEND found") - foreach(f ${CUDA_NVCC_DEPEND}) - # message("searching for ${f}") - if(NOT EXISTS ${f}) - #message("file ${f} not found") - set(CUDA_NVCC_DEPEND_REGENERATE TRUE) - endif() - endforeach() - else() - #message("CUDA_NVCC_DEPEND false") - # No dependencies, so regenerate the file. - set(CUDA_NVCC_DEPEND_REGENERATE TRUE) - endif() - - #message("CUDA_NVCC_DEPEND_REGENERATE = ${CUDA_NVCC_DEPEND_REGENERATE}") - # No incoming dependencies, so we need to generate them. Make the - # output depend on the dependency file itself, which should cause the - # rule to re-run. - if(CUDA_NVCC_DEPEND_REGENERATE) - set(CUDA_NVCC_DEPEND ${dependency_file}) - #message("Generating an empty dependency_file: ${dependency_file}") - file(WRITE ${dependency_file} "#FindCUDA.cmake generated file. Do not edit.\n") - endif() - -endmacro() - -############################################################################### -############################################################################### -# Setup variables' defaults -############################################################################### -############################################################################### - -# Allow the user to specify if the device code is supposed to be 32 or 64 bit. -if(CMAKE_SIZEOF_VOID_P EQUAL 8) - set(CUDA_64_BIT_DEVICE_CODE_DEFAULT ON) -else() - set(CUDA_64_BIT_DEVICE_CODE_DEFAULT OFF) -endif() -option(CUDA_64_BIT_DEVICE_CODE "Compile device code in 64 bit mode" ${CUDA_64_BIT_DEVICE_CODE_DEFAULT}) - -# Attach the build rule to the source file in VS. This option -option(CUDA_ATTACH_VS_BUILD_RULE_TO_CUDA_FILE "Attach the build rule to the CUDA source file. Enable only when the CUDA source file is added to at most one target." ON) - -# Prints out extra information about the cuda file during compilation -option(CUDA_BUILD_CUBIN "Generate and parse .cubin files in Device mode." OFF) - -# Set whether we are using emulation or device mode. -option(CUDA_BUILD_EMULATION "Build in Emulation mode" OFF) - -# Where to put the generated output. -set(CUDA_GENERATED_OUTPUT_DIR "" CACHE PATH "Directory to put all the output files. If blank it will default to the CMAKE_CURRENT_BINARY_DIR") - -# Parse HOST_COMPILATION mode. -option(CUDA_HOST_COMPILATION_CPP "Generated file extension" ON) - -# Extra user settable flags -set(CUDA_NVCC_FLAGS "" CACHE STRING "Semi-colon delimit multiple arguments.") - -if(CMAKE_GENERATOR MATCHES "Visual Studio") - set(CUDA_HOST_COMPILER "$(VCInstallDir)bin" CACHE FILEPATH "Host side compiler used by NVCC") -else() - if(APPLE - AND "${CMAKE_C_COMPILER_ID}" MATCHES "Clang" - AND "${CMAKE_C_COMPILER}" MATCHES "/cc$") - # Using cc which is symlink to clang may let NVCC think it is GCC and issue - # unhandled -dumpspecs option to clang. Also in case neither - # CMAKE_C_COMPILER is defined (project does not use C language) nor - # CUDA_HOST_COMPILER is specified manually we should skip -ccbin and let - # nvcc use its own default C compiler. - # Only care about this on APPLE with clang to avoid - # following symlinks to things like ccache - if(DEFINED CMAKE_C_COMPILER AND NOT DEFINED CUDA_HOST_COMPILER) - get_filename_component(c_compiler_realpath "${CMAKE_C_COMPILER}" REALPATH) - # if the real path does not end up being clang then - # go back to using CMAKE_C_COMPILER - if(NOT "${c_compiler_realpath}" MATCHES "/clang$") - set(c_compiler_realpath "${CMAKE_C_COMPILER}") - endif() - else() - set(c_compiler_realpath "") - endif() - set(CUDA_HOST_COMPILER "${c_compiler_realpath}" CACHE FILEPATH "Host side compiler used by NVCC") - else() - set(CUDA_HOST_COMPILER "${CMAKE_C_COMPILER}" - CACHE FILEPATH "Host side compiler used by NVCC") - endif() -endif() - -# Propagate the host flags to the host compiler via -Xcompiler -option(CUDA_PROPAGATE_HOST_FLAGS "Propage C/CXX_FLAGS and friends to the host compiler via -Xcompile" ON) - -# Enable CUDA_SEPARABLE_COMPILATION -option(CUDA_SEPARABLE_COMPILATION "Compile CUDA objects with separable compilation enabled. Requires CUDA 5.0+" OFF) - -# Specifies whether the commands used when compiling the .cu file will be printed out. -option(CUDA_VERBOSE_BUILD "Print out the commands run while compiling the CUDA source file. With the Makefile generator this defaults to VERBOSE variable specified on the command line, but can be forced on with this option." OFF) - -mark_as_advanced( - CUDA_64_BIT_DEVICE_CODE - CUDA_ATTACH_VS_BUILD_RULE_TO_CUDA_FILE - CUDA_GENERATED_OUTPUT_DIR - CUDA_HOST_COMPILATION_CPP - CUDA_NVCC_FLAGS - CUDA_PROPAGATE_HOST_FLAGS - CUDA_BUILD_CUBIN - CUDA_BUILD_EMULATION - CUDA_VERBOSE_BUILD - CUDA_SEPARABLE_COMPILATION - ) - -# Makefile and similar generators don't define CMAKE_CONFIGURATION_TYPES, so we -# need to add another entry for the CMAKE_BUILD_TYPE. We also need to add the -# standerd set of 4 build types (Debug, MinSizeRel, Release, and RelWithDebInfo) -# for completeness. We need run this loop in order to accomodate the addition -# of extra configuration types. Duplicate entries will be removed by -# REMOVE_DUPLICATES. -set(CUDA_configuration_types ${CMAKE_CONFIGURATION_TYPES} ${CMAKE_BUILD_TYPE} Debug MinSizeRel Release RelWithDebInfo) -list(REMOVE_DUPLICATES CUDA_configuration_types) -foreach(config ${CUDA_configuration_types}) - string(TOUPPER ${config} config_upper) - set(CUDA_NVCC_FLAGS_${config_upper} "" CACHE STRING "Semi-colon delimit multiple arguments.") - mark_as_advanced(CUDA_NVCC_FLAGS_${config_upper}) -endforeach() - -############################################################################### -############################################################################### -# Locate CUDA, Set Build Type, etc. -############################################################################### -############################################################################### - -macro(cuda_unset_include_and_libraries) - unset(CUDA_TOOLKIT_INCLUDE CACHE) - unset(CUDA_CUDART_LIBRARY CACHE) - unset(CUDA_CUDA_LIBRARY CACHE) - # Make sure you run this before you unset CUDA_VERSION. - if(CUDA_VERSION VERSION_EQUAL "3.0") - # This only existed in the 3.0 version of the CUDA toolkit - unset(CUDA_CUDARTEMU_LIBRARY CACHE) - endif() - unset(CUDA_cudart_static_LIBRARY CACHE) - unset(CUDA_cublas_LIBRARY CACHE) - unset(CUDA_cublasemu_LIBRARY CACHE) - unset(CUDA_cufft_LIBRARY CACHE) - unset(CUDA_cufftemu_LIBRARY CACHE) - unset(CUDA_cupti_LIBRARY CACHE) - unset(CUDA_curand_LIBRARY CACHE) - unset(CUDA_cusolver_LIBRARY CACHE) - unset(CUDA_cusparse_LIBRARY CACHE) - unset(CUDA_npp_LIBRARY CACHE) - unset(CUDA_nppc_LIBRARY CACHE) - unset(CUDA_nppi_LIBRARY CACHE) - unset(CUDA_npps_LIBRARY CACHE) - unset(CUDA_nvcuvenc_LIBRARY CACHE) - unset(CUDA_nvcuvid_LIBRARY CACHE) - - unset(CUDA_USE_STATIC_CUDA_RUNTIME CACHE) -endmacro() - -# Check to see if the CUDA_TOOLKIT_ROOT_DIR and CUDA_SDK_ROOT_DIR have changed, -# if they have then clear the cache variables, so that will be detected again. -if(NOT "${CUDA_TOOLKIT_ROOT_DIR}" STREQUAL "${CUDA_TOOLKIT_ROOT_DIR_INTERNAL}") - unset(CUDA_TOOLKIT_TARGET_DIR CACHE) - unset(CUDA_NVCC_EXECUTABLE CACHE) - cuda_unset_include_and_libraries() - unset(CUDA_VERSION CACHE) -endif() - -if(NOT "${CUDA_TOOLKIT_TARGET_DIR}" STREQUAL "${CUDA_TOOLKIT_TARGET_DIR_INTERNAL}") - cuda_unset_include_and_libraries() -endif() - -if(NOT "${CUDA_SDK_ROOT_DIR}" STREQUAL "${CUDA_SDK_ROOT_DIR_INTERNAL}") - # No specific variables to catch. Use this kind of code before calling - # find_package(CUDA) to clean up any variables that may depend on this path. - - # unset(MY_SPECIAL_CUDA_SDK_INCLUDE_DIR CACHE) - # unset(MY_SPECIAL_CUDA_SDK_LIBRARY CACHE) -endif() - -# Search for the cuda distribution. -if(NOT CUDA_TOOLKIT_ROOT_DIR) - - # Search in the CUDA_BIN_PATH first. - find_path(CUDA_TOOLKIT_ROOT_DIR - NAMES nvcc nvcc.exe - PATHS - ENV CUDA_PATH - ENV CUDA_BIN_PATH - PATH_SUFFIXES bin bin64 - DOC "Toolkit location." - NO_DEFAULT_PATH - ) - # Now search default paths - find_path(CUDA_TOOLKIT_ROOT_DIR - NAMES nvcc nvcc.exe - PATHS /usr/local/bin - /usr/local/cuda/bin - DOC "Toolkit location." - ) - - if (CUDA_TOOLKIT_ROOT_DIR) - string(REGEX REPLACE "[/\\\\]?bin[64]*[/\\\\]?$" "" CUDA_TOOLKIT_ROOT_DIR ${CUDA_TOOLKIT_ROOT_DIR}) - # We need to force this back into the cache. - set(CUDA_TOOLKIT_ROOT_DIR ${CUDA_TOOLKIT_ROOT_DIR} CACHE PATH "Toolkit location." FORCE) - endif() - if (NOT EXISTS ${CUDA_TOOLKIT_ROOT_DIR}) - if(CUDA_FIND_REQUIRED) - message(FATAL_ERROR "Specify CUDA_TOOLKIT_ROOT_DIR") - elseif(NOT CUDA_FIND_QUIETLY) - message("CUDA_TOOLKIT_ROOT_DIR not found or specified") - endif() - endif () -endif () - -# CUDA_NVCC_EXECUTABLE -find_program(CUDA_NVCC_EXECUTABLE - NAMES nvcc - PATHS "${CUDA_TOOLKIT_ROOT_DIR}" - ENV CUDA_PATH - ENV CUDA_BIN_PATH - PATH_SUFFIXES bin bin64 - NO_DEFAULT_PATH - ) -# Search default search paths, after we search our own set of paths. -find_program(CUDA_NVCC_EXECUTABLE nvcc) -mark_as_advanced(CUDA_NVCC_EXECUTABLE) - -if(CUDA_NVCC_EXECUTABLE AND NOT CUDA_VERSION) - # Compute the version. - execute_process (COMMAND ${CUDA_NVCC_EXECUTABLE} "--version" OUTPUT_VARIABLE NVCC_OUT) - string(REGEX REPLACE ".*release ([0-9]+)\\.([0-9]+).*" "\\1" CUDA_VERSION_MAJOR ${NVCC_OUT}) - string(REGEX REPLACE ".*release ([0-9]+)\\.([0-9]+).*" "\\2" CUDA_VERSION_MINOR ${NVCC_OUT}) - set(CUDA_VERSION "${CUDA_VERSION_MAJOR}.${CUDA_VERSION_MINOR}" CACHE STRING "Version of CUDA as computed from nvcc.") - mark_as_advanced(CUDA_VERSION) -else() - # Need to set these based off of the cached value - string(REGEX REPLACE "([0-9]+)\\.([0-9]+).*" "\\1" CUDA_VERSION_MAJOR "${CUDA_VERSION}") - string(REGEX REPLACE "([0-9]+)\\.([0-9]+).*" "\\2" CUDA_VERSION_MINOR "${CUDA_VERSION}") -endif() - -# Always set this convenience variable -set(CUDA_VERSION_STRING "${CUDA_VERSION}") - -# Support for arm cross compilation with CUDA 5.5 -if(CUDA_VERSION VERSION_GREATER "5.0" AND CMAKE_CROSSCOMPILING AND CMAKE_SYSTEM_PROCESSOR MATCHES "arm" AND EXISTS "${CUDA_TOOLKIT_ROOT_DIR}/targets/armv7-linux-gnueabihf") - set(CUDA_TOOLKIT_TARGET_DIR "${CUDA_TOOLKIT_ROOT_DIR}/targets/armv7-linux-gnueabihf" CACHE PATH "Toolkit target location.") -else() - set(CUDA_TOOLKIT_TARGET_DIR "${CUDA_TOOLKIT_ROOT_DIR}" CACHE PATH "Toolkit target location.") -endif() -mark_as_advanced(CUDA_TOOLKIT_TARGET_DIR) - -# Target CPU architecture -if(CUDA_VERSION VERSION_GREATER "5.0" AND CMAKE_CROSSCOMPILING AND CMAKE_SYSTEM_PROCESSOR MATCHES "arm") - set(_cuda_target_cpu_arch_initial "ARM") -else() - set(_cuda_target_cpu_arch_initial "") -endif() -set(CUDA_TARGET_CPU_ARCH ${_cuda_target_cpu_arch_initial} CACHE STRING "Specify the name of the class of CPU architecture for which the input files must be compiled.") -mark_as_advanced(CUDA_TARGET_CPU_ARCH) - -# CUDA_TOOLKIT_INCLUDE -find_path(CUDA_TOOLKIT_INCLUDE - device_functions.h # Header included in toolkit - PATHS "${CUDA_TOOLKIT_TARGET_DIR}" "${CUDA_TOOLKIT_ROOT_DIR}" - ENV CUDA_PATH - ENV CUDA_INC_PATH - PATH_SUFFIXES include - NO_DEFAULT_PATH - ) -# Search default search paths, after we search our own set of paths. -find_path(CUDA_TOOLKIT_INCLUDE device_functions.h) -mark_as_advanced(CUDA_TOOLKIT_INCLUDE) - -# Set the user list of include dir to nothing to initialize it. -set (CUDA_NVCC_INCLUDE_ARGS_USER "") -set (CUDA_INCLUDE_DIRS ${CUDA_TOOLKIT_INCLUDE}) - -macro(cuda_find_library_local_first_with_path_ext _var _names _doc _path_ext ) - if(CMAKE_SIZEOF_VOID_P EQUAL 8) - # CUDA 3.2+ on Windows moved the library directories, so we need the new - # and old paths. - set(_cuda_64bit_lib_dir "${_path_ext}lib/x64" "${_path_ext}lib64" "${_path_ext}libx64" ) - endif() - # CUDA 3.2+ on Windows moved the library directories, so we need to new - # (lib/Win32) and the old path (lib). - find_library(${_var} - NAMES ${_names} - PATHS "${CUDA_TOOLKIT_TARGET_DIR}" "${CUDA_TOOLKIT_ROOT_DIR}" - ENV CUDA_PATH - ENV CUDA_LIB_PATH - PATH_SUFFIXES ${_cuda_64bit_lib_dir} "${_path_ext}lib/Win32" "${_path_ext}lib" "${_path_ext}libWin32" - DOC ${_doc} - NO_DEFAULT_PATH - ) - # Search default search paths, after we search our own set of paths. - find_library(${_var} - NAMES ${_names} - PATHS "/usr/lib/nvidia-current" - DOC ${_doc} - ) -endmacro() - -macro(cuda_find_library_local_first _var _names _doc) - cuda_find_library_local_first_with_path_ext( "${_var}" "${_names}" "${_doc}" "" ) -endmacro() - -macro(find_library_local_first _var _names _doc ) - cuda_find_library_local_first( "${_var}" "${_names}" "${_doc}" "" ) -endmacro() - - -# CUDA_LIBRARIES -cuda_find_library_local_first(CUDA_CUDART_LIBRARY cudart "\"cudart\" library") -if(CUDA_VERSION VERSION_EQUAL "3.0") - # The cudartemu library only existed for the 3.0 version of CUDA. - cuda_find_library_local_first(CUDA_CUDARTEMU_LIBRARY cudartemu "\"cudartemu\" library") - mark_as_advanced( - CUDA_CUDARTEMU_LIBRARY - ) -endif() -if(NOT CUDA_VERSION VERSION_LESS "5.5") - cuda_find_library_local_first(CUDA_cudart_static_LIBRARY cudart_static "static CUDA runtime library") - mark_as_advanced(CUDA_cudart_static_LIBRARY) -endif() -if(CUDA_cudart_static_LIBRARY) - # Set whether to use the static cuda runtime. - option(CUDA_USE_STATIC_CUDA_RUNTIME "Use the static version of the CUDA runtime library if available" ON) -else() - option(CUDA_USE_STATIC_CUDA_RUNTIME "Use the static version of the CUDA runtime library if available" OFF) -endif() - -if(CUDA_USE_STATIC_CUDA_RUNTIME) - if(UNIX) - # Check for the dependent libraries. Here we look for pthreads. - if (DEFINED CMAKE_THREAD_PREFER_PTHREAD) - set(_cuda_cmake_thread_prefer_pthread ${CMAKE_THREAD_PREFER_PTHREAD}) - endif() - set(CMAKE_THREAD_PREFER_PTHREAD 1) - - # Many of the FindXYZ CMake comes with makes use of try_compile with int main(){return 0;} - # as the source file. Unfortunately this causes a warning with -Wstrict-prototypes and - # -Werror causes the try_compile to fail. We will just temporarily disable other flags - # when doing the find_package command here. - set(_cuda_cmake_c_flags ${CMAKE_C_FLAGS}) - set(CMAKE_C_FLAGS "-fPIC") - find_package(Threads REQUIRED) - set(CMAKE_C_FLAGS ${_cuda_cmake_c_flags}) - - if (DEFINED _cuda_cmake_thread_prefer_pthread) - set(CMAKE_THREAD_PREFER_PTHREAD ${_cuda_cmake_thread_prefer_pthread}) - unset(_cuda_cmake_thread_prefer_pthread) - else() - unset(CMAKE_THREAD_PREFER_PTHREAD) - endif() - if (NOT APPLE) - # Here is librt that has things such as, clock_gettime, shm_open, and shm_unlink. - find_library(CUDA_rt_LIBRARY rt) - find_library(CUDA_dl_LIBRARY dl) - if (NOT CUDA_rt_LIBRARY) - message(WARNING "Expecting to find librt for libcudart_static, but didn't find it.") - endif() - if (NOT CUDA_dl_LIBRARY) - message(WARNING "Expecting to find libdl for libcudart_static, but didn't find it.") - endif() - endif() - endif() -endif() - -# CUPTI library showed up in cuda toolkit 4.0 -if(NOT CUDA_VERSION VERSION_LESS "4.0") - cuda_find_library_local_first_with_path_ext(CUDA_cupti_LIBRARY cupti "\"cupti\" library" "extras/CUPTI/") - mark_as_advanced(CUDA_cupti_LIBRARY) -endif() - -# Set the CUDA_LIBRARIES variable. This is the set of stuff to link against if you are -# using the CUDA runtime. For the dynamic version of the runtime, most of the -# dependencies are brough in, but for the static version there are additional libraries -# and linker commands needed. -# Initialize to empty -set(CUDA_LIBRARIES) - -# If we are using emulation mode and we found the cudartemu library then use -# that one instead of cudart. -if(CUDA_BUILD_EMULATION AND CUDA_CUDARTEMU_LIBRARY) - list(APPEND CUDA_LIBRARIES ${CUDA_CUDARTEMU_LIBRARY}) -elseif(CUDA_USE_STATIC_CUDA_RUNTIME AND CUDA_cudart_static_LIBRARY) - list(APPEND CUDA_LIBRARIES ${CUDA_cudart_static_LIBRARY} ${CMAKE_THREAD_LIBS_INIT}) - if (CUDA_rt_LIBRARY) - list(APPEND CUDA_LIBRARIES ${CUDA_rt_LIBRARY}) - endif() - if (CUDA_dl_LIBRARY) - list(APPEND CUDA_LIBRARIES ${CUDA_dl_LIBRARY}) - endif() - if(APPLE) - # We need to add the default path to the driver (libcuda.dylib) as an rpath, so that - # the static cuda runtime can find it at runtime. - list(APPEND CUDA_LIBRARIES -Wl,-rpath,/usr/local/cuda/lib) - endif() -else() - list(APPEND CUDA_LIBRARIES ${CUDA_CUDART_LIBRARY}) -endif() - -# 1.1 toolkit on linux doesn't appear to have a separate library on -# some platforms. -cuda_find_library_local_first(CUDA_CUDA_LIBRARY cuda "\"cuda\" library (older versions only).") - -mark_as_advanced( - CUDA_CUDA_LIBRARY - CUDA_CUDART_LIBRARY - ) - -####################### -# Look for some of the toolkit helper libraries -macro(FIND_CUDA_HELPER_LIBS _name) - cuda_find_library_local_first(CUDA_${_name}_LIBRARY ${_name} "\"${_name}\" library") - mark_as_advanced(CUDA_${_name}_LIBRARY) -endmacro() - -####################### -# Disable emulation for v3.1 onward -if(CUDA_VERSION VERSION_GREATER "3.0") - if(CUDA_BUILD_EMULATION) - message(FATAL_ERROR "CUDA_BUILD_EMULATION is not supported in version 3.1 and onwards. You must disable it to proceed. You have version ${CUDA_VERSION}.") - endif() -endif() - -# Search for additional CUDA toolkit libraries. -if(CUDA_VERSION VERSION_LESS "3.1") - # Emulation libraries aren't available in version 3.1 onward. - find_cuda_helper_libs(cufftemu) - find_cuda_helper_libs(cublasemu) -endif() -find_cuda_helper_libs(cufft) -find_cuda_helper_libs(cublas) -if(NOT CUDA_VERSION VERSION_LESS "3.2") - # cusparse showed up in version 3.2 - find_cuda_helper_libs(cusparse) - find_cuda_helper_libs(curand) - if (WIN32) - find_cuda_helper_libs(nvcuvenc) - find_cuda_helper_libs(nvcuvid) - endif() -endif() -if(CUDA_VERSION VERSION_GREATER "5.0") - # In CUDA 5.5 NPP was splitted onto 3 separate libraries. - find_cuda_helper_libs(nppc) - find_cuda_helper_libs(nppi) - find_cuda_helper_libs(npps) - set(CUDA_npp_LIBRARY "${CUDA_nppc_LIBRARY};${CUDA_nppi_LIBRARY};${CUDA_npps_LIBRARY}") -elseif(NOT CUDA_VERSION VERSION_LESS "4.0") - find_cuda_helper_libs(npp) -endif() -if(NOT CUDA_VERSION VERSION_LESS "7.0") - # cusolver showed up in version 7.0 - find_cuda_helper_libs(cusolver) -endif() - -if (CUDA_BUILD_EMULATION) - set(CUDA_CUFFT_LIBRARIES ${CUDA_cufftemu_LIBRARY}) - set(CUDA_CUBLAS_LIBRARIES ${CUDA_cublasemu_LIBRARY}) -else() - set(CUDA_CUFFT_LIBRARIES ${CUDA_cufft_LIBRARY}) - set(CUDA_CUBLAS_LIBRARIES ${CUDA_cublas_LIBRARY}) -endif() - -######################## -# Look for the SDK stuff. As of CUDA 3.0 NVSDKCUDA_ROOT has been replaced with -# NVSDKCOMPUTE_ROOT with the old CUDA C contents moved into the C subdirectory -find_path(CUDA_SDK_ROOT_DIR common/inc/cutil.h - HINTS - "$ENV{NVSDKCOMPUTE_ROOT}/C" - ENV NVSDKCUDA_ROOT - "[HKEY_LOCAL_MACHINE\\SOFTWARE\\NVIDIA Corporation\\Installed Products\\NVIDIA SDK 10\\Compute;InstallDir]" - PATHS - "/Developer/GPU\ Computing/C" - ) - -# Keep the CUDA_SDK_ROOT_DIR first in order to be able to override the -# environment variables. -set(CUDA_SDK_SEARCH_PATH - "${CUDA_SDK_ROOT_DIR}" - "${CUDA_TOOLKIT_ROOT_DIR}/local/NVSDK0.2" - "${CUDA_TOOLKIT_ROOT_DIR}/NVSDK0.2" - "${CUDA_TOOLKIT_ROOT_DIR}/NV_CUDA_SDK" - "$ENV{HOME}/NVIDIA_CUDA_SDK" - "$ENV{HOME}/NVIDIA_CUDA_SDK_MACOSX" - "/Developer/CUDA" - ) - -# Example of how to find an include file from the CUDA_SDK_ROOT_DIR - -# find_path(CUDA_CUT_INCLUDE_DIR -# cutil.h -# PATHS ${CUDA_SDK_SEARCH_PATH} -# PATH_SUFFIXES "common/inc" -# DOC "Location of cutil.h" -# NO_DEFAULT_PATH -# ) -# # Now search system paths -# find_path(CUDA_CUT_INCLUDE_DIR cutil.h DOC "Location of cutil.h") - -# mark_as_advanced(CUDA_CUT_INCLUDE_DIR) - - -# Example of how to find a library in the CUDA_SDK_ROOT_DIR - -# # cutil library is called cutil64 for 64 bit builds on windows. We don't want -# # to get these confused, so we are setting the name based on the word size of -# # the build. - -# if(CMAKE_SIZEOF_VOID_P EQUAL 8) -# set(cuda_cutil_name cutil64) -# else() -# set(cuda_cutil_name cutil32) -# endif() - -# find_library(CUDA_CUT_LIBRARY -# NAMES cutil ${cuda_cutil_name} -# PATHS ${CUDA_SDK_SEARCH_PATH} -# # The new version of the sdk shows up in common/lib, but the old one is in lib -# PATH_SUFFIXES "common/lib" "lib" -# DOC "Location of cutil library" -# NO_DEFAULT_PATH -# ) -# # Now search system paths -# find_library(CUDA_CUT_LIBRARY NAMES cutil ${cuda_cutil_name} DOC "Location of cutil library") -# mark_as_advanced(CUDA_CUT_LIBRARY) -# set(CUDA_CUT_LIBRARIES ${CUDA_CUT_LIBRARY}) - - - -############################# -# Check for required components -set(CUDA_FOUND TRUE) - -set(CUDA_TOOLKIT_ROOT_DIR_INTERNAL "${CUDA_TOOLKIT_ROOT_DIR}" CACHE INTERNAL - "This is the value of the last time CUDA_TOOLKIT_ROOT_DIR was set successfully." FORCE) -set(CUDA_TOOLKIT_TARGET_DIR_INTERNAL "${CUDA_TOOLKIT_TARGET_DIR}" CACHE INTERNAL - "This is the value of the last time CUDA_TOOLKIT_TARGET_DIR was set successfully." FORCE) -set(CUDA_SDK_ROOT_DIR_INTERNAL "${CUDA_SDK_ROOT_DIR}" CACHE INTERNAL - "This is the value of the last time CUDA_SDK_ROOT_DIR was set successfully." FORCE) - -include(${CMAKE_CURRENT_LIST_DIR}/FindPackageHandleStandardArgs.cmake) -find_package_handle_standard_args(CUDA - REQUIRED_VARS - CUDA_TOOLKIT_ROOT_DIR - CUDA_NVCC_EXECUTABLE - CUDA_INCLUDE_DIRS - CUDA_CUDART_LIBRARY - VERSION_VAR - CUDA_VERSION - ) - - - -############################################################################### -############################################################################### -# Macros -############################################################################### -############################################################################### - -############################################################################### -# Add include directories to pass to the nvcc command. -macro(CUDA_INCLUDE_DIRECTORIES) - foreach(dir ${ARGN}) - list(APPEND CUDA_NVCC_INCLUDE_ARGS_USER -I${dir}) - endforeach() -endmacro() - - -############################################################################## -cuda_find_helper_file(parse_cubin cmake) -cuda_find_helper_file(make2cmake cmake) -cuda_find_helper_file(run_nvcc cmake) - -############################################################################## -# Separate the OPTIONS out from the sources -# -macro(CUDA_GET_SOURCES_AND_OPTIONS _sources _cmake_options _options) - set( ${_sources} ) - set( ${_cmake_options} ) - set( ${_options} ) - set( _found_options FALSE ) - foreach(arg ${ARGN}) - if("x${arg}" STREQUAL "xOPTIONS") - set( _found_options TRUE ) - elseif( - "x${arg}" STREQUAL "xWIN32" OR - "x${arg}" STREQUAL "xMACOSX_BUNDLE" OR - "x${arg}" STREQUAL "xEXCLUDE_FROM_ALL" OR - "x${arg}" STREQUAL "xSTATIC" OR - "x${arg}" STREQUAL "xSHARED" OR - "x${arg}" STREQUAL "xMODULE" - ) - list(APPEND ${_cmake_options} ${arg}) - else() - if ( _found_options ) - list(APPEND ${_options} ${arg}) - else() - # Assume this is a file - list(APPEND ${_sources} ${arg}) - endif() - endif() - endforeach() -endmacro() - -############################################################################## -# Parse the OPTIONS from ARGN and set the variables prefixed by _option_prefix -# -macro(CUDA_PARSE_NVCC_OPTIONS _option_prefix) - set( _found_config ) - foreach(arg ${ARGN}) - # Determine if we are dealing with a perconfiguration flag - foreach(config ${CUDA_configuration_types}) - string(TOUPPER ${config} config_upper) - if (arg STREQUAL "${config_upper}") - set( _found_config _${arg}) - # Set arg to nothing to keep it from being processed further - set( arg ) - endif() - endforeach() - - if ( arg ) - list(APPEND ${_option_prefix}${_found_config} "${arg}") - endif() - endforeach() -endmacro() - -############################################################################## -# Helper to add the include directory for CUDA only once -function(CUDA_ADD_CUDA_INCLUDE_ONCE) - get_directory_property(_include_directories INCLUDE_DIRECTORIES) - set(_add TRUE) - if(_include_directories) - foreach(dir ${_include_directories}) - if("${dir}" STREQUAL "${CUDA_INCLUDE_DIRS}") - set(_add FALSE) - endif() - endforeach() - endif() - if(_add) - include_directories(${CUDA_INCLUDE_DIRS}) - endif() -endfunction() - -function(CUDA_BUILD_SHARED_LIBRARY shared_flag) - set(cmake_args ${ARGN}) - # If SHARED, MODULE, or STATIC aren't already in the list of arguments, then - # add SHARED or STATIC based on the value of BUILD_SHARED_LIBS. - list(FIND cmake_args SHARED _cuda_found_SHARED) - list(FIND cmake_args MODULE _cuda_found_MODULE) - list(FIND cmake_args STATIC _cuda_found_STATIC) - if( _cuda_found_SHARED GREATER -1 OR - _cuda_found_MODULE GREATER -1 OR - _cuda_found_STATIC GREATER -1) - set(_cuda_build_shared_libs) - else() - if (BUILD_SHARED_LIBS) - set(_cuda_build_shared_libs SHARED) - else() - set(_cuda_build_shared_libs STATIC) - endif() - endif() - set(${shared_flag} ${_cuda_build_shared_libs} PARENT_SCOPE) -endfunction() - -############################################################################## -# Helper to avoid clashes of files with the same basename but different paths. -# This doesn't attempt to do exactly what CMake internals do, which is to only -# add this path when there is a conflict, since by the time a second collision -# in names is detected it's already too late to fix the first one. For -# consistency sake the relative path will be added to all files. -function(CUDA_COMPUTE_BUILD_PATH path build_path) - #message("CUDA_COMPUTE_BUILD_PATH([${path}] ${build_path})") - # Only deal with CMake style paths from here on out - file(TO_CMAKE_PATH "${path}" bpath) - if (IS_ABSOLUTE "${bpath}") - # Absolute paths are generally unnessary, especially if something like - # file(GLOB_RECURSE) is used to pick up the files. - - string(FIND "${bpath}" "${CMAKE_CURRENT_BINARY_DIR}" _binary_dir_pos) - if (_binary_dir_pos EQUAL 0) - file(RELATIVE_PATH bpath "${CMAKE_CURRENT_BINARY_DIR}" "${bpath}") - else() - file(RELATIVE_PATH bpath "${CMAKE_CURRENT_SOURCE_DIR}" "${bpath}") - endif() - endif() - - # This recipe is from cmLocalGenerator::CreateSafeUniqueObjectFileName in the - # CMake source. - - # Remove leading / - string(REGEX REPLACE "^[/]+" "" bpath "${bpath}") - # Avoid absolute paths by removing ':' - string(REPLACE ":" "_" bpath "${bpath}") - # Avoid relative paths that go up the tree - string(REPLACE "../" "__/" bpath "${bpath}") - # Avoid spaces - string(REPLACE " " "_" bpath "${bpath}") - - # Strip off the filename. I wait until here to do it, since removin the - # basename can make a path that looked like path/../basename turn into - # path/.. (notice the trailing slash). - get_filename_component(bpath "${bpath}" PATH) - - set(${build_path} "${bpath}" PARENT_SCOPE) - #message("${build_path} = ${bpath}") -endfunction() - -############################################################################## -# This helper macro populates the following variables and setups up custom -# commands and targets to invoke the nvcc compiler to generate C or PTX source -# dependent upon the format parameter. The compiler is invoked once with -M -# to generate a dependency file and a second time with -cuda or -ptx to generate -# a .cpp or .ptx file. -# INPUT: -# cuda_target - Target name -# format - PTX, CUBIN, FATBIN or OBJ -# FILE1 .. FILEN - The remaining arguments are the sources to be wrapped. -# OPTIONS - Extra options to NVCC -# OUTPUT: -# generated_files - List of generated files -############################################################################## -############################################################################## - -macro(CUDA_WRAP_SRCS cuda_target format generated_files) - - # If CMake doesn't support separable compilation, complain - if(CUDA_SEPARABLE_COMPILATION AND CMAKE_VERSION VERSION_LESS "2.8.10.1") - message(SEND_ERROR "CUDA_SEPARABLE_COMPILATION isn't supported for CMake versions less than 2.8.10.1") - endif() - - # Set up all the command line flags here, so that they can be overridden on a per target basis. - - set(nvcc_flags "") - - # Emulation if the card isn't present. - if (CUDA_BUILD_EMULATION) - # Emulation. - set(nvcc_flags ${nvcc_flags} --device-emulation -D_DEVICEEMU -g) - else() - # Device mode. No flags necessary. - endif() - - if(CUDA_HOST_COMPILATION_CPP) - set(CUDA_C_OR_CXX CXX) - else() - if(CUDA_VERSION VERSION_LESS "3.0") - set(nvcc_flags ${nvcc_flags} --host-compilation C) - else() - message(WARNING "--host-compilation flag is deprecated in CUDA version >= 3.0. Removing --host-compilation C flag" ) - endif() - set(CUDA_C_OR_CXX C) - endif() - - set(generated_extension ${CMAKE_${CUDA_C_OR_CXX}_OUTPUT_EXTENSION}) - - if(CUDA_64_BIT_DEVICE_CODE) - set(nvcc_flags ${nvcc_flags} -m64) - else() - set(nvcc_flags ${nvcc_flags} -m32) - endif() - - if(CUDA_TARGET_CPU_ARCH) - set(nvcc_flags ${nvcc_flags} "--target-cpu-architecture=${CUDA_TARGET_CPU_ARCH}") - endif() - - # This needs to be passed in at this stage, because VS needs to fill out the - # value of VCInstallDir from within VS. Note that CCBIN is only used if - # -ccbin or --compiler-bindir isn't used and CUDA_HOST_COMPILER matches - # $(VCInstallDir)/bin. - if(CMAKE_GENERATOR MATCHES "Visual Studio") - set(ccbin_flags -D "\"CCBIN:PATH=$(VCInstallDir)bin\"" ) - else() - set(ccbin_flags) - endif() - - # Figure out which configure we will use and pass that in as an argument to - # the script. We need to defer the decision until compilation time, because - # for VS projects we won't know if we are making a debug or release build - # until build time. - if(CMAKE_GENERATOR MATCHES "Visual Studio") - set( CUDA_build_configuration "$(ConfigurationName)" ) - else() - set( CUDA_build_configuration "${CMAKE_BUILD_TYPE}") - endif() - - # Initialize our list of includes with the user ones followed by the CUDA system ones. - set(CUDA_NVCC_INCLUDE_ARGS ${CUDA_NVCC_INCLUDE_ARGS_USER} "-I${CUDA_INCLUDE_DIRS}") - # Get the include directories for this directory and use them for our nvcc command. - # Remove duplicate entries which may be present since include_directories - # in CMake >= 2.8.8 does not remove them. - get_directory_property(CUDA_NVCC_INCLUDE_DIRECTORIES INCLUDE_DIRECTORIES) - list(REMOVE_DUPLICATES CUDA_NVCC_INCLUDE_DIRECTORIES) - if(CUDA_NVCC_INCLUDE_DIRECTORIES) - foreach(dir ${CUDA_NVCC_INCLUDE_DIRECTORIES}) - list(APPEND CUDA_NVCC_INCLUDE_ARGS -I${dir}) - endforeach() - endif() - - # Reset these variables - set(CUDA_WRAP_OPTION_NVCC_FLAGS) - foreach(config ${CUDA_configuration_types}) - string(TOUPPER ${config} config_upper) - set(CUDA_WRAP_OPTION_NVCC_FLAGS_${config_upper}) - endforeach() - - CUDA_GET_SOURCES_AND_OPTIONS(_cuda_wrap_sources _cuda_wrap_cmake_options _cuda_wrap_options ${ARGN}) - CUDA_PARSE_NVCC_OPTIONS(CUDA_WRAP_OPTION_NVCC_FLAGS ${_cuda_wrap_options}) - - # Figure out if we are building a shared library. BUILD_SHARED_LIBS is - # respected in CUDA_ADD_LIBRARY. - set(_cuda_build_shared_libs FALSE) - # SHARED, MODULE - list(FIND _cuda_wrap_cmake_options SHARED _cuda_found_SHARED) - list(FIND _cuda_wrap_cmake_options MODULE _cuda_found_MODULE) - if(_cuda_found_SHARED GREATER -1 OR _cuda_found_MODULE GREATER -1) - set(_cuda_build_shared_libs TRUE) - endif() - # STATIC - list(FIND _cuda_wrap_cmake_options STATIC _cuda_found_STATIC) - if(_cuda_found_STATIC GREATER -1) - set(_cuda_build_shared_libs FALSE) - endif() - - # CUDA_HOST_FLAGS - if(_cuda_build_shared_libs) - # If we are setting up code for a shared library, then we need to add extra flags for - # compiling objects for shared libraries. - set(CUDA_HOST_SHARED_FLAGS ${CMAKE_SHARED_LIBRARY_${CUDA_C_OR_CXX}_FLAGS}) - else() - set(CUDA_HOST_SHARED_FLAGS) - endif() - # Only add the CMAKE_{C,CXX}_FLAGS if we are propagating host flags. We - # always need to set the SHARED_FLAGS, though. - if(CUDA_PROPAGATE_HOST_FLAGS) - set(_cuda_host_flags "set(CMAKE_HOST_FLAGS ${CMAKE_${CUDA_C_OR_CXX}_FLAGS} ${CUDA_HOST_SHARED_FLAGS})") - else() - set(_cuda_host_flags "set(CMAKE_HOST_FLAGS ${CUDA_HOST_SHARED_FLAGS})") - endif() - - set(_cuda_nvcc_flags_config "# Build specific configuration flags") - # Loop over all the configuration types to generate appropriate flags for run_nvcc.cmake - foreach(config ${CUDA_configuration_types}) - string(TOUPPER ${config} config_upper) - # CMAKE_FLAGS are strings and not lists. By not putting quotes around CMAKE_FLAGS - # we convert the strings to lists (like we want). - - if(CUDA_PROPAGATE_HOST_FLAGS) - # nvcc chokes on -g3 in versions previous to 3.0, so replace it with -g - set(_cuda_fix_g3 FALSE) - - if(CMAKE_COMPILER_IS_GNUCC) - if (CUDA_VERSION VERSION_LESS "3.0" OR - CUDA_VERSION VERSION_EQUAL "4.1" OR - CUDA_VERSION VERSION_EQUAL "4.2" - ) - set(_cuda_fix_g3 TRUE) - endif() - endif() - if(_cuda_fix_g3) - string(REPLACE "-g3" "-g" _cuda_C_FLAGS "${CMAKE_${CUDA_C_OR_CXX}_FLAGS_${config_upper}}") - else() - set(_cuda_C_FLAGS "${CMAKE_${CUDA_C_OR_CXX}_FLAGS_${config_upper}}") - endif() - - set(_cuda_host_flags "${_cuda_host_flags}\nset(CMAKE_HOST_FLAGS_${config_upper} ${_cuda_C_FLAGS})") - endif() - - # Note that if we ever want CUDA_NVCC_FLAGS_ to be string (instead of a list - # like it is currently), we can remove the quotes around the - # ${CUDA_NVCC_FLAGS_${config_upper}} variable like the CMAKE_HOST_FLAGS_ variable. - set(_cuda_nvcc_flags_config "${_cuda_nvcc_flags_config}\nset(CUDA_NVCC_FLAGS_${config_upper} ${CUDA_NVCC_FLAGS_${config_upper}} ;; ${CUDA_WRAP_OPTION_NVCC_FLAGS_${config_upper}})") - endforeach() - - # Process the C++11 flag. If the host sets the flag, we need to add it to nvcc and - # remove it from the host. This is because -Xcompile -std=c++ will choke nvcc (it uses - # the C preprocessor). In order to get this to work correctly, we need to use nvcc's - # specific c++11 flag. - if( "${_cuda_host_flags}" MATCHES "-std=c\\+\\+11") - # Add the c++11 flag to nvcc if it isn't already present. Note that we only look at - # the main flag instead of the configuration specific flags. - if( NOT "${CUDA_NVCC_FLAGS}" MATCHES "-std;c\\+\\+11" ) - list(APPEND nvcc_flags --std c++11) - endif() - string(REGEX REPLACE "[-]+std=c\\+\\+11" "" _cuda_host_flags "${_cuda_host_flags}") - endif() - - # Get the list of definitions from the directory property - get_directory_property(CUDA_NVCC_DEFINITIONS COMPILE_DEFINITIONS) - if(CUDA_NVCC_DEFINITIONS) - foreach(_definition ${CUDA_NVCC_DEFINITIONS}) - list(APPEND nvcc_flags "-D${_definition}") - endforeach() - endif() - - if(_cuda_build_shared_libs) - list(APPEND nvcc_flags "-D${cuda_target}_EXPORTS") - endif() - - # Reset the output variable - set(_cuda_wrap_generated_files "") - - # Iterate over the macro arguments and create custom - # commands for all the .cu files. - foreach(file ${ARGN}) - # Ignore any file marked as a HEADER_FILE_ONLY - get_source_file_property(_is_header ${file} HEADER_FILE_ONLY) - # Allow per source file overrides of the format. Also allows compiling non-.cu files. - get_source_file_property(_cuda_source_format ${file} CUDA_SOURCE_PROPERTY_FORMAT) - if((${file} MATCHES "\\.cu$" OR _cuda_source_format) AND NOT _is_header) - - if(NOT _cuda_source_format) - set(_cuda_source_format ${format}) - endif() - # If file isn't a .cu file, we need to tell nvcc to treat it as such. - if(NOT ${file} MATCHES "\\.cu$") - set(cuda_language_flag -x=cu) - else() - set(cuda_language_flag) - endif() - - if( ${_cuda_source_format} MATCHES "OBJ") - set( cuda_compile_to_external_module OFF ) - else() - set( cuda_compile_to_external_module ON ) - if( ${_cuda_source_format} MATCHES "PTX" ) - set( cuda_compile_to_external_module_type "ptx" ) - elseif( ${_cuda_source_format} MATCHES "CUBIN") - set( cuda_compile_to_external_module_type "cubin" ) - elseif( ${_cuda_source_format} MATCHES "FATBIN") - set( cuda_compile_to_external_module_type "fatbin" ) - else() - message( FATAL_ERROR "Invalid format flag passed to CUDA_WRAP_SRCS or set with CUDA_SOURCE_PROPERTY_FORMAT file property for file '${file}': '${_cuda_source_format}'. Use OBJ, PTX, CUBIN or FATBIN.") - endif() - endif() - - if(cuda_compile_to_external_module) - # Don't use any of the host compilation flags for PTX targets. - set(CUDA_HOST_FLAGS) - set(CUDA_NVCC_FLAGS_CONFIG) - else() - set(CUDA_HOST_FLAGS ${_cuda_host_flags}) - set(CUDA_NVCC_FLAGS_CONFIG ${_cuda_nvcc_flags_config}) - endif() - - # Determine output directory - cuda_compute_build_path("${file}" cuda_build_path) - set(cuda_compile_intermediate_directory "${CMAKE_CURRENT_BINARY_DIR}/CMakeFiles/${cuda_target}.dir/${cuda_build_path}") - if(CUDA_GENERATED_OUTPUT_DIR) - set(cuda_compile_output_dir "${CUDA_GENERATED_OUTPUT_DIR}") - else() - if ( cuda_compile_to_external_module ) - set(cuda_compile_output_dir "${CMAKE_CURRENT_BINARY_DIR}") - else() - set(cuda_compile_output_dir "${cuda_compile_intermediate_directory}") - endif() - endif() - - # Add a custom target to generate a c or ptx file. ###################### - - get_filename_component( basename ${file} NAME ) - if( cuda_compile_to_external_module ) - set(generated_file_path "${cuda_compile_output_dir}") - set(generated_file_basename "${cuda_target}_generated_${basename}.${cuda_compile_to_external_module_type}") - set(format_flag "-${cuda_compile_to_external_module_type}") - file(MAKE_DIRECTORY "${cuda_compile_output_dir}") - else() - set(generated_file_path "${cuda_compile_output_dir}/${CMAKE_CFG_INTDIR}") - set(generated_file_basename "${cuda_target}_generated_${basename}${generated_extension}") - if(CUDA_SEPARABLE_COMPILATION) - set(format_flag "-dc") - else() - set(format_flag "-c") - endif() - endif() - - # Set all of our file names. Make sure that whatever filenames that have - # generated_file_path in them get passed in through as a command line - # argument, so that the ${CMAKE_CFG_INTDIR} gets expanded at run time - # instead of configure time. - set(generated_file "${generated_file_path}/${generated_file_basename}") - set(cmake_dependency_file "${cuda_compile_intermediate_directory}/${generated_file_basename}.depend") - set(NVCC_generated_dependency_file "${cuda_compile_intermediate_directory}/${generated_file_basename}.NVCC-depend") - set(generated_cubin_file "${generated_file_path}/${generated_file_basename}.cubin.txt") - set(custom_target_script "${cuda_compile_intermediate_directory}/${generated_file_basename}.cmake") - - # Setup properties for obj files: - if( NOT cuda_compile_to_external_module ) - set_source_files_properties("${generated_file}" - PROPERTIES - EXTERNAL_OBJECT true # This is an object file not to be compiled, but only be linked. - ) - endif() - - # Don't add CMAKE_CURRENT_SOURCE_DIR if the path is already an absolute path. - get_filename_component(file_path "${file}" PATH) - if(IS_ABSOLUTE "${file_path}") - set(source_file "${file}") - else() - set(source_file "${CMAKE_CURRENT_SOURCE_DIR}/${file}") - endif() - - if( NOT cuda_compile_to_external_module AND CUDA_SEPARABLE_COMPILATION) - list(APPEND ${cuda_target}_SEPARABLE_COMPILATION_OBJECTS "${generated_file}") - endif() - - # Bring in the dependencies. Creates a variable CUDA_NVCC_DEPEND ####### - cuda_include_nvcc_dependencies(${cmake_dependency_file}) - - # Convience string for output ########################################### - if(CUDA_BUILD_EMULATION) - set(cuda_build_type "Emulation") - else() - set(cuda_build_type "Device") - endif() - - # Build the NVCC made dependency file ################################### - set(build_cubin OFF) - if ( NOT CUDA_BUILD_EMULATION AND CUDA_BUILD_CUBIN ) - if ( NOT cuda_compile_to_external_module ) - set ( build_cubin ON ) - endif() - endif() - - # Configure the build script - configure_file("${CUDA_run_nvcc}" "${custom_target_script}" @ONLY) - - # So if a user specifies the same cuda file as input more than once, you - # can have bad things happen with dependencies. Here we check an option - # to see if this is the behavior they want. - if(CUDA_ATTACH_VS_BUILD_RULE_TO_CUDA_FILE) - set(main_dep MAIN_DEPENDENCY ${source_file}) - else() - set(main_dep DEPENDS ${source_file}) - endif() - - if(CUDA_VERBOSE_BUILD) - set(verbose_output ON) - elseif(CMAKE_GENERATOR MATCHES "Makefiles") - set(verbose_output "$(VERBOSE)") - else() - set(verbose_output OFF) - endif() - - # Create up the comment string - file(RELATIVE_PATH generated_file_relative_path "${CMAKE_BINARY_DIR}" "${generated_file}") - if(cuda_compile_to_external_module) - set(cuda_build_comment_string "Building NVCC ${cuda_compile_to_external_module_type} file ${generated_file_relative_path}") - else() - set(cuda_build_comment_string "Building NVCC (${cuda_build_type}) object ${generated_file_relative_path}") - endif() - - # Build the generated file and dependency file ########################## - add_custom_command( - OUTPUT ${generated_file} - # These output files depend on the source_file and the contents of cmake_dependency_file - ${main_dep} - DEPENDS ${CUDA_NVCC_DEPEND} - DEPENDS ${custom_target_script} - # Make sure the output directory exists before trying to write to it. - COMMAND ${CMAKE_COMMAND} -E make_directory "${generated_file_path}" - COMMAND ${CMAKE_COMMAND} ARGS - -D verbose:BOOL=${verbose_output} - ${ccbin_flags} - -D build_configuration:STRING=${CUDA_build_configuration} - -D "generated_file:STRING=${generated_file}" - -D "generated_cubin_file:STRING=${generated_cubin_file}" - -P "${custom_target_script}" - WORKING_DIRECTORY "${cuda_compile_intermediate_directory}" - COMMENT "${cuda_build_comment_string}" - ) - - # Make sure the build system knows the file is generated. - set_source_files_properties(${generated_file} PROPERTIES GENERATED TRUE) - - list(APPEND _cuda_wrap_generated_files ${generated_file}) - - # Add the other files that we want cmake to clean on a cleanup ########## - list(APPEND CUDA_ADDITIONAL_CLEAN_FILES "${cmake_dependency_file}") - list(REMOVE_DUPLICATES CUDA_ADDITIONAL_CLEAN_FILES) - set(CUDA_ADDITIONAL_CLEAN_FILES ${CUDA_ADDITIONAL_CLEAN_FILES} CACHE INTERNAL "List of intermediate files that are part of the cuda dependency scanning.") - - endif() - endforeach() - - # Set the return parameter - set(${generated_files} ${_cuda_wrap_generated_files}) -endmacro() - -function(_cuda_get_important_host_flags important_flags flag_string) - if(CMAKE_GENERATOR MATCHES "Visual Studio") - string(REGEX MATCHALL "/M[DT][d]?" flags "${flag_string}") - list(APPEND ${important_flags} ${flags}) - else() - string(REGEX MATCHALL "-fPIC" flags "${flag_string}") - list(APPEND ${important_flags} ${flags}) - endif() - set(${important_flags} ${${important_flags}} PARENT_SCOPE) -endfunction() - -############################################################################### -############################################################################### -# Separable Compilation Link -############################################################################### -############################################################################### - -# Compute the filename to be used by CUDA_LINK_SEPARABLE_COMPILATION_OBJECTS -function(CUDA_COMPUTE_SEPARABLE_COMPILATION_OBJECT_FILE_NAME output_file_var cuda_target object_files) - if (object_files) - set(generated_extension ${CMAKE_${CUDA_C_OR_CXX}_OUTPUT_EXTENSION}) - set(output_file "${CMAKE_CURRENT_BINARY_DIR}/CMakeFiles/${cuda_target}.dir/${CMAKE_CFG_INTDIR}/${cuda_target}_intermediate_link${generated_extension}") - else() - set(output_file) - endif() - - set(${output_file_var} "${output_file}" PARENT_SCOPE) -endfunction() - -# Setup the build rule for the separable compilation intermediate link file. -function(CUDA_LINK_SEPARABLE_COMPILATION_OBJECTS output_file cuda_target options object_files) - if (object_files) - - set_source_files_properties("${output_file}" - PROPERTIES - EXTERNAL_OBJECT TRUE # This is an object file not to be compiled, but only - # be linked. - GENERATED TRUE # This file is generated during the build - ) - - # For now we are ignoring all the configuration specific flags. - set(nvcc_flags) - CUDA_PARSE_NVCC_OPTIONS(nvcc_flags ${options}) - if(CUDA_64_BIT_DEVICE_CODE) - list(APPEND nvcc_flags -m64) - else() - list(APPEND nvcc_flags -m32) - endif() - # If -ccbin, --compiler-bindir has been specified, don't do anything. Otherwise add it here. - list( FIND nvcc_flags "-ccbin" ccbin_found0 ) - list( FIND nvcc_flags "--compiler-bindir" ccbin_found1 ) - if( ccbin_found0 LESS 0 AND ccbin_found1 LESS 0 AND CUDA_HOST_COMPILER ) - list(APPEND nvcc_flags -ccbin "\"${CUDA_HOST_COMPILER}\"") - endif() - - # Create a list of flags specified by CUDA_NVCC_FLAGS_${CONFIG} and CMAKE_${CUDA_C_OR_CXX}_FLAGS* - set(config_specific_flags) - set(flags) - foreach(config ${CUDA_configuration_types}) - string(TOUPPER ${config} config_upper) - # Add config specific flags - foreach(f ${CUDA_NVCC_FLAGS_${config_upper}}) - list(APPEND config_specific_flags $<$:${f}>) - endforeach() - set(important_host_flags) - _cuda_get_important_host_flags(important_host_flags "${CMAKE_${CUDA_C_OR_CXX}_FLAGS_${config_upper}}") - foreach(f ${important_host_flags}) - list(APPEND flags $<$:-Xcompiler> $<$:${f}>) - endforeach() - endforeach() - # Add CMAKE_${CUDA_C_OR_CXX}_FLAGS - set(important_host_flags) - _cuda_get_important_host_flags(important_host_flags "${CMAKE_${CUDA_C_OR_CXX}_FLAGS}") - foreach(f ${important_host_flags}) - list(APPEND flags -Xcompiler ${f}) - endforeach() - - # Add our general CUDA_NVCC_FLAGS with the configuration specifig flags - set(nvcc_flags ${CUDA_NVCC_FLAGS} ${config_specific_flags} ${nvcc_flags}) - - file(RELATIVE_PATH output_file_relative_path "${CMAKE_BINARY_DIR}" "${output_file}") - - # Some generators don't handle the multiple levels of custom command - # dependencies correctly (obj1 depends on file1, obj2 depends on obj1), so - # we work around that issue by compiling the intermediate link object as a - # pre-link custom command in that situation. - set(do_obj_build_rule TRUE) - if (MSVC_VERSION GREATER 1599) - # VS 2010 and 2012 have this problem. If future versions fix this issue, - # it should still work, it just won't be as nice as the other method. - set(do_obj_build_rule FALSE) - endif() - - if (do_obj_build_rule) - add_custom_command( - OUTPUT ${output_file} - DEPENDS ${object_files} - COMMAND ${CUDA_NVCC_EXECUTABLE} ${nvcc_flags} -dlink ${object_files} -o ${output_file} - ${flags} - COMMENT "Building NVCC intermediate link file ${output_file_relative_path}" - ) - else() - get_filename_component(output_file_dir "${output_file}" DIRECTORY) - add_custom_command( - TARGET ${cuda_target} - PRE_LINK - COMMAND ${CMAKE_COMMAND} -E echo "Building NVCC intermediate link file ${output_file_relative_path}" - COMMAND ${CMAKE_COMMAND} -E make_directory "${output_file_dir}" - COMMAND ${CUDA_NVCC_EXECUTABLE} ${nvcc_flags} ${flags} -dlink ${object_files} -o "${output_file}" - ) - endif() - endif() -endfunction() - -############################################################################### -############################################################################### -# ADD LIBRARY -############################################################################### -############################################################################### -macro(CUDA_ADD_LIBRARY cuda_target) - - CUDA_ADD_CUDA_INCLUDE_ONCE() - - # Separate the sources from the options - CUDA_GET_SOURCES_AND_OPTIONS(_sources _cmake_options _options ${ARGN}) - CUDA_BUILD_SHARED_LIBRARY(_cuda_shared_flag ${ARGN}) - # Create custom commands and targets for each file. - CUDA_WRAP_SRCS( ${cuda_target} OBJ _generated_files ${_sources} - ${_cmake_options} ${_cuda_shared_flag} - OPTIONS ${_options} ) - - # Compute the file name of the intermedate link file used for separable - # compilation. - CUDA_COMPUTE_SEPARABLE_COMPILATION_OBJECT_FILE_NAME(link_file ${cuda_target} "${${cuda_target}_SEPARABLE_COMPILATION_OBJECTS}") - - # Add the library. - add_library(${cuda_target} ${_cmake_options} - ${_generated_files} - ${_sources} - ${link_file} - ) - - # Add a link phase for the separable compilation if it has been enabled. If - # it has been enabled then the ${cuda_target}_SEPARABLE_COMPILATION_OBJECTS - # variable will have been defined. - CUDA_LINK_SEPARABLE_COMPILATION_OBJECTS("${link_file}" ${cuda_target} "${_options}" "${${cuda_target}_SEPARABLE_COMPILATION_OBJECTS}") - - target_link_libraries(${cuda_target} - ${CUDA_LIBRARIES} - ) - - # We need to set the linker language based on what the expected generated file - # would be. CUDA_C_OR_CXX is computed based on CUDA_HOST_COMPILATION_CPP. - set_target_properties(${cuda_target} - PROPERTIES - LINKER_LANGUAGE ${CUDA_C_OR_CXX} - ) - -endmacro() - - -############################################################################### -############################################################################### -# ADD EXECUTABLE -############################################################################### -############################################################################### -macro(CUDA_ADD_EXECUTABLE cuda_target) - - CUDA_ADD_CUDA_INCLUDE_ONCE() - - # Separate the sources from the options - CUDA_GET_SOURCES_AND_OPTIONS(_sources _cmake_options _options ${ARGN}) - # Create custom commands and targets for each file. - CUDA_WRAP_SRCS( ${cuda_target} OBJ _generated_files ${_sources} OPTIONS ${_options} ) - - # Compute the file name of the intermedate link file used for separable - # compilation. - CUDA_COMPUTE_SEPARABLE_COMPILATION_OBJECT_FILE_NAME(link_file ${cuda_target} "${${cuda_target}_SEPARABLE_COMPILATION_OBJECTS}") - - # Add the library. - add_executable(${cuda_target} ${_cmake_options} - ${_generated_files} - ${_sources} - ${link_file} - ) - - # Add a link phase for the separable compilation if it has been enabled. If - # it has been enabled then the ${cuda_target}_SEPARABLE_COMPILATION_OBJECTS - # variable will have been defined. - CUDA_LINK_SEPARABLE_COMPILATION_OBJECTS("${link_file}" ${cuda_target} "${_options}" "${${cuda_target}_SEPARABLE_COMPILATION_OBJECTS}") - - target_link_libraries(${cuda_target} - ${CUDA_LIBRARIES} - ) - - # We need to set the linker language based on what the expected generated file - # would be. CUDA_C_OR_CXX is computed based on CUDA_HOST_COMPILATION_CPP. - set_target_properties(${cuda_target} - PROPERTIES - LINKER_LANGUAGE ${CUDA_C_OR_CXX} - ) - -endmacro() - - -############################################################################### -############################################################################### -# (Internal) helper for manually added cuda source files with specific targets -############################################################################### -############################################################################### -macro(cuda_compile_base cuda_target format generated_files) - - # Separate the sources from the options - CUDA_GET_SOURCES_AND_OPTIONS(_sources _cmake_options _options ${ARGN}) - # Create custom commands and targets for each file. - CUDA_WRAP_SRCS( ${cuda_target} ${format} _generated_files ${_sources} ${_cmake_options} - OPTIONS ${_options} ) - - set( ${generated_files} ${_generated_files}) - -endmacro() - -############################################################################### -############################################################################### -# CUDA COMPILE -############################################################################### -############################################################################### -macro(CUDA_COMPILE generated_files) - cuda_compile_base(cuda_compile OBJ ${generated_files} ${ARGN}) -endmacro() - -############################################################################### -############################################################################### -# CUDA COMPILE PTX -############################################################################### -############################################################################### -macro(CUDA_COMPILE_PTX generated_files) - cuda_compile_base(cuda_compile_ptx PTX ${generated_files} ${ARGN}) -endmacro() - -############################################################################### -############################################################################### -# CUDA COMPILE FATBIN -############################################################################### -############################################################################### -macro(CUDA_COMPILE_FATBIN generated_files) - cuda_compile_base(cuda_compile_fatbin FATBIN ${generated_files} ${ARGN}) -endmacro() - -############################################################################### -############################################################################### -# CUDA COMPILE CUBIN -############################################################################### -############################################################################### -macro(CUDA_COMPILE_CUBIN generated_files) - cuda_compile_base(cuda_compile_cubin CUBIN ${generated_files} ${ARGN}) -endmacro() - - -############################################################################### -############################################################################### -# CUDA ADD CUFFT TO TARGET -############################################################################### -############################################################################### -macro(CUDA_ADD_CUFFT_TO_TARGET target) - if (CUDA_BUILD_EMULATION) - target_link_libraries(${target} ${CUDA_cufftemu_LIBRARY}) - else() - target_link_libraries(${target} ${CUDA_cufft_LIBRARY}) - endif() -endmacro() - -############################################################################### -############################################################################### -# CUDA ADD CUBLAS TO TARGET -############################################################################### -############################################################################### -macro(CUDA_ADD_CUBLAS_TO_TARGET target) - if (CUDA_BUILD_EMULATION) - target_link_libraries(${target} ${CUDA_cublasemu_LIBRARY}) - else() - target_link_libraries(${target} ${CUDA_cublas_LIBRARY}) - endif() -endmacro() - -############################################################################### -############################################################################### -# CUDA BUILD CLEAN TARGET -############################################################################### -############################################################################### -macro(CUDA_BUILD_CLEAN_TARGET) - # Call this after you add all your CUDA targets, and you will get a convience - # target. You should also make clean after running this target to get the - # build system to generate all the code again. - - set(cuda_clean_target_name clean_cuda_depends) - if (CMAKE_GENERATOR MATCHES "Visual Studio") - string(TOUPPER ${cuda_clean_target_name} cuda_clean_target_name) - endif() - add_custom_target(${cuda_clean_target_name} - COMMAND ${CMAKE_COMMAND} -E remove ${CUDA_ADDITIONAL_CLEAN_FILES}) - - # Clear out the variable, so the next time we configure it will be empty. - # This is useful so that the files won't persist in the list after targets - # have been removed. - set(CUDA_ADDITIONAL_CLEAN_FILES "" CACHE INTERNAL "List of intermediate files that are part of the cuda dependency scanning.") -endmacro() diff --git a/cmake/FindCUDA/make2cmake.cmake b/cmake/FindCUDA/make2cmake.cmake deleted file mode 100644 index c433fa8ed..000000000 --- a/cmake/FindCUDA/make2cmake.cmake +++ /dev/null @@ -1,92 +0,0 @@ -# James Bigler, NVIDIA Corp (nvidia.com - jbigler) -# Abe Stephens, SCI Institute -- http://www.sci.utah.edu/~abe/FindCuda.html -# -# Copyright (c) 2008 - 2009 NVIDIA Corporation. All rights reserved. -# -# Copyright (c) 2007-2009 -# Scientific Computing and Imaging Institute, University of Utah -# -# This code is licensed under the MIT License. See the FindCUDA.cmake script -# for the text of the license. - -# The MIT License -# -# License for the specific language governing rights and limitations under -# Permission is hereby granted, free of charge, to any person obtaining a -# copy of this software and associated documentation files (the "Software"), -# to deal in the Software without restriction, including without limitation -# the rights to use, copy, modify, merge, publish, distribute, sublicense, -# and/or sell copies of the Software, and to permit persons to whom the -# Software is furnished to do so, subject to the following conditions: -# -# The above copyright notice and this permission notice shall be included -# in all copies or substantial portions of the Software. -# -# THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS -# OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -# FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL -# THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -# LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING -# FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER -# DEALINGS IN THE SOFTWARE. -# - -####################################################################### -# This converts a file written in makefile syntax into one that can be included -# by CMake. - -file(READ ${input_file} depend_text) - -if (NOT "${depend_text}" STREQUAL "") - - # message("FOUND DEPENDS") - - string(REPLACE "\\ " " " depend_text ${depend_text}) - - # This works for the nvcc -M generated dependency files. - string(REGEX REPLACE "^.* : " "" depend_text ${depend_text}) - string(REGEX REPLACE "[ \\\\]*\n" ";" depend_text ${depend_text}) - - set(dependency_list "") - - foreach(file ${depend_text}) - - string(REGEX REPLACE "^ +" "" file ${file}) - - # OK, now if we had a UNC path, nvcc has a tendency to only output the first '/' - # instead of '//'. Here we will test to see if the file exists, if it doesn't then - # try to prepend another '/' to the path and test again. If it still fails remove the - # path. - - if(NOT EXISTS "${file}") - if (EXISTS "/${file}") - set(file "/${file}") - else() - message(WARNING " Removing non-existent dependency file: ${file}") - set(file "") - endif() - endif() - - if(NOT IS_DIRECTORY "${file}") - # If softlinks start to matter, we should change this to REALPATH. For now we need - # to flatten paths, because nvcc can generate stuff like /bin/../include instead of - # just /include. - get_filename_component(file_absolute "${file}" ABSOLUTE) - list(APPEND dependency_list "${file_absolute}") - endif() - - endforeach() - -else() - # message("FOUND NO DEPENDS") -endif() - -# Remove the duplicate entries and sort them. -list(REMOVE_DUPLICATES dependency_list) -list(SORT dependency_list) - -foreach(file ${dependency_list}) - set(cuda_nvcc_depend "${cuda_nvcc_depend} \"${file}\"\n") -endforeach() - -file(WRITE ${output_file} "# Generated by: make2cmake.cmake\nSET(CUDA_NVCC_DEPEND\n ${cuda_nvcc_depend})\n\n") diff --git a/cmake/FindCUDA/parse_cubin.cmake b/cmake/FindCUDA/parse_cubin.cmake deleted file mode 100644 index 626c8a2e4..000000000 --- a/cmake/FindCUDA/parse_cubin.cmake +++ /dev/null @@ -1,111 +0,0 @@ -# James Bigler, NVIDIA Corp (nvidia.com - jbigler) -# Abe Stephens, SCI Institute -- http://www.sci.utah.edu/~abe/FindCuda.html -# -# Copyright (c) 2008 - 2009 NVIDIA Corporation. All rights reserved. -# -# Copyright (c) 2007-2009 -# Scientific Computing and Imaging Institute, University of Utah -# -# This code is licensed under the MIT License. See the FindCUDA.cmake script -# for the text of the license. - -# The MIT License -# -# License for the specific language governing rights and limitations under -# Permission is hereby granted, free of charge, to any person obtaining a -# copy of this software and associated documentation files (the "Software"), -# to deal in the Software without restriction, including without limitation -# the rights to use, copy, modify, merge, publish, distribute, sublicense, -# and/or sell copies of the Software, and to permit persons to whom the -# Software is furnished to do so, subject to the following conditions: -# -# The above copyright notice and this permission notice shall be included -# in all copies or substantial portions of the Software. -# -# THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS -# OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -# FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL -# THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -# LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING -# FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER -# DEALINGS IN THE SOFTWARE. -# - -####################################################################### -# Parses a .cubin file produced by nvcc and reports statistics about the file. - - -file(READ ${input_file} file_text) - -if (NOT "${file_text}" STREQUAL "") - - string(REPLACE ";" "\\;" file_text ${file_text}) - string(REPLACE "\ncode" ";code" file_text ${file_text}) - - list(LENGTH file_text len) - - foreach(line ${file_text}) - - # Only look at "code { }" blocks. - if(line MATCHES "^code") - - # Break into individual lines. - string(REGEX REPLACE "\n" ";" line ${line}) - - foreach(entry ${line}) - - # Extract kernel names. - if (${entry} MATCHES "[^g]name = ([^ ]+)") - set(entry "${CMAKE_MATCH_1}") - - # Check to see if the kernel name starts with "_" - set(skip FALSE) - # if (${entry} MATCHES "^_") - # Skip the rest of this block. - # message("Skipping ${entry}") - # set(skip TRUE) - # else () - message("Kernel: ${entry}") - # endif () - - endif() - - # Skip the rest of the block if necessary - if(NOT skip) - - # Registers - if (${entry} MATCHES "reg([ ]+)=([ ]+)([^ ]+)") - set(entry "${CMAKE_MATCH_3}") - message("Registers: ${entry}") - endif() - - # Local memory - if (${entry} MATCHES "lmem([ ]+)=([ ]+)([^ ]+)") - set(entry "${CMAKE_MATCH_3}") - message("Local: ${entry}") - endif() - - # Shared memory - if (${entry} MATCHES "smem([ ]+)=([ ]+)([^ ]+)") - set(entry "${CMAKE_MATCH_3}") - message("Shared: ${entry}") - endif() - - if (${entry} MATCHES "^}") - message("") - endif() - - endif() - - - endforeach() - - endif() - - endforeach() - -else() - # message("FOUND NO DEPENDS") -endif() - - diff --git a/cmake/FindCUDA/run_nvcc.cmake b/cmake/FindCUDA/run_nvcc.cmake deleted file mode 100644 index abdd3079e..000000000 --- a/cmake/FindCUDA/run_nvcc.cmake +++ /dev/null @@ -1,288 +0,0 @@ -# James Bigler, NVIDIA Corp (nvidia.com - jbigler) -# -# Copyright (c) 2008 - 2009 NVIDIA Corporation. All rights reserved. -# -# This code is licensed under the MIT License. See the FindCUDA.cmake script -# for the text of the license. - -# The MIT License -# -# License for the specific language governing rights and limitations under -# Permission is hereby granted, free of charge, to any person obtaining a -# copy of this software and associated documentation files (the "Software"), -# to deal in the Software without restriction, including without limitation -# the rights to use, copy, modify, merge, publish, distribute, sublicense, -# and/or sell copies of the Software, and to permit persons to whom the -# Software is furnished to do so, subject to the following conditions: -# -# The above copyright notice and this permission notice shall be included -# in all copies or substantial portions of the Software. -# -# THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS -# OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, -# FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL -# THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER -# LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING -# FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER -# DEALINGS IN THE SOFTWARE. - - -########################################################################## -# This file runs the nvcc commands to produce the desired output file along with -# the dependency file needed by CMake to compute dependencies. In addition the -# file checks the output of each command and if the command fails it deletes the -# output files. - -# Input variables -# -# verbose:BOOL=<> OFF: Be as quiet as possible (default) -# ON : Describe each step -# -# build_configuration:STRING=<> Typically one of Debug, MinSizeRel, Release, or -# RelWithDebInfo, but it should match one of the -# entries in CUDA_HOST_FLAGS. This is the build -# configuration used when compiling the code. If -# blank or unspecified Debug is assumed as this is -# what CMake does. -# -# generated_file:STRING=<> File to generate. This argument must be passed in. -# -# generated_cubin_file:STRING=<> File to generate. This argument must be passed -# in if build_cubin is true. - -if(NOT generated_file) - message(FATAL_ERROR "You must specify generated_file on the command line") -endif() - -# Set these up as variables to make reading the generated file easier -set(CMAKE_COMMAND "@CMAKE_COMMAND@") # path -set(source_file "@source_file@") # path -set(NVCC_generated_dependency_file "@NVCC_generated_dependency_file@") # path -set(cmake_dependency_file "@cmake_dependency_file@") # path -set(CUDA_make2cmake "@CUDA_make2cmake@") # path -set(CUDA_parse_cubin "@CUDA_parse_cubin@") # path -set(build_cubin @build_cubin@) # bool -set(CUDA_HOST_COMPILER "@CUDA_HOST_COMPILER@") # path -# We won't actually use these variables for now, but we need to set this, in -# order to force this file to be run again if it changes. -set(generated_file_path "@generated_file_path@") # path -set(generated_file_internal "@generated_file@") # path -set(generated_cubin_file_internal "@generated_cubin_file@") # path - -set(CUDA_NVCC_EXECUTABLE "@CUDA_NVCC_EXECUTABLE@") # path -set(CUDA_NVCC_FLAGS @CUDA_NVCC_FLAGS@ ;; @CUDA_WRAP_OPTION_NVCC_FLAGS@) # list -@CUDA_NVCC_FLAGS_CONFIG@ -set(nvcc_flags @nvcc_flags@) # list -set(CUDA_NVCC_INCLUDE_ARGS "@CUDA_NVCC_INCLUDE_ARGS@") # list (needs to be in quotes to handle spaces properly). -set(format_flag "@format_flag@") # string - -if(build_cubin AND NOT generated_cubin_file) - message(FATAL_ERROR "You must specify generated_cubin_file on the command line") -endif() - -# This is the list of host compilation flags. It C or CXX should already have -# been chosen by FindCUDA.cmake. -@CUDA_HOST_FLAGS@ - -# Take the compiler flags and package them up to be sent to the compiler via -Xcompiler -set(nvcc_host_compiler_flags "") -# If we weren't given a build_configuration, use Debug. -if(NOT build_configuration) - set(build_configuration Debug) -endif() -string(TOUPPER "${build_configuration}" build_configuration) -#message("CUDA_NVCC_HOST_COMPILER_FLAGS = ${CUDA_NVCC_HOST_COMPILER_FLAGS}") -foreach(flag ${CMAKE_HOST_FLAGS} ${CMAKE_HOST_FLAGS_${build_configuration}}) - # Extra quotes are added around each flag to help nvcc parse out flags with spaces. - set(nvcc_host_compiler_flags "${nvcc_host_compiler_flags},\"${flag}\"") -endforeach() -if (nvcc_host_compiler_flags) - set(nvcc_host_compiler_flags "-Xcompiler" ${nvcc_host_compiler_flags}) -endif() -#message("nvcc_host_compiler_flags = \"${nvcc_host_compiler_flags}\"") -# Add the build specific configuration flags -list(APPEND CUDA_NVCC_FLAGS ${CUDA_NVCC_FLAGS_${build_configuration}}) - -# Any -ccbin existing in CUDA_NVCC_FLAGS gets highest priority -list( FIND CUDA_NVCC_FLAGS "-ccbin" ccbin_found0 ) -list( FIND CUDA_NVCC_FLAGS "--compiler-bindir" ccbin_found1 ) -if( ccbin_found0 LESS 0 AND ccbin_found1 LESS 0 AND CUDA_HOST_COMPILER ) - if (CUDA_HOST_COMPILER STREQUAL "$(VCInstallDir)bin" AND DEFINED CCBIN) - set(CCBIN -ccbin "${CCBIN}") - else() - set(CCBIN -ccbin "${CUDA_HOST_COMPILER}") - endif() -endif() - -# cuda_execute_process - Executes a command with optional command echo and status message. -# -# status - Status message to print if verbose is true -# command - COMMAND argument from the usual execute_process argument structure -# ARGN - Remaining arguments are the command with arguments -# -# CUDA_result - return value from running the command -# -# Make this a macro instead of a function, so that things like RESULT_VARIABLE -# and other return variables are present after executing the process. -macro(cuda_execute_process status command) - set(_command ${command}) - if(NOT "x${_command}" STREQUAL "xCOMMAND") - message(FATAL_ERROR "Malformed call to cuda_execute_process. Missing COMMAND as second argument. (command = ${command})") - endif() - if(verbose) - execute_process(COMMAND "${CMAKE_COMMAND}" -E echo -- ${status}) - # Now we need to build up our command string. We are accounting for quotes - # and spaces, anything else is left up to the user to fix if they want to - # copy and paste a runnable command line. - set(cuda_execute_process_string) - foreach(arg ${ARGN}) - # If there are quotes, excape them, so they come through. - string(REPLACE "\"" "\\\"" arg ${arg}) - # Args with spaces need quotes around them to get them to be parsed as a single argument. - if(arg MATCHES " ") - list(APPEND cuda_execute_process_string "\"${arg}\"") - else() - list(APPEND cuda_execute_process_string ${arg}) - endif() - endforeach() - # Echo the command - execute_process(COMMAND ${CMAKE_COMMAND} -E echo ${cuda_execute_process_string}) - endif() - # Run the command - execute_process(COMMAND ${ARGN} RESULT_VARIABLE CUDA_result ) -endmacro() - -# Delete the target file -cuda_execute_process( - "Removing ${generated_file}" - COMMAND "${CMAKE_COMMAND}" -E remove "${generated_file}" - ) - -# For CUDA 2.3 and below, -G -M doesn't work, so remove the -G flag -# for dependency generation and hope for the best. -set(depends_CUDA_NVCC_FLAGS "${CUDA_NVCC_FLAGS}") -set(CUDA_VERSION @CUDA_VERSION@) -if(CUDA_VERSION VERSION_LESS "3.0") - cmake_policy(PUSH) - # CMake policy 0007 NEW states that empty list elements are not - # ignored. I'm just setting it to avoid the warning that's printed. - cmake_policy(SET CMP0007 NEW) - # Note that this will remove all occurances of -G. - list(REMOVE_ITEM depends_CUDA_NVCC_FLAGS "-G") - cmake_policy(POP) -endif() - -# nvcc doesn't define __CUDACC__ for some reason when generating dependency files. This -# can cause incorrect dependencies when #including files based on this macro which is -# defined in the generating passes of nvcc invokation. We will go ahead and manually -# define this for now until a future version fixes this bug. -set(CUDACC_DEFINE -D__CUDACC__) - -# Generate the dependency file -cuda_execute_process( - "Generating dependency file: ${NVCC_generated_dependency_file}" - COMMAND "${CUDA_NVCC_EXECUTABLE}" - -M - ${CUDACC_DEFINE} - "${source_file}" - -o "${NVCC_generated_dependency_file}" - ${CCBIN} - ${nvcc_flags} - ${nvcc_host_compiler_flags} - ${depends_CUDA_NVCC_FLAGS} - -DNVCC - ${CUDA_NVCC_INCLUDE_ARGS} - ) - -if(CUDA_result) - message(FATAL_ERROR "Error generating ${generated_file}") -endif() - -# Generate the cmake readable dependency file to a temp file. Don't put the -# quotes just around the filenames for the input_file and output_file variables. -# CMake will pass the quotes through and not be able to find the file. -cuda_execute_process( - "Generating temporary cmake readable file: ${cmake_dependency_file}.tmp" - COMMAND "${CMAKE_COMMAND}" - -D "input_file:FILEPATH=${NVCC_generated_dependency_file}" - -D "output_file:FILEPATH=${cmake_dependency_file}.tmp" - -P "${CUDA_make2cmake}" - ) - -if(CUDA_result) - message(FATAL_ERROR "Error generating ${generated_file}") -endif() - -# Copy the file if it is different -cuda_execute_process( - "Copy if different ${cmake_dependency_file}.tmp to ${cmake_dependency_file}" - COMMAND "${CMAKE_COMMAND}" -E copy_if_different "${cmake_dependency_file}.tmp" "${cmake_dependency_file}" - ) - -if(CUDA_result) - message(FATAL_ERROR "Error generating ${generated_file}") -endif() - -# Delete the temporary file -cuda_execute_process( - "Removing ${cmake_dependency_file}.tmp and ${NVCC_generated_dependency_file}" - COMMAND "${CMAKE_COMMAND}" -E remove "${cmake_dependency_file}.tmp" "${NVCC_generated_dependency_file}" - ) - -if(CUDA_result) - message(FATAL_ERROR "Error generating ${generated_file}") -endif() - -# Generate the code -cuda_execute_process( - "Generating ${generated_file}" - COMMAND "${CUDA_NVCC_EXECUTABLE}" - "${source_file}" - ${format_flag} -o "${generated_file}" - ${CCBIN} - ${nvcc_flags} - ${nvcc_host_compiler_flags} - ${CUDA_NVCC_FLAGS} - -DNVCC - ${CUDA_NVCC_INCLUDE_ARGS} - ) - -if(CUDA_result) - # Since nvcc can sometimes leave half done files make sure that we delete the output file. - cuda_execute_process( - "Removing ${generated_file}" - COMMAND "${CMAKE_COMMAND}" -E remove "${generated_file}" - ) - message(FATAL_ERROR "Error generating file ${generated_file}") -else() - if(verbose) - message("Generated ${generated_file} successfully.") - endif() -endif() - -# Cubin resource report commands. -if( build_cubin ) - # Run with -cubin to produce resource usage report. - cuda_execute_process( - "Generating ${generated_cubin_file}" - COMMAND "${CUDA_NVCC_EXECUTABLE}" - "${source_file}" - ${CUDA_NVCC_FLAGS} - ${nvcc_flags} - ${CCBIN} - ${nvcc_host_compiler_flags} - -DNVCC - -cubin - -o "${generated_cubin_file}" - ${CUDA_NVCC_INCLUDE_ARGS} - ) - - # Execute the parser script. - cuda_execute_process( - "Executing the parser script" - COMMAND "${CMAKE_COMMAND}" - -D "input_file:STRING=${generated_cubin_file}" - -P "${CUDA_parse_cubin}" - ) - -endif() diff --git a/cmake/FindGLEW.cmake b/cmake/FindGLEW.cmake new file mode 100644 index 000000000..ac09d323c --- /dev/null +++ b/cmake/FindGLEW.cmake @@ -0,0 +1,96 @@ +# +# Find GLEW +# +# Try to find GLEW : The OpenGL Extension Wrangler Library. +# This module defines the following variables: +# - GLEW_INCLUDE_DIRS +# - GLEW_LIBRARIES +# - GLEW_DEFINITIONS +# - GLEW_FOUND +# +# The following variables can be set as arguments for the module. +# - GLEW_ROOT_DIR : Root library directory of GLEW +# - GLEW_USE_STATIC_LIBS : Specifies to use static version of GLEW library (Windows only) +# +# References: +# - https://github.com/progschj/OpenGL-Examples/blob/master/cmake_modules/FindGLEW.cmake +# - https://code.google.com/p/nvidia-texture-tools/source/browse/trunk/cmake/FindGLEW.cmake +# - Mitsuba Renderer +# + +# Additional modules +include(FindPackageHandleStandardArgs) + +# Dependencies +# GLEW depends on OpenGL +find_package(OpenGL) + +if (WIN32) + # Find include files + find_path( + GLEW_INCLUDE_DIR + NAMES GL/glew.h + PATHS + $ENV{PROGRAMFILES}/include + ${GLEW_ROOT_DIR}/include + DOC "The directory where GL/glew.h resides") + + # Use glew32s.lib for static library + # Define additional compiler definitions + if (GLEW_USE_STATIC_LIBS) + set(GLEW_LIBRARY_NAME glew32s) + set(GLEW_DEFINITIONS -DGLEW_STATIC) + else() + set(GLEW_LIBRARY_NAME glew32) + endif() + + # Find library files + find_library( + GLEW_LIBRARY + NAMES ${GLEW_LIBRARY_NAME} + PATHS + $ENV{PROGRAMFILES}/GLEW/lib + ${GLEW_ROOT_DIR}/lib + DOC "The GLEW library") + + unset(GLEW_LIBRARY_NAME) +else() + # Find include files + find_path( + GLEW_INCLUDE_DIR + NAMES GL/glew.h + PATHS + /usr/include + /usr/local/include + /sw/include + /opt/local/include + ${GLEW_ROOT_DIR}/include + DOC "The directory where GL/glew.h resides") + + # Find library files + # Try to use static libraries + find_library( + GLEW_LIBRARY + NAMES libGLEW.a GLEW + PATHS + /usr/lib64 + /usr/lib + /usr/local/lib64 + /usr/local/lib + /sw/lib + /opt/local/lib + ${GLEW_ROOT_DIR}/lib + DOC "The GLEW library") +endif() + +# Handle REQUIRD argument, define *_FOUND variable +find_package_handle_standard_args(GLEW DEFAULT_MSG GLEW_INCLUDE_DIR GLEW_LIBRARY) + +# Define GLEW_LIBRARIES and GLEW_INCLUDE_DIRS +if (GLEW_FOUND) + set(GLEW_LIBRARIES ${OPENGL_LIBRARIES} ${GLEW_LIBRARY}) + set(GLEW_INCLUDE_DIRS ${GLEW_INCLUDE_DIR}) +endif() + +# Hide some variables +mark_as_advanced(GLEW_INCLUDE_DIR GLEW_LIBRARY) diff --git a/cmake/FindGLFW.cmake b/cmake/FindGLFW.cmake new file mode 100644 index 000000000..9cf378642 --- /dev/null +++ b/cmake/FindGLFW.cmake @@ -0,0 +1,86 @@ +# +# Find GLFW +# +# Try to find GLFW library. +# This module defines the following variables: +# - GLFW_INCLUDE_DIRS +# - GLFW_LIBRARIES +# - GLFW_FOUND +# +# The following variables can be set as arguments for the module. +# - GLFW_ROOT_DIR : Root library directory of GLFW +# - GLFW_USE_STATIC_LIBS : Specifies to use static version of GLFW library (Windows only) +# +# References: +# - https://github.com/progschj/OpenGL-Examples/blob/master/cmake_modules/FindGLFW.cmake +# - https://bitbucket.org/Ident8/cegui-mk2-opengl3-renderer/src/befd47200265/cmake/FindGLFW.cmake +# + +# Additional modules +include(FindPackageHandleStandardArgs) + +if (WIN32) + # Find include files + find_path( + GLFW_INCLUDE_DIR + NAMES GLFW/glfw3.h + PATHS + $ENV{PROGRAMFILES}/include + ${GLFW_ROOT_DIR}/include + DOC "The directory where GLFW/glfw.h resides") + + # Use glfw3.lib for static library + if (GLFW_USE_STATIC_LIBS) + set(GLFW_LIBRARY_NAME glfw3) + else() + set(GLFW_LIBRARY_NAME glfw3dll) + endif() + + # Find library files + find_library( + GLFW_LIBRARY + NAMES ${GLFW_LIBRARY_NAME} + PATHS + $ENV{PROGRAMFILES}/lib + ${GLFW_ROOT_DIR}/lib) + + unset(GLFW_LIBRARY_NAME) +else() + # Find include files + find_path( + GLFW_INCLUDE_DIR + NAMES GLFW/glfw.h + PATHS + /usr/include + /usr/local/include + /sw/include + /opt/local/include + DOC "The directory where GL/glfw.h resides") + + # Find library files + # Try to use static libraries + find_library( + GLFW_LIBRARY + NAMES glfw3 + PATHS + /usr/lib64 + /usr/lib + /usr/local/lib64 + /usr/local/lib + /sw/lib + /opt/local/lib + ${GLFW_ROOT_DIR}/lib + DOC "The GLFW library") +endif() + +# Handle REQUIRD argument, define *_FOUND variable +find_package_handle_standard_args(GLFW DEFAULT_MSG GLFW_INCLUDE_DIR GLFW_LIBRARY) + +# Define GLFW_LIBRARIES and GLFW_INCLUDE_DIRS +if (GLFW_FOUND) + set(GLFW_LIBRARIES ${OPENGL_LIBRARIES} ${GLFW_LIBRARY}) + set(GLFW_INCLUDE_DIRS ${GLFW_INCLUDE_DIR}) +endif() + +# Hide some variables +mark_as_advanced(GLFW_INCLUDE_DIR GLFW_LIBRARY) diff --git a/cmake/FindGLM.cmake b/cmake/FindGLM.cmake new file mode 100644 index 000000000..55086f641 --- /dev/null +++ b/cmake/FindGLM.cmake @@ -0,0 +1,52 @@ +# +# Find GLM +# +# Try to find GLM : OpenGL Mathematics. +# This module defines +# - GLM_INCLUDE_DIRS +# - GLM_FOUND +# +# The following variables can be set as arguments for the module. +# - GLM_ROOT_DIR : Root library directory of GLM +# +# References: +# - https://github.com/Groovounet/glm/blob/master/util/FindGLM.cmake +# - https://bitbucket.org/alfonse/gltut/src/28636298c1c0/glm-0.9.0.7/FindGLM.cmake +# + +# Additional modules +include(FindPackageHandleStandardArgs) + +if (WIN32) + # Find include files + find_path( + GLM_INCLUDE_DIR + NAMES glm/glm.hpp + PATHS + $ENV{PROGRAMFILES}/include + ${GLM_ROOT_DIR}/include + DOC "The directory where glm/glm.hpp resides") +else() + # Find include files + find_path( + GLM_INCLUDE_DIR + NAMES glm/glm.hpp + PATHS + /usr/include + /usr/local/include + /sw/include + /opt/local/include + ${GLM_ROOT_DIR}/include + DOC "The directory where glm/glm.hpp resides") +endif() + +# Handle REQUIRD argument, define *_FOUND variable +find_package_handle_standard_args(GLM DEFAULT_MSG GLM_INCLUDE_DIR) + +# Define GLM_INCLUDE_DIRS +if (GLM_FOUND) + set(GLM_INCLUDE_DIRS ${GLM_INCLUDE_DIR}) +endif() + +# Hide some variables +mark_as_advanced(GLM_INCLUDE_DIR) diff --git a/cmake/FindPackageHandleStandardArgs.cmake b/cmake/FindPackageHandleStandardArgs.cmake deleted file mode 100644 index 2de1fb373..000000000 --- a/cmake/FindPackageHandleStandardArgs.cmake +++ /dev/null @@ -1,382 +0,0 @@ -#.rst: -# FindPackageHandleStandardArgs -# ----------------------------- -# -# -# -# FIND_PACKAGE_HANDLE_STANDARD_ARGS( ... ) -# -# This function is intended to be used in FindXXX.cmake modules files. -# It handles the REQUIRED, QUIET and version-related arguments to -# find_package(). It also sets the _FOUND variable. The -# package is considered found if all variables ... listed contain -# valid results, e.g. valid filepaths. -# -# There are two modes of this function. The first argument in both -# modes is the name of the Find-module where it is called (in original -# casing). -# -# The first simple mode looks like this: -# -# :: -# -# FIND_PACKAGE_HANDLE_STANDARD_ARGS( -# (DEFAULT_MSG|"Custom failure message") ... ) -# -# If the variables to are all valid, then -# _FOUND will be set to TRUE. If DEFAULT_MSG is given -# as second argument, then the function will generate itself useful -# success and error messages. You can also supply a custom error -# message for the failure case. This is not recommended. -# -# The second mode is more powerful and also supports version checking: -# -# :: -# -# FIND_PACKAGE_HANDLE_STANDARD_ARGS(NAME -# [FOUND_VAR ] -# [REQUIRED_VARS ...] -# [VERSION_VAR ] -# [HANDLE_COMPONENTS] -# [CONFIG_MODE] -# [FAIL_MESSAGE "Custom failure message"] ) -# -# In this mode, the name of the result-variable can be set either to -# either _FOUND or _FOUND using the -# FOUND_VAR option. Other names for the result-variable are not -# allowed. So for a Find-module named FindFooBar.cmake, the two -# possible names are FooBar_FOUND and FOOBAR_FOUND. It is recommended -# to use the original case version. If the FOUND_VAR option is not -# used, the default is _FOUND. -# -# As in the simple mode, if through are all valid, -# _FOUND will be set to TRUE. After REQUIRED_VARS the -# variables which are required for this package are listed. Following -# VERSION_VAR the name of the variable can be specified which holds the -# version of the package which has been found. If this is done, this -# version will be checked against the (potentially) specified required -# version used in the find_package() call. The EXACT keyword is also -# handled. The default messages include information about the required -# version and the version which has been actually found, both if the -# version is ok or not. If the package supports components, use the -# HANDLE_COMPONENTS option to enable handling them. In this case, -# find_package_handle_standard_args() will report which components have -# been found and which are missing, and the _FOUND variable -# will be set to FALSE if any of the required components (i.e. not the -# ones listed after OPTIONAL_COMPONENTS) are missing. Use the option -# CONFIG_MODE if your FindXXX.cmake module is a wrapper for a -# find_package(... NO_MODULE) call. In this case VERSION_VAR will be -# set to _VERSION and the macro will automatically check whether -# the Config module was found. Via FAIL_MESSAGE a custom failure -# message can be specified, if this is not used, the default message -# will be displayed. -# -# Example for mode 1: -# -# :: -# -# find_package_handle_standard_args(LibXml2 DEFAULT_MSG -# LIBXML2_LIBRARY LIBXML2_INCLUDE_DIR) -# -# -# -# LibXml2 is considered to be found, if both LIBXML2_LIBRARY and -# LIBXML2_INCLUDE_DIR are valid. Then also LIBXML2_FOUND is set to -# TRUE. If it is not found and REQUIRED was used, it fails with -# FATAL_ERROR, independent whether QUIET was used or not. If it is -# found, success will be reported, including the content of . On -# repeated Cmake runs, the same message won't be printed again. -# -# Example for mode 2: -# -# :: -# -# find_package_handle_standard_args(LibXslt -# FOUND_VAR LibXslt_FOUND -# REQUIRED_VARS LibXslt_LIBRARIES LibXslt_INCLUDE_DIRS -# VERSION_VAR LibXslt_VERSION_STRING) -# -# In this case, LibXslt is considered to be found if the variable(s) -# listed after REQUIRED_VAR are all valid, i.e. LibXslt_LIBRARIES and -# LibXslt_INCLUDE_DIRS in this case. The result will then be stored in -# LibXslt_FOUND . Also the version of LibXslt will be checked by using -# the version contained in LibXslt_VERSION_STRING. Since no -# FAIL_MESSAGE is given, the default messages will be printed. -# -# Another example for mode 2: -# -# :: -# -# find_package(Automoc4 QUIET NO_MODULE HINTS /opt/automoc4) -# find_package_handle_standard_args(Automoc4 CONFIG_MODE) -# -# In this case, FindAutmoc4.cmake wraps a call to find_package(Automoc4 -# NO_MODULE) and adds an additional search directory for automoc4. Here -# the result will be stored in AUTOMOC4_FOUND. The following -# FIND_PACKAGE_HANDLE_STANDARD_ARGS() call produces a proper -# success/error message. - -#============================================================================= -# Copyright 2007-2009 Kitware, Inc. -# -# Distributed under the OSI-approved BSD License (the "License"); -# see accompanying file Copyright.txt for details. -# -# This software is distributed WITHOUT ANY WARRANTY; without even the -# implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. -# See the License for more information. -#============================================================================= -# (To distribute this file outside of CMake, substitute the full -# License text for the above reference.) - -include(${CMAKE_CURRENT_LIST_DIR}/FindPackageMessage.cmake) -include(${CMAKE_CURRENT_LIST_DIR}/CMakeParseArguments.cmake) - -# internal helper macro -macro(_FPHSA_FAILURE_MESSAGE _msg) - if (${_NAME}_FIND_REQUIRED) - message(FATAL_ERROR "${_msg}") - else () - if (NOT ${_NAME}_FIND_QUIETLY) - message(STATUS "${_msg}") - endif () - endif () -endmacro() - - -# internal helper macro to generate the failure message when used in CONFIG_MODE: -macro(_FPHSA_HANDLE_FAILURE_CONFIG_MODE) - # _CONFIG is set, but FOUND is false, this means that some other of the REQUIRED_VARS was not found: - if(${_NAME}_CONFIG) - _FPHSA_FAILURE_MESSAGE("${FPHSA_FAIL_MESSAGE}: missing: ${MISSING_VARS} (found ${${_NAME}_CONFIG} ${VERSION_MSG})") - else() - # If _CONSIDERED_CONFIGS is set, the config-file has been found, but no suitable version. - # List them all in the error message: - if(${_NAME}_CONSIDERED_CONFIGS) - set(configsText "") - list(LENGTH ${_NAME}_CONSIDERED_CONFIGS configsCount) - math(EXPR configsCount "${configsCount} - 1") - foreach(currentConfigIndex RANGE ${configsCount}) - list(GET ${_NAME}_CONSIDERED_CONFIGS ${currentConfigIndex} filename) - list(GET ${_NAME}_CONSIDERED_VERSIONS ${currentConfigIndex} version) - set(configsText "${configsText} ${filename} (version ${version})\n") - endforeach() - if (${_NAME}_NOT_FOUND_MESSAGE) - set(configsText "${configsText} Reason given by package: ${${_NAME}_NOT_FOUND_MESSAGE}\n") - endif() - _FPHSA_FAILURE_MESSAGE("${FPHSA_FAIL_MESSAGE} ${VERSION_MSG}, checked the following files:\n${configsText}") - - else() - # Simple case: No Config-file was found at all: - _FPHSA_FAILURE_MESSAGE("${FPHSA_FAIL_MESSAGE}: found neither ${_NAME}Config.cmake nor ${_NAME_LOWER}-config.cmake ${VERSION_MSG}") - endif() - endif() -endmacro() - - -function(FIND_PACKAGE_HANDLE_STANDARD_ARGS _NAME _FIRST_ARG) - -# set up the arguments for CMAKE_PARSE_ARGUMENTS and check whether we are in -# new extended or in the "old" mode: - set(options CONFIG_MODE HANDLE_COMPONENTS) - set(oneValueArgs FAIL_MESSAGE VERSION_VAR FOUND_VAR) - set(multiValueArgs REQUIRED_VARS) - set(_KEYWORDS_FOR_EXTENDED_MODE ${options} ${oneValueArgs} ${multiValueArgs} ) - list(FIND _KEYWORDS_FOR_EXTENDED_MODE "${_FIRST_ARG}" INDEX) - - if(${INDEX} EQUAL -1) - set(FPHSA_FAIL_MESSAGE ${_FIRST_ARG}) - set(FPHSA_REQUIRED_VARS ${ARGN}) - set(FPHSA_VERSION_VAR) - else() - - CMAKE_PARSE_ARGUMENTS(FPHSA "${options}" "${oneValueArgs}" "${multiValueArgs}" ${_FIRST_ARG} ${ARGN}) - - if(FPHSA_UNPARSED_ARGUMENTS) - message(FATAL_ERROR "Unknown keywords given to FIND_PACKAGE_HANDLE_STANDARD_ARGS(): \"${FPHSA_UNPARSED_ARGUMENTS}\"") - endif() - - if(NOT FPHSA_FAIL_MESSAGE) - set(FPHSA_FAIL_MESSAGE "DEFAULT_MSG") - endif() - endif() - -# now that we collected all arguments, process them - - if("x${FPHSA_FAIL_MESSAGE}" STREQUAL "xDEFAULT_MSG") - set(FPHSA_FAIL_MESSAGE "Could NOT find ${_NAME}") - endif() - - # In config-mode, we rely on the variable _CONFIG, which is set by find_package() - # when it successfully found the config-file, including version checking: - if(FPHSA_CONFIG_MODE) - list(INSERT FPHSA_REQUIRED_VARS 0 ${_NAME}_CONFIG) - list(REMOVE_DUPLICATES FPHSA_REQUIRED_VARS) - set(FPHSA_VERSION_VAR ${_NAME}_VERSION) - endif() - - if(NOT FPHSA_REQUIRED_VARS) - message(FATAL_ERROR "No REQUIRED_VARS specified for FIND_PACKAGE_HANDLE_STANDARD_ARGS()") - endif() - - list(GET FPHSA_REQUIRED_VARS 0 _FIRST_REQUIRED_VAR) - - string(TOUPPER ${_NAME} _NAME_UPPER) - string(TOLOWER ${_NAME} _NAME_LOWER) - - if(FPHSA_FOUND_VAR) - if(FPHSA_FOUND_VAR MATCHES "^${_NAME}_FOUND$" OR FPHSA_FOUND_VAR MATCHES "^${_NAME_UPPER}_FOUND$") - set(_FOUND_VAR ${FPHSA_FOUND_VAR}) - else() - message(FATAL_ERROR "The argument for FOUND_VAR is \"${FPHSA_FOUND_VAR}\", but only \"${_NAME}_FOUND\" and \"${_NAME_UPPER}_FOUND\" are valid names.") - endif() - else() - set(_FOUND_VAR ${_NAME_UPPER}_FOUND) - endif() - - # collect all variables which were not found, so they can be printed, so the - # user knows better what went wrong (#6375) - set(MISSING_VARS "") - set(DETAILS "") - # check if all passed variables are valid - unset(${_FOUND_VAR}) - foreach(_CURRENT_VAR ${FPHSA_REQUIRED_VARS}) - if(NOT ${_CURRENT_VAR}) - set(${_FOUND_VAR} FALSE) - set(MISSING_VARS "${MISSING_VARS} ${_CURRENT_VAR}") - else() - set(DETAILS "${DETAILS}[${${_CURRENT_VAR}}]") - endif() - endforeach() - if(NOT "${${_FOUND_VAR}}" STREQUAL "FALSE") - set(${_FOUND_VAR} TRUE) - endif() - - # component handling - unset(FOUND_COMPONENTS_MSG) - unset(MISSING_COMPONENTS_MSG) - - if(FPHSA_HANDLE_COMPONENTS) - foreach(comp ${${_NAME}_FIND_COMPONENTS}) - if(${_NAME}_${comp}_FOUND) - - if(NOT DEFINED FOUND_COMPONENTS_MSG) - set(FOUND_COMPONENTS_MSG "found components: ") - endif() - set(FOUND_COMPONENTS_MSG "${FOUND_COMPONENTS_MSG} ${comp}") - - else() - - if(NOT DEFINED MISSING_COMPONENTS_MSG) - set(MISSING_COMPONENTS_MSG "missing components: ") - endif() - set(MISSING_COMPONENTS_MSG "${MISSING_COMPONENTS_MSG} ${comp}") - - if(${_NAME}_FIND_REQUIRED_${comp}) - set(${_FOUND_VAR} FALSE) - set(MISSING_VARS "${MISSING_VARS} ${comp}") - endif() - - endif() - endforeach() - set(COMPONENT_MSG "${FOUND_COMPONENTS_MSG} ${MISSING_COMPONENTS_MSG}") - set(DETAILS "${DETAILS}[c${COMPONENT_MSG}]") - endif() - - # version handling: - set(VERSION_MSG "") - set(VERSION_OK TRUE) - set(VERSION ${${FPHSA_VERSION_VAR}}) - - # check with DEFINED here as the requested or found version may be "0" - if (DEFINED ${_NAME}_FIND_VERSION) - if(DEFINED ${FPHSA_VERSION_VAR}) - - if(${_NAME}_FIND_VERSION_EXACT) # exact version required - # count the dots in the version string - string(REGEX REPLACE "[^.]" "" _VERSION_DOTS "${VERSION}") - # add one dot because there is one dot more than there are components - string(LENGTH "${_VERSION_DOTS}." _VERSION_DOTS) - if (_VERSION_DOTS GREATER ${_NAME}_FIND_VERSION_COUNT) - # Because of the C++ implementation of find_package() ${_NAME}_FIND_VERSION_COUNT - # is at most 4 here. Therefore a simple lookup table is used. - if (${_NAME}_FIND_VERSION_COUNT EQUAL 1) - set(_VERSION_REGEX "[^.]*") - elseif (${_NAME}_FIND_VERSION_COUNT EQUAL 2) - set(_VERSION_REGEX "[^.]*\\.[^.]*") - elseif (${_NAME}_FIND_VERSION_COUNT EQUAL 3) - set(_VERSION_REGEX "[^.]*\\.[^.]*\\.[^.]*") - else () - set(_VERSION_REGEX "[^.]*\\.[^.]*\\.[^.]*\\.[^.]*") - endif () - string(REGEX REPLACE "^(${_VERSION_REGEX})\\..*" "\\1" _VERSION_HEAD "${VERSION}") - unset(_VERSION_REGEX) - if (NOT ${_NAME}_FIND_VERSION VERSION_EQUAL _VERSION_HEAD) - set(VERSION_MSG "Found unsuitable version \"${VERSION}\", but required is exact version \"${${_NAME}_FIND_VERSION}\"") - set(VERSION_OK FALSE) - else () - set(VERSION_MSG "(found suitable exact version \"${VERSION}\")") - endif () - unset(_VERSION_HEAD) - else () - if (NOT ${_NAME}_FIND_VERSION VERSION_EQUAL VERSION) - set(VERSION_MSG "Found unsuitable version \"${VERSION}\", but required is exact version \"${${_NAME}_FIND_VERSION}\"") - set(VERSION_OK FALSE) - else () - set(VERSION_MSG "(found suitable exact version \"${VERSION}\")") - endif () - endif () - unset(_VERSION_DOTS) - - else() # minimum version specified: - if (${_NAME}_FIND_VERSION VERSION_GREATER VERSION) - set(VERSION_MSG "Found unsuitable version \"${VERSION}\", but required is at least \"${${_NAME}_FIND_VERSION}\"") - set(VERSION_OK FALSE) - else () - set(VERSION_MSG "(found suitable version \"${VERSION}\", minimum required is \"${${_NAME}_FIND_VERSION}\")") - endif () - endif() - - else() - - # if the package was not found, but a version was given, add that to the output: - if(${_NAME}_FIND_VERSION_EXACT) - set(VERSION_MSG "(Required is exact version \"${${_NAME}_FIND_VERSION}\")") - else() - set(VERSION_MSG "(Required is at least version \"${${_NAME}_FIND_VERSION}\")") - endif() - - endif() - else () - if(VERSION) - set(VERSION_MSG "(found version \"${VERSION}\")") - endif() - endif () - - if(VERSION_OK) - set(DETAILS "${DETAILS}[v${VERSION}(${${_NAME}_FIND_VERSION})]") - else() - set(${_FOUND_VAR} FALSE) - endif() - - - # print the result: - if (${_FOUND_VAR}) - FIND_PACKAGE_MESSAGE(${_NAME} "Found ${_NAME}: ${${_FIRST_REQUIRED_VAR}} ${VERSION_MSG} ${COMPONENT_MSG}" "${DETAILS}") - else () - - if(FPHSA_CONFIG_MODE) - _FPHSA_HANDLE_FAILURE_CONFIG_MODE() - else() - if(NOT VERSION_OK) - _FPHSA_FAILURE_MESSAGE("${FPHSA_FAIL_MESSAGE}: ${VERSION_MSG} (found ${${_FIRST_REQUIRED_VAR}})") - else() - _FPHSA_FAILURE_MESSAGE("${FPHSA_FAIL_MESSAGE} (missing: ${MISSING_VARS}) ${VERSION_MSG}") - endif() - endif() - - endif () - - set(${_FOUND_VAR} ${${_FOUND_VAR}} PARENT_SCOPE) - -endfunction() diff --git a/cmake/FindPackageMessage.cmake b/cmake/FindPackageMessage.cmake deleted file mode 100644 index a0349d3db..000000000 --- a/cmake/FindPackageMessage.cmake +++ /dev/null @@ -1,57 +0,0 @@ -#.rst: -# FindPackageMessage -# ------------------ -# -# -# -# FIND_PACKAGE_MESSAGE( "message for user" "find result details") -# -# This macro is intended to be used in FindXXX.cmake modules files. It -# will print a message once for each unique find result. This is useful -# for telling the user where a package was found. The first argument -# specifies the name (XXX) of the package. The second argument -# specifies the message to display. The third argument lists details -# about the find result so that if they change the message will be -# displayed again. The macro also obeys the QUIET argument to the -# find_package command. -# -# Example: -# -# :: -# -# if(X11_FOUND) -# FIND_PACKAGE_MESSAGE(X11 "Found X11: ${X11_X11_LIB}" -# "[${X11_X11_LIB}][${X11_INCLUDE_DIR}]") -# else() -# ... -# endif() - -#============================================================================= -# Copyright 2008-2009 Kitware, Inc. -# -# Distributed under the OSI-approved BSD License (the "License"); -# see accompanying file Copyright.txt for details. -# -# This software is distributed WITHOUT ANY WARRANTY; without even the -# implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. -# See the License for more information. -#============================================================================= -# (To distribute this file outside of CMake, substitute the full -# License text for the above reference.) - -function(FIND_PACKAGE_MESSAGE pkg msg details) - # Avoid printing a message repeatedly for the same find result. - if(NOT ${pkg}_FIND_QUIETLY) - string(REPLACE "\n" "" details "${details}") - set(DETAILS_VAR FIND_PACKAGE_MESSAGE_DETAILS_${pkg}) - if(NOT "${details}" STREQUAL "${${DETAILS_VAR}}") - # The message has not yet been printed. - message(STATUS "${msg}") - - # Save the find details in the cache to avoid printing the same - # message again. - set("${DETAILS_VAR}" "${details}" - CACHE INTERNAL "Details about finding ${pkg}") - endif() - endif() -endfunction() diff --git a/cornell.2026-04-03_23-37-16z.5000samp.png b/cornell.2026-04-03_23-37-16z.5000samp.png new file mode 100644 index 000000000..058277546 Binary files /dev/null and b/cornell.2026-04-03_23-37-16z.5000samp.png differ diff --git a/cornell.2026-04-04_00-11-30z.5000samp.png b/cornell.2026-04-04_00-11-30z.5000samp.png new file mode 100644 index 000000000..7832385f6 Binary files /dev/null and b/cornell.2026-04-04_00-11-30z.5000samp.png differ diff --git a/cornell.2026-04-04_00-33-27z.5000samp.png b/cornell.2026-04-04_00-33-27z.5000samp.png new file mode 100644 index 000000000..186af17b6 Binary files /dev/null and b/cornell.2026-04-04_00-33-27z.5000samp.png differ diff --git a/external/include/GL/Copying.txt b/external/include/GL/Copying.txt deleted file mode 100644 index fc36ad990..000000000 --- a/external/include/GL/Copying.txt +++ /dev/null @@ -1,27 +0,0 @@ - - Freeglut Copyright - ------------------ - - Freeglut code without an explicit copyright is covered by the following - copyright: - - Copyright (c) 1999-2000 Pawel W. Olszta. All Rights Reserved. - Permission is hereby granted, free of charge, to any person obtaining a copy - of this software and associated documentation files (the "Software"), to deal - in the Software without restriction, including without limitation the rights - to use, copy, modify, merge, publish, distribute, sublicense, and/or sell - copies or substantial portions of the Software. - - The above copyright notice and this permission notice shall be included in - all copies or substantial portions of the Software. - - THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR - IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, - FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL - PAWEL W. OLSZTA BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER - IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN - CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. - - Except as contained in this notice, the name of Pawel W. Olszta shall not be - used in advertising or otherwise to promote the sale, use or other dealings - in this Software without prior written authorization from Pawel W. Olszta. diff --git a/external/include/GL/Readme.txt b/external/include/GL/Readme.txt deleted file mode 100644 index f45416915..000000000 --- a/external/include/GL/Readme.txt +++ /dev/null @@ -1,101 +0,0 @@ -freeglut 2.8.1-1.mp for MSVC - -This package contains freeglut import libraries, headers, and Windows DLLs. -These allow 32 and 64 bit GLUT applications to be compiled on Windows using -Microsoft Visual C++. - -For more information on freeglut, visit http://freeglut.sourceforge.net/. - - -Installation - -Create a folder on your PC which is readable by all users, for example -“C:\Program Files\Common Files\MSVC\freeglut\” on a typical Windows system. Copy -the “lib\” and “include\” folders from this zip archive to that location. - -The appropriate freeglut DLL can either be placed in the same folder as your -application, or can be installed in a system-wide folder which appears in your -%PATH% environment variable. Be careful not to mix the 32 bit DLL up with the 64 -bit DLL, as they are not interchangeable. - - -Compiling 32 bit Applications - -To create a 32 bit freeglut application, create a new Win32 C++ project in MSVC. -From the “Win32 Application Wizard”, choose a “Windows application”, check the -“Empty project” box, and submit. - -You’ll now need to configure the compiler and linker settings. Open up the -project properties, and select “All Configurations” (this is necessary to ensure -our changes are applied for both debug and release builds). Open up the -“general” section under “C/C++”, and configure the “include\” folder you created -above as an “Additional Include Directory”. If you have more than one GLUT -package which contains a “glut.h” file, it’s important to ensure that the -freeglut include folder appears above all other GLUT include folders. - -Now open up the “general” section under “Linker”, and configure the “lib\” -folder you created above as an “Additional Library Directory”. A freeglut -application depends on the import libraries “freeglut.lib” and “opengl32.lib”, -which can be configured under the “Input” section. However, it shouldn’t be -necessary to explicitly state these dependencies, since the freeglut headers -handle this for you. Now open the “Advanced” section, and enter “mainCRTStartup” -as the “Entry Point” for your application. This is necessary because GLUT -applications use “main” as the application entry point, not “WinMain”—without it -you’ll get an undefined reference when you try to link your application. - -That’s all of your project properties configured, so you can now add source -files to your project and build the application. If you want your application to -be compatible with GLUT, you should “#include ”. If you want to use -freeglut specific extensions, you should “#include ” instead. - -Don’t forget to either include the freeglut DLL when distributing applications, -or provide your users with some method of obtaining it if they don’t already -have it! - - -Compiling 64 bit Applications - -Building 64 bit applications is almost identical to building 32 bit applications. -When you use the configuration manager to add the x64 platform, it’s easiest to -copy the settings from the Win32 platform. If you do so, it’s then only necessary -to change the “Additional Library Directories” configuration so that it -references the directory containing the 64 bit import library rather -than the 32 bit one. - - -Problems? - -If you have problems using this package (compiler / linker errors etc.), please -check that you have followed all of the steps in this readme file correctly. -Almost all of the problems which are reported with these packages are due to -missing a step or not doing it correctly, for example trying to build a 32 bit -app against the 64 bit import library. If you have followed all of the steps -correctly but your application still fails to build, try building a very simple -but functional program (the example at -http://www.transmissionzero.co.uk/computing/using-glut-with-mingw/ works fine -with MSVC). A lot of people try to build very complex applications after -installing these packages, and often the error is with the application code or -other library dependencies rather than freeglut. - -If you still can’t get it working after trying to compile a simple application, -then please get in touch via http://www.transmissionzero.co.uk/contact/, -providing as much detail as you can. Please don’t complain to the freeglut guys -unless you’re sure it’s a freeglut bug, and have reproduced the issue after -compiling freeglut from the latest SVN version—if that’s still the case, I’m sure -they would appreciate a bug report or a patch. - - -Changelog - -2013–05–11: Release 2.8.1-1.mp - - • First 2.8.1 MSVC release. I’ve built the package using Visual Studio 2012, - and the only change I’ve made is to the DLL version resource—I’ve changed - the description so that my MinGW and MSVC builds are distinguishable from - each other (and other builds) using Windows Explorer. - - -Martin Payne -2013–05–11 - -http://www.transmissionzero.co.uk/ diff --git a/external/include/GL/eglew.h b/external/include/GL/eglew.h new file mode 100644 index 000000000..467014794 --- /dev/null +++ b/external/include/GL/eglew.h @@ -0,0 +1,2618 @@ +/* +** The OpenGL Extension Wrangler Library +** Copyright (C) 2008-2017, Nigel Stewart +** Copyright (C) 2002-2008, Milan Ikits +** Copyright (C) 2002-2008, Marcelo E. Magallon +** Copyright (C) 2002, Lev Povalahev +** All rights reserved. +** +** Redistribution and use in source and binary forms, with or without +** modification, are permitted provided that the following conditions are met: +** +** * Redistributions of source code must retain the above copyright notice, +** this list of conditions and the following disclaimer. +** * Redistributions in binary form must reproduce the above copyright notice, +** this list of conditions and the following disclaimer in the documentation +** and/or other materials provided with the distribution. +** * The name of the author may be used to endorse or promote products +** derived from this software without specific prior written permission. +** +** THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" +** AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE +** IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE +** ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE +** LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR +** CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF +** SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS +** INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN +** CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) +** ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF +** THE POSSIBILITY OF SUCH DAMAGE. +*/ + +/* + * Mesa 3-D graphics library + * Version: 7.0 + * + * Copyright (C) 1999-2007 Brian Paul All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the "Software"), + * to deal in the Software without restriction, including without limitation + * the rights to use, copy, modify, merge, publish, distribute, sublicense, + * and/or sell copies of the Software, and to permit persons to whom the + * Software is furnished to do so, subject to the following conditions: + * + * The above copyright notice and this permission notice shall be included + * in all copies or substantial portions of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, + * FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL + * BRIAN PAUL BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN + * AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN + * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + */ + +/* +** Copyright (c) 2007 The Khronos Group Inc. +** +** Permission is hereby granted, free of charge, to any person obtaining a +** copy of this software and/or associated documentation files (the +** "Materials"), to deal in the Materials without restriction, including +** without limitation the rights to use, copy, modify, merge, publish, +** distribute, sublicense, and/or sell copies of the Materials, and to +** permit persons to whom the Materials are furnished to do so, subject to +** the following conditions: +** +** The above copyright notice and this permission notice shall be included +** in all copies or substantial portions of the Materials. +** +** THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, +** EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF +** MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. +** IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY +** CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, +** TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE +** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS. +*/ + +#ifndef __eglew_h__ +#define __eglew_h__ +#define __EGLEW_H__ + +#ifdef __eglext_h_ +#error eglext.h included before eglew.h +#endif + +#if defined(__egl_h_) +#error egl.h included before eglew.h +#endif + +#define __eglext_h_ + +#define __egl_h_ + +#ifndef EGLAPIENTRY +#define EGLAPIENTRY +#endif +#ifndef EGLAPI +#define EGLAPI extern +#endif + +/* EGL Types */ +#include + +#include +#include + +#include + +#ifdef __cplusplus +extern "C" { +#endif + +typedef int32_t EGLint; + +typedef unsigned int EGLBoolean; +typedef void *EGLDisplay; +typedef void *EGLConfig; +typedef void *EGLSurface; +typedef void *EGLContext; +typedef void (*__eglMustCastToProperFunctionPointerType)(void); + +typedef unsigned int EGLenum; +typedef void *EGLClientBuffer; + +typedef void *EGLSync; +typedef intptr_t EGLAttrib; +typedef khronos_utime_nanoseconds_t EGLTime; +typedef void *EGLImage; + +typedef void *EGLSyncKHR; +typedef intptr_t EGLAttribKHR; +typedef void *EGLLabelKHR; +typedef void *EGLObjectKHR; +typedef void (EGLAPIENTRY *EGLDEBUGPROCKHR)(EGLenum error,const char *command,EGLint messageType,EGLLabelKHR threadLabel,EGLLabelKHR objectLabel,const char* message); +typedef khronos_utime_nanoseconds_t EGLTimeKHR; +typedef void *EGLImageKHR; +typedef void *EGLStreamKHR; +typedef khronos_uint64_t EGLuint64KHR; +typedef int EGLNativeFileDescriptorKHR; +typedef khronos_ssize_t EGLsizeiANDROID; +typedef void (*EGLSetBlobFuncANDROID) (const void *key, EGLsizeiANDROID keySize, const void *value, EGLsizeiANDROID valueSize); +typedef EGLsizeiANDROID (*EGLGetBlobFuncANDROID) (const void *key, EGLsizeiANDROID keySize, void *value, EGLsizeiANDROID valueSize); +typedef void *EGLDeviceEXT; +typedef void *EGLOutputLayerEXT; +typedef void *EGLOutputPortEXT; +typedef void *EGLSyncNV; +typedef khronos_utime_nanoseconds_t EGLTimeNV; +typedef khronos_utime_nanoseconds_t EGLuint64NV; +typedef khronos_stime_nanoseconds_t EGLnsecsANDROID; + +struct EGLClientPixmapHI; + +#define EGL_DONT_CARE ((EGLint)-1) + +#define EGL_NO_CONTEXT ((EGLContext)0) +#define EGL_NO_DISPLAY ((EGLDisplay)0) +#define EGL_NO_IMAGE ((EGLImage)0) +#define EGL_NO_SURFACE ((EGLSurface)0) +#define EGL_NO_SYNC ((EGLSync)0) + +#define EGL_UNKNOWN ((EGLint)-1) + +#define EGL_DEFAULT_DISPLAY ((EGLNativeDisplayType)0) + +EGLAPI __eglMustCastToProperFunctionPointerType EGLAPIENTRY eglGetProcAddress (const char *procname); +/* ---------------------------- EGL_VERSION_1_0 ---------------------------- */ + +#ifndef EGL_VERSION_1_0 +#define EGL_VERSION_1_0 1 + +#define EGL_FALSE 0 +#define EGL_PBUFFER_BIT 0x0001 +#define EGL_TRUE 1 +#define EGL_PIXMAP_BIT 0x0002 +#define EGL_WINDOW_BIT 0x0004 +#define EGL_SUCCESS 0x3000 +#define EGL_NOT_INITIALIZED 0x3001 +#define EGL_BAD_ACCESS 0x3002 +#define EGL_BAD_ALLOC 0x3003 +#define EGL_BAD_ATTRIBUTE 0x3004 +#define EGL_BAD_CONFIG 0x3005 +#define EGL_BAD_CONTEXT 0x3006 +#define EGL_BAD_CURRENT_SURFACE 0x3007 +#define EGL_BAD_DISPLAY 0x3008 +#define EGL_BAD_MATCH 0x3009 +#define EGL_BAD_NATIVE_PIXMAP 0x300A +#define EGL_BAD_NATIVE_WINDOW 0x300B +#define EGL_BAD_PARAMETER 0x300C +#define EGL_BAD_SURFACE 0x300D +#define EGL_BUFFER_SIZE 0x3020 +#define EGL_ALPHA_SIZE 0x3021 +#define EGL_BLUE_SIZE 0x3022 +#define EGL_GREEN_SIZE 0x3023 +#define EGL_RED_SIZE 0x3024 +#define EGL_DEPTH_SIZE 0x3025 +#define EGL_STENCIL_SIZE 0x3026 +#define EGL_CONFIG_CAVEAT 0x3027 +#define EGL_CONFIG_ID 0x3028 +#define EGL_LEVEL 0x3029 +#define EGL_MAX_PBUFFER_HEIGHT 0x302A +#define EGL_MAX_PBUFFER_PIXELS 0x302B +#define EGL_MAX_PBUFFER_WIDTH 0x302C +#define EGL_NATIVE_RENDERABLE 0x302D +#define EGL_NATIVE_VISUAL_ID 0x302E +#define EGL_NATIVE_VISUAL_TYPE 0x302F +#define EGL_SAMPLES 0x3031 +#define EGL_SAMPLE_BUFFERS 0x3032 +#define EGL_SURFACE_TYPE 0x3033 +#define EGL_TRANSPARENT_TYPE 0x3034 +#define EGL_TRANSPARENT_BLUE_VALUE 0x3035 +#define EGL_TRANSPARENT_GREEN_VALUE 0x3036 +#define EGL_TRANSPARENT_RED_VALUE 0x3037 +#define EGL_NONE 0x3038 +#define EGL_SLOW_CONFIG 0x3050 +#define EGL_NON_CONFORMANT_CONFIG 0x3051 +#define EGL_TRANSPARENT_RGB 0x3052 +#define EGL_VENDOR 0x3053 +#define EGL_VERSION 0x3054 +#define EGL_EXTENSIONS 0x3055 +#define EGL_HEIGHT 0x3056 +#define EGL_WIDTH 0x3057 +#define EGL_LARGEST_PBUFFER 0x3058 +#define EGL_DRAW 0x3059 +#define EGL_READ 0x305A +#define EGL_CORE_NATIVE_ENGINE 0x305B + +typedef EGLBoolean ( * PFNEGLCHOOSECONFIGPROC) (EGLDisplay dpy, const EGLint * attrib_list, EGLConfig * configs, EGLint config_size, EGLint * num_config); +typedef EGLBoolean ( * PFNEGLCOPYBUFFERSPROC) (EGLDisplay dpy, EGLSurface surface, EGLNativePixmapType target); +typedef EGLContext ( * PFNEGLCREATECONTEXTPROC) (EGLDisplay dpy, EGLConfig config, EGLContext share_context, const EGLint * attrib_list); +typedef EGLSurface ( * PFNEGLCREATEPBUFFERSURFACEPROC) (EGLDisplay dpy, EGLConfig config, const EGLint * attrib_list); +typedef EGLSurface ( * PFNEGLCREATEPIXMAPSURFACEPROC) (EGLDisplay dpy, EGLConfig config, EGLNativePixmapType pixmap, const EGLint * attrib_list); +typedef EGLSurface ( * PFNEGLCREATEWINDOWSURFACEPROC) (EGLDisplay dpy, EGLConfig config, EGLNativeWindowType win, const EGLint * attrib_list); +typedef EGLBoolean ( * PFNEGLDESTROYCONTEXTPROC) (EGLDisplay dpy, EGLContext ctx); +typedef EGLBoolean ( * PFNEGLDESTROYSURFACEPROC) (EGLDisplay dpy, EGLSurface surface); +typedef EGLBoolean ( * PFNEGLGETCONFIGATTRIBPROC) (EGLDisplay dpy, EGLConfig config, EGLint attribute, EGLint * value); +typedef EGLBoolean ( * PFNEGLGETCONFIGSPROC) (EGLDisplay dpy, EGLConfig * configs, EGLint config_size, EGLint * num_config); +typedef EGLDisplay ( * PFNEGLGETCURRENTDISPLAYPROC) ( void ); +typedef EGLSurface ( * PFNEGLGETCURRENTSURFACEPROC) (EGLint readdraw); +typedef EGLDisplay ( * PFNEGLGETDISPLAYPROC) (EGLNativeDisplayType display_id); +typedef EGLint ( * PFNEGLGETERRORPROC) ( void ); +typedef EGLBoolean ( * PFNEGLINITIALIZEPROC) (EGLDisplay dpy, EGLint * major, EGLint * minor); +typedef EGLBoolean ( * PFNEGLMAKECURRENTPROC) (EGLDisplay dpy, EGLSurface draw, EGLSurface read, EGLContext ctx); +typedef EGLBoolean ( * PFNEGLQUERYCONTEXTPROC) (EGLDisplay dpy, EGLContext ctx, EGLint attribute, EGLint * value); +typedef const char * ( * PFNEGLQUERYSTRINGPROC) (EGLDisplay dpy, EGLint name); +typedef EGLBoolean ( * PFNEGLQUERYSURFACEPROC) (EGLDisplay dpy, EGLSurface surface, EGLint attribute, EGLint * value); +typedef EGLBoolean ( * PFNEGLSWAPBUFFERSPROC) (EGLDisplay dpy, EGLSurface surface); +typedef EGLBoolean ( * PFNEGLTERMINATEPROC) (EGLDisplay dpy); +typedef EGLBoolean ( * PFNEGLWAITGLPROC) ( void ); +typedef EGLBoolean ( * PFNEGLWAITNATIVEPROC) (EGLint engine); + +#define eglChooseConfig EGLEW_GET_FUN(__eglewChooseConfig) +#define eglCopyBuffers EGLEW_GET_FUN(__eglewCopyBuffers) +#define eglCreateContext EGLEW_GET_FUN(__eglewCreateContext) +#define eglCreatePbufferSurface EGLEW_GET_FUN(__eglewCreatePbufferSurface) +#define eglCreatePixmapSurface EGLEW_GET_FUN(__eglewCreatePixmapSurface) +#define eglCreateWindowSurface EGLEW_GET_FUN(__eglewCreateWindowSurface) +#define eglDestroyContext EGLEW_GET_FUN(__eglewDestroyContext) +#define eglDestroySurface EGLEW_GET_FUN(__eglewDestroySurface) +#define eglGetConfigAttrib EGLEW_GET_FUN(__eglewGetConfigAttrib) +#define eglGetConfigs EGLEW_GET_FUN(__eglewGetConfigs) +#define eglGetCurrentDisplay EGLEW_GET_FUN(__eglewGetCurrentDisplay) +#define eglGetCurrentSurface EGLEW_GET_FUN(__eglewGetCurrentSurface) +#define eglGetDisplay EGLEW_GET_FUN(__eglewGetDisplay) +#define eglGetError EGLEW_GET_FUN(__eglewGetError) +#define eglInitialize EGLEW_GET_FUN(__eglewInitialize) +#define eglMakeCurrent EGLEW_GET_FUN(__eglewMakeCurrent) +#define eglQueryContext EGLEW_GET_FUN(__eglewQueryContext) +#define eglQueryString EGLEW_GET_FUN(__eglewQueryString) +#define eglQuerySurface EGLEW_GET_FUN(__eglewQuerySurface) +#define eglSwapBuffers EGLEW_GET_FUN(__eglewSwapBuffers) +#define eglTerminate EGLEW_GET_FUN(__eglewTerminate) +#define eglWaitGL EGLEW_GET_FUN(__eglewWaitGL) +#define eglWaitNative EGLEW_GET_FUN(__eglewWaitNative) + +#define EGLEW_VERSION_1_0 EGLEW_GET_VAR(__EGLEW_VERSION_1_0) + +#endif /* EGL_VERSION_1_0 */ + +/* ---------------------------- EGL_VERSION_1_1 ---------------------------- */ + +#ifndef EGL_VERSION_1_1 +#define EGL_VERSION_1_1 1 + +#define EGL_CONTEXT_LOST 0x300E +#define EGL_BIND_TO_TEXTURE_RGB 0x3039 +#define EGL_BIND_TO_TEXTURE_RGBA 0x303A +#define EGL_MIN_SWAP_INTERVAL 0x303B +#define EGL_MAX_SWAP_INTERVAL 0x303C +#define EGL_NO_TEXTURE 0x305C +#define EGL_TEXTURE_RGB 0x305D +#define EGL_TEXTURE_RGBA 0x305E +#define EGL_TEXTURE_2D 0x305F +#define EGL_TEXTURE_FORMAT 0x3080 +#define EGL_TEXTURE_TARGET 0x3081 +#define EGL_MIPMAP_TEXTURE 0x3082 +#define EGL_MIPMAP_LEVEL 0x3083 +#define EGL_BACK_BUFFER 0x3084 + +typedef EGLBoolean ( * PFNEGLBINDTEXIMAGEPROC) (EGLDisplay dpy, EGLSurface surface, EGLint buffer); +typedef EGLBoolean ( * PFNEGLRELEASETEXIMAGEPROC) (EGLDisplay dpy, EGLSurface surface, EGLint buffer); +typedef EGLBoolean ( * PFNEGLSURFACEATTRIBPROC) (EGLDisplay dpy, EGLSurface surface, EGLint attribute, EGLint value); +typedef EGLBoolean ( * PFNEGLSWAPINTERVALPROC) (EGLDisplay dpy, EGLint interval); + +#define eglBindTexImage EGLEW_GET_FUN(__eglewBindTexImage) +#define eglReleaseTexImage EGLEW_GET_FUN(__eglewReleaseTexImage) +#define eglSurfaceAttrib EGLEW_GET_FUN(__eglewSurfaceAttrib) +#define eglSwapInterval EGLEW_GET_FUN(__eglewSwapInterval) + +#define EGLEW_VERSION_1_1 EGLEW_GET_VAR(__EGLEW_VERSION_1_1) + +#endif /* EGL_VERSION_1_1 */ + +/* ---------------------------- EGL_VERSION_1_2 ---------------------------- */ + +#ifndef EGL_VERSION_1_2 +#define EGL_VERSION_1_2 1 + +#define EGL_OPENGL_ES_BIT 0x0001 +#define EGL_OPENVG_BIT 0x0002 +#define EGL_LUMINANCE_SIZE 0x303D +#define EGL_ALPHA_MASK_SIZE 0x303E +#define EGL_COLOR_BUFFER_TYPE 0x303F +#define EGL_RENDERABLE_TYPE 0x3040 +#define EGL_SINGLE_BUFFER 0x3085 +#define EGL_RENDER_BUFFER 0x3086 +#define EGL_COLORSPACE 0x3087 +#define EGL_ALPHA_FORMAT 0x3088 +#define EGL_COLORSPACE_LINEAR 0x308A +#define EGL_ALPHA_FORMAT_NONPRE 0x308B +#define EGL_ALPHA_FORMAT_PRE 0x308C +#define EGL_CLIENT_APIS 0x308D +#define EGL_RGB_BUFFER 0x308E +#define EGL_LUMINANCE_BUFFER 0x308F +#define EGL_HORIZONTAL_RESOLUTION 0x3090 +#define EGL_VERTICAL_RESOLUTION 0x3091 +#define EGL_PIXEL_ASPECT_RATIO 0x3092 +#define EGL_SWAP_BEHAVIOR 0x3093 +#define EGL_BUFFER_PRESERVED 0x3094 +#define EGL_BUFFER_DESTROYED 0x3095 +#define EGL_OPENVG_IMAGE 0x3096 +#define EGL_CONTEXT_CLIENT_TYPE 0x3097 +#define EGL_OPENGL_ES_API 0x30A0 +#define EGL_OPENVG_API 0x30A1 +#define EGL_DISPLAY_SCALING 10000 + +typedef EGLBoolean ( * PFNEGLBINDAPIPROC) (EGLenum api); +typedef EGLSurface ( * PFNEGLCREATEPBUFFERFROMCLIENTBUFFERPROC) (EGLDisplay dpy, EGLenum buftype, EGLClientBuffer buffer, EGLConfig config, const EGLint * attrib_list); +typedef EGLenum ( * PFNEGLQUERYAPIPROC) ( void ); +typedef EGLBoolean ( * PFNEGLRELEASETHREADPROC) ( void ); +typedef EGLBoolean ( * PFNEGLWAITCLIENTPROC) ( void ); + +#define eglBindAPI EGLEW_GET_FUN(__eglewBindAPI) +#define eglCreatePbufferFromClientBuffer EGLEW_GET_FUN(__eglewCreatePbufferFromClientBuffer) +#define eglQueryAPI EGLEW_GET_FUN(__eglewQueryAPI) +#define eglReleaseThread EGLEW_GET_FUN(__eglewReleaseThread) +#define eglWaitClient EGLEW_GET_FUN(__eglewWaitClient) + +#define EGLEW_VERSION_1_2 EGLEW_GET_VAR(__EGLEW_VERSION_1_2) + +#endif /* EGL_VERSION_1_2 */ + +/* ---------------------------- EGL_VERSION_1_3 ---------------------------- */ + +#ifndef EGL_VERSION_1_3 +#define EGL_VERSION_1_3 1 + +#define EGL_OPENGL_ES2_BIT 0x0004 +#define EGL_VG_COLORSPACE_LINEAR_BIT 0x0020 +#define EGL_VG_ALPHA_FORMAT_PRE_BIT 0x0040 +#define EGL_MATCH_NATIVE_PIXMAP 0x3041 +#define EGL_CONFORMANT 0x3042 +#define EGL_VG_COLORSPACE 0x3087 +#define EGL_VG_ALPHA_FORMAT 0x3088 +#define EGL_VG_COLORSPACE_LINEAR 0x308A +#define EGL_VG_ALPHA_FORMAT_NONPRE 0x308B +#define EGL_VG_ALPHA_FORMAT_PRE 0x308C +#define EGL_CONTEXT_CLIENT_VERSION 0x3098 + +#define EGLEW_VERSION_1_3 EGLEW_GET_VAR(__EGLEW_VERSION_1_3) + +#endif /* EGL_VERSION_1_3 */ + +/* ---------------------------- EGL_VERSION_1_4 ---------------------------- */ + +#ifndef EGL_VERSION_1_4 +#define EGL_VERSION_1_4 1 + +#define EGL_OPENGL_BIT 0x0008 +#define EGL_MULTISAMPLE_RESOLVE_BOX_BIT 0x0200 +#define EGL_SWAP_BEHAVIOR_PRESERVED_BIT 0x0400 +#define EGL_MULTISAMPLE_RESOLVE 0x3099 +#define EGL_MULTISAMPLE_RESOLVE_DEFAULT 0x309A +#define EGL_MULTISAMPLE_RESOLVE_BOX 0x309B +#define EGL_OPENGL_API 0x30A2 + +typedef EGLContext ( * PFNEGLGETCURRENTCONTEXTPROC) ( void ); + +#define eglGetCurrentContext EGLEW_GET_FUN(__eglewGetCurrentContext) + +#define EGLEW_VERSION_1_4 EGLEW_GET_VAR(__EGLEW_VERSION_1_4) + +#endif /* EGL_VERSION_1_4 */ + +/* ---------------------------- EGL_VERSION_1_5 ---------------------------- */ + +#ifndef EGL_VERSION_1_5 +#define EGL_VERSION_1_5 1 + +#define EGL_CONTEXT_OPENGL_CORE_PROFILE_BIT 0x00000001 +#define EGL_SYNC_FLUSH_COMMANDS_BIT 0x0001 +#define EGL_CONTEXT_OPENGL_COMPATIBILITY_PROFILE_BIT 0x00000002 +#define EGL_OPENGL_ES3_BIT 0x00000040 +#define EGL_GL_COLORSPACE_SRGB 0x3089 +#define EGL_GL_COLORSPACE_LINEAR 0x308A +#define EGL_CONTEXT_MAJOR_VERSION 0x3098 +#define EGL_CL_EVENT_HANDLE 0x309C +#define EGL_GL_COLORSPACE 0x309D +#define EGL_GL_TEXTURE_2D 0x30B1 +#define EGL_GL_TEXTURE_3D 0x30B2 +#define EGL_GL_TEXTURE_CUBE_MAP_POSITIVE_X 0x30B3 +#define EGL_GL_TEXTURE_CUBE_MAP_NEGATIVE_X 0x30B4 +#define EGL_GL_TEXTURE_CUBE_MAP_POSITIVE_Y 0x30B5 +#define EGL_GL_TEXTURE_CUBE_MAP_NEGATIVE_Y 0x30B6 +#define EGL_GL_TEXTURE_CUBE_MAP_POSITIVE_Z 0x30B7 +#define EGL_GL_TEXTURE_CUBE_MAP_NEGATIVE_Z 0x30B8 +#define EGL_GL_RENDERBUFFER 0x30B9 +#define EGL_GL_TEXTURE_LEVEL 0x30BC +#define EGL_GL_TEXTURE_ZOFFSET 0x30BD +#define EGL_IMAGE_PRESERVED 0x30D2 +#define EGL_SYNC_PRIOR_COMMANDS_COMPLETE 0x30F0 +#define EGL_SYNC_STATUS 0x30F1 +#define EGL_SIGNALED 0x30F2 +#define EGL_UNSIGNALED 0x30F3 +#define EGL_TIMEOUT_EXPIRED 0x30F5 +#define EGL_CONDITION_SATISFIED 0x30F6 +#define EGL_SYNC_TYPE 0x30F7 +#define EGL_SYNC_CONDITION 0x30F8 +#define EGL_SYNC_FENCE 0x30F9 +#define EGL_CONTEXT_MINOR_VERSION 0x30FB +#define EGL_CONTEXT_OPENGL_PROFILE_MASK 0x30FD +#define EGL_SYNC_CL_EVENT 0x30FE +#define EGL_SYNC_CL_EVENT_COMPLETE 0x30FF +#define EGL_CONTEXT_OPENGL_DEBUG 0x31B0 +#define EGL_CONTEXT_OPENGL_FORWARD_COMPATIBLE 0x31B1 +#define EGL_CONTEXT_OPENGL_ROBUST_ACCESS 0x31B2 +#define EGL_CONTEXT_OPENGL_RESET_NOTIFICATION_STRATEGY 0x31BD +#define EGL_NO_RESET_NOTIFICATION 0x31BE +#define EGL_LOSE_CONTEXT_ON_RESET 0x31BF +#define EGL_FOREVER 0xFFFFFFFFFFFFFFFF + +typedef EGLint ( * PFNEGLCLIENTWAITSYNCPROC) (EGLDisplay dpy, EGLSync sync, EGLint flags, EGLTime timeout); +typedef EGLImage ( * PFNEGLCREATEIMAGEPROC) (EGLDisplay dpy, EGLContext ctx, EGLenum target, EGLClientBuffer buffer, const EGLAttrib * attrib_list); +typedef EGLSurface ( * PFNEGLCREATEPLATFORMPIXMAPSURFACEPROC) (EGLDisplay dpy, EGLConfig config, void * native_pixmap, const EGLAttrib * attrib_list); +typedef EGLSurface ( * PFNEGLCREATEPLATFORMWINDOWSURFACEPROC) (EGLDisplay dpy, EGLConfig config, void * native_window, const EGLAttrib * attrib_list); +typedef EGLSync ( * PFNEGLCREATESYNCPROC) (EGLDisplay dpy, EGLenum type, const EGLAttrib * attrib_list); +typedef EGLBoolean ( * PFNEGLDESTROYIMAGEPROC) (EGLDisplay dpy, EGLImage image); +typedef EGLBoolean ( * PFNEGLDESTROYSYNCPROC) (EGLDisplay dpy, EGLSync sync); +typedef EGLDisplay ( * PFNEGLGETPLATFORMDISPLAYPROC) (EGLenum platform, void * native_display, const EGLAttrib * attrib_list); +typedef EGLBoolean ( * PFNEGLGETSYNCATTRIBPROC) (EGLDisplay dpy, EGLSync sync, EGLint attribute, EGLAttrib * value); +typedef EGLBoolean ( * PFNEGLWAITSYNCPROC) (EGLDisplay dpy, EGLSync sync, EGLint flags); + +#define eglClientWaitSync EGLEW_GET_FUN(__eglewClientWaitSync) +#define eglCreateImage EGLEW_GET_FUN(__eglewCreateImage) +#define eglCreatePlatformPixmapSurface EGLEW_GET_FUN(__eglewCreatePlatformPixmapSurface) +#define eglCreatePlatformWindowSurface EGLEW_GET_FUN(__eglewCreatePlatformWindowSurface) +#define eglCreateSync EGLEW_GET_FUN(__eglewCreateSync) +#define eglDestroyImage EGLEW_GET_FUN(__eglewDestroyImage) +#define eglDestroySync EGLEW_GET_FUN(__eglewDestroySync) +#define eglGetPlatformDisplay EGLEW_GET_FUN(__eglewGetPlatformDisplay) +#define eglGetSyncAttrib EGLEW_GET_FUN(__eglewGetSyncAttrib) +#define eglWaitSync EGLEW_GET_FUN(__eglewWaitSync) + +#define EGLEW_VERSION_1_5 EGLEW_GET_VAR(__EGLEW_VERSION_1_5) + +#endif /* EGL_VERSION_1_5 */ + +/* ------------------------- EGL_ANDROID_blob_cache ------------------------ */ + +#ifndef EGL_ANDROID_blob_cache +#define EGL_ANDROID_blob_cache 1 + +typedef void ( * PFNEGLSETBLOBCACHEFUNCSANDROIDPROC) (EGLDisplay dpy, EGLSetBlobFuncANDROID set, EGLGetBlobFuncANDROID get); + +#define eglSetBlobCacheFuncsANDROID EGLEW_GET_FUN(__eglewSetBlobCacheFuncsANDROID) + +#define EGLEW_ANDROID_blob_cache EGLEW_GET_VAR(__EGLEW_ANDROID_blob_cache) + +#endif /* EGL_ANDROID_blob_cache */ + +/* ---------------- EGL_ANDROID_create_native_client_buffer ---------------- */ + +#ifndef EGL_ANDROID_create_native_client_buffer +#define EGL_ANDROID_create_native_client_buffer 1 + +#define EGL_NATIVE_BUFFER_USAGE_PROTECTED_BIT_ANDROID 0x00000001 +#define EGL_NATIVE_BUFFER_USAGE_RENDERBUFFER_BIT_ANDROID 0x00000002 +#define EGL_NATIVE_BUFFER_USAGE_TEXTURE_BIT_ANDROID 0x00000004 +#define EGL_NATIVE_BUFFER_USAGE_ANDROID 0x3143 + +typedef EGLClientBuffer ( * PFNEGLCREATENATIVECLIENTBUFFERANDROIDPROC) (const EGLint * attrib_list); + +#define eglCreateNativeClientBufferANDROID EGLEW_GET_FUN(__eglewCreateNativeClientBufferANDROID) + +#define EGLEW_ANDROID_create_native_client_buffer EGLEW_GET_VAR(__EGLEW_ANDROID_create_native_client_buffer) + +#endif /* EGL_ANDROID_create_native_client_buffer */ + +/* --------------------- EGL_ANDROID_framebuffer_target -------------------- */ + +#ifndef EGL_ANDROID_framebuffer_target +#define EGL_ANDROID_framebuffer_target 1 + +#define EGL_FRAMEBUFFER_TARGET_ANDROID 0x3147 + +#define EGLEW_ANDROID_framebuffer_target EGLEW_GET_VAR(__EGLEW_ANDROID_framebuffer_target) + +#endif /* EGL_ANDROID_framebuffer_target */ + +/* ----------------- EGL_ANDROID_front_buffer_auto_refresh ----------------- */ + +#ifndef EGL_ANDROID_front_buffer_auto_refresh +#define EGL_ANDROID_front_buffer_auto_refresh 1 + +#define EGL_FRONT_BUFFER_AUTO_REFRESH_ANDROID 0x314C + +#define EGLEW_ANDROID_front_buffer_auto_refresh EGLEW_GET_VAR(__EGLEW_ANDROID_front_buffer_auto_refresh) + +#endif /* EGL_ANDROID_front_buffer_auto_refresh */ + +/* -------------------- EGL_ANDROID_image_native_buffer -------------------- */ + +#ifndef EGL_ANDROID_image_native_buffer +#define EGL_ANDROID_image_native_buffer 1 + +#define EGL_NATIVE_BUFFER_ANDROID 0x3140 + +#define EGLEW_ANDROID_image_native_buffer EGLEW_GET_VAR(__EGLEW_ANDROID_image_native_buffer) + +#endif /* EGL_ANDROID_image_native_buffer */ + +/* --------------------- EGL_ANDROID_native_fence_sync --------------------- */ + +#ifndef EGL_ANDROID_native_fence_sync +#define EGL_ANDROID_native_fence_sync 1 + +#define EGL_SYNC_NATIVE_FENCE_ANDROID 0x3144 +#define EGL_SYNC_NATIVE_FENCE_FD_ANDROID 0x3145 +#define EGL_SYNC_NATIVE_FENCE_SIGNALED_ANDROID 0x3146 + +typedef EGLint ( * PFNEGLDUPNATIVEFENCEFDANDROIDPROC) (EGLDisplay dpy, EGLSyncKHR sync); + +#define eglDupNativeFenceFDANDROID EGLEW_GET_FUN(__eglewDupNativeFenceFDANDROID) + +#define EGLEW_ANDROID_native_fence_sync EGLEW_GET_VAR(__EGLEW_ANDROID_native_fence_sync) + +#endif /* EGL_ANDROID_native_fence_sync */ + +/* --------------------- EGL_ANDROID_presentation_time --------------------- */ + +#ifndef EGL_ANDROID_presentation_time +#define EGL_ANDROID_presentation_time 1 + +typedef EGLBoolean ( * PFNEGLPRESENTATIONTIMEANDROIDPROC) (EGLDisplay dpy, EGLSurface surface, EGLnsecsANDROID time); + +#define eglPresentationTimeANDROID EGLEW_GET_FUN(__eglewPresentationTimeANDROID) + +#define EGLEW_ANDROID_presentation_time EGLEW_GET_VAR(__EGLEW_ANDROID_presentation_time) + +#endif /* EGL_ANDROID_presentation_time */ + +/* ------------------------- EGL_ANDROID_recordable ------------------------ */ + +#ifndef EGL_ANDROID_recordable +#define EGL_ANDROID_recordable 1 + +#define EGL_RECORDABLE_ANDROID 0x3142 + +#define EGLEW_ANDROID_recordable EGLEW_GET_VAR(__EGLEW_ANDROID_recordable) + +#endif /* EGL_ANDROID_recordable */ + +/* ---------------- EGL_ANGLE_d3d_share_handle_client_buffer --------------- */ + +#ifndef EGL_ANGLE_d3d_share_handle_client_buffer +#define EGL_ANGLE_d3d_share_handle_client_buffer 1 + +#define EGL_D3D_TEXTURE_2D_SHARE_HANDLE_ANGLE 0x3200 + +#define EGLEW_ANGLE_d3d_share_handle_client_buffer EGLEW_GET_VAR(__EGLEW_ANGLE_d3d_share_handle_client_buffer) + +#endif /* EGL_ANGLE_d3d_share_handle_client_buffer */ + +/* -------------------------- EGL_ANGLE_device_d3d ------------------------- */ + +#ifndef EGL_ANGLE_device_d3d +#define EGL_ANGLE_device_d3d 1 + +#define EGL_D3D9_DEVICE_ANGLE 0x33A0 +#define EGL_D3D11_DEVICE_ANGLE 0x33A1 + +#define EGLEW_ANGLE_device_d3d EGLEW_GET_VAR(__EGLEW_ANGLE_device_d3d) + +#endif /* EGL_ANGLE_device_d3d */ + +/* -------------------- EGL_ANGLE_query_surface_pointer -------------------- */ + +#ifndef EGL_ANGLE_query_surface_pointer +#define EGL_ANGLE_query_surface_pointer 1 + +typedef EGLBoolean ( * PFNEGLQUERYSURFACEPOINTERANGLEPROC) (EGLDisplay dpy, EGLSurface surface, EGLint attribute, void ** value); + +#define eglQuerySurfacePointerANGLE EGLEW_GET_FUN(__eglewQuerySurfacePointerANGLE) + +#define EGLEW_ANGLE_query_surface_pointer EGLEW_GET_VAR(__EGLEW_ANGLE_query_surface_pointer) + +#endif /* EGL_ANGLE_query_surface_pointer */ + +/* ------------- EGL_ANGLE_surface_d3d_texture_2d_share_handle ------------- */ + +#ifndef EGL_ANGLE_surface_d3d_texture_2d_share_handle +#define EGL_ANGLE_surface_d3d_texture_2d_share_handle 1 + +#define EGL_D3D_TEXTURE_2D_SHARE_HANDLE_ANGLE 0x3200 + +#define EGLEW_ANGLE_surface_d3d_texture_2d_share_handle EGLEW_GET_VAR(__EGLEW_ANGLE_surface_d3d_texture_2d_share_handle) + +#endif /* EGL_ANGLE_surface_d3d_texture_2d_share_handle */ + +/* ---------------------- EGL_ANGLE_window_fixed_size ---------------------- */ + +#ifndef EGL_ANGLE_window_fixed_size +#define EGL_ANGLE_window_fixed_size 1 + +#define EGL_FIXED_SIZE_ANGLE 0x3201 + +#define EGLEW_ANGLE_window_fixed_size EGLEW_GET_VAR(__EGLEW_ANGLE_window_fixed_size) + +#endif /* EGL_ANGLE_window_fixed_size */ + +/* --------------------- EGL_ARM_implicit_external_sync -------------------- */ + +#ifndef EGL_ARM_implicit_external_sync +#define EGL_ARM_implicit_external_sync 1 + +#define EGL_SYNC_PRIOR_COMMANDS_IMPLICIT_EXTERNAL_ARM 0x328A + +#define EGLEW_ARM_implicit_external_sync EGLEW_GET_VAR(__EGLEW_ARM_implicit_external_sync) + +#endif /* EGL_ARM_implicit_external_sync */ + +/* ------------------- EGL_ARM_pixmap_multisample_discard ------------------ */ + +#ifndef EGL_ARM_pixmap_multisample_discard +#define EGL_ARM_pixmap_multisample_discard 1 + +#define EGL_DISCARD_SAMPLES_ARM 0x3286 + +#define EGLEW_ARM_pixmap_multisample_discard EGLEW_GET_VAR(__EGLEW_ARM_pixmap_multisample_discard) + +#endif /* EGL_ARM_pixmap_multisample_discard */ + +/* --------------------------- EGL_EXT_buffer_age -------------------------- */ + +#ifndef EGL_EXT_buffer_age +#define EGL_EXT_buffer_age 1 + +#define EGL_BUFFER_AGE_EXT 0x313D + +#define EGLEW_EXT_buffer_age EGLEW_GET_VAR(__EGLEW_EXT_buffer_age) + +#endif /* EGL_EXT_buffer_age */ + +/* ----------------------- EGL_EXT_client_extensions ----------------------- */ + +#ifndef EGL_EXT_client_extensions +#define EGL_EXT_client_extensions 1 + +#define EGLEW_EXT_client_extensions EGLEW_GET_VAR(__EGLEW_EXT_client_extensions) + +#endif /* EGL_EXT_client_extensions */ + +/* ------------------- EGL_EXT_create_context_robustness ------------------- */ + +#ifndef EGL_EXT_create_context_robustness +#define EGL_EXT_create_context_robustness 1 + +#define EGL_CONTEXT_OPENGL_ROBUST_ACCESS_EXT 0x30BF +#define EGL_CONTEXT_OPENGL_RESET_NOTIFICATION_STRATEGY_EXT 0x3138 +#define EGL_NO_RESET_NOTIFICATION_EXT 0x31BE +#define EGL_LOSE_CONTEXT_ON_RESET_EXT 0x31BF + +#define EGLEW_EXT_create_context_robustness EGLEW_GET_VAR(__EGLEW_EXT_create_context_robustness) + +#endif /* EGL_EXT_create_context_robustness */ + +/* -------------------------- EGL_EXT_device_base -------------------------- */ + +#ifndef EGL_EXT_device_base +#define EGL_EXT_device_base 1 + +#define EGL_BAD_DEVICE_EXT 0x322B +#define EGL_DEVICE_EXT 0x322C + +#define EGLEW_EXT_device_base EGLEW_GET_VAR(__EGLEW_EXT_device_base) + +#endif /* EGL_EXT_device_base */ + +/* --------------------------- EGL_EXT_device_drm -------------------------- */ + +#ifndef EGL_EXT_device_drm +#define EGL_EXT_device_drm 1 + +#define EGL_DRM_DEVICE_FILE_EXT 0x3233 + +#define EGLEW_EXT_device_drm EGLEW_GET_VAR(__EGLEW_EXT_device_drm) + +#endif /* EGL_EXT_device_drm */ + +/* ----------------------- EGL_EXT_device_enumeration ---------------------- */ + +#ifndef EGL_EXT_device_enumeration +#define EGL_EXT_device_enumeration 1 + +typedef EGLBoolean ( * PFNEGLQUERYDEVICESEXTPROC) (EGLint max_devices, EGLDeviceEXT * devices, EGLint * num_devices); + +#define eglQueryDevicesEXT EGLEW_GET_FUN(__eglewQueryDevicesEXT) + +#define EGLEW_EXT_device_enumeration EGLEW_GET_VAR(__EGLEW_EXT_device_enumeration) + +#endif /* EGL_EXT_device_enumeration */ + +/* ------------------------- EGL_EXT_device_openwf ------------------------- */ + +#ifndef EGL_EXT_device_openwf +#define EGL_EXT_device_openwf 1 + +#define EGL_OPENWF_DEVICE_ID_EXT 0x3237 + +#define EGLEW_EXT_device_openwf EGLEW_GET_VAR(__EGLEW_EXT_device_openwf) + +#endif /* EGL_EXT_device_openwf */ + +/* -------------------------- EGL_EXT_device_query ------------------------- */ + +#ifndef EGL_EXT_device_query +#define EGL_EXT_device_query 1 + +#define EGL_BAD_DEVICE_EXT 0x322B +#define EGL_DEVICE_EXT 0x322C + +typedef EGLBoolean ( * PFNEGLQUERYDEVICEATTRIBEXTPROC) (EGLDeviceEXT device, EGLint attribute, EGLAttrib * value); +typedef const char * ( * PFNEGLQUERYDEVICESTRINGEXTPROC) (EGLDeviceEXT device, EGLint name); +typedef EGLBoolean ( * PFNEGLQUERYDISPLAYATTRIBEXTPROC) (EGLDisplay dpy, EGLint attribute, EGLAttrib * value); + +#define eglQueryDeviceAttribEXT EGLEW_GET_FUN(__eglewQueryDeviceAttribEXT) +#define eglQueryDeviceStringEXT EGLEW_GET_FUN(__eglewQueryDeviceStringEXT) +#define eglQueryDisplayAttribEXT EGLEW_GET_FUN(__eglewQueryDisplayAttribEXT) + +#define EGLEW_EXT_device_query EGLEW_GET_VAR(__EGLEW_EXT_device_query) + +#endif /* EGL_EXT_device_query */ + +/* ------------------ EGL_EXT_gl_colorspace_bt2020_linear ------------------ */ + +#ifndef EGL_EXT_gl_colorspace_bt2020_linear +#define EGL_EXT_gl_colorspace_bt2020_linear 1 + +#define EGL_GL_COLORSPACE_BT2020_LINEAR_EXT 0x333F + +#define EGLEW_EXT_gl_colorspace_bt2020_linear EGLEW_GET_VAR(__EGLEW_EXT_gl_colorspace_bt2020_linear) + +#endif /* EGL_EXT_gl_colorspace_bt2020_linear */ + +/* -------------------- EGL_EXT_gl_colorspace_bt2020_pq -------------------- */ + +#ifndef EGL_EXT_gl_colorspace_bt2020_pq +#define EGL_EXT_gl_colorspace_bt2020_pq 1 + +#define EGL_GL_COLORSPACE_BT2020_PQ_EXT 0x3340 + +#define EGLEW_EXT_gl_colorspace_bt2020_pq EGLEW_GET_VAR(__EGLEW_EXT_gl_colorspace_bt2020_pq) + +#endif /* EGL_EXT_gl_colorspace_bt2020_pq */ + +/* ------------------- EGL_EXT_gl_colorspace_scrgb_linear ------------------ */ + +#ifndef EGL_EXT_gl_colorspace_scrgb_linear +#define EGL_EXT_gl_colorspace_scrgb_linear 1 + +#define EGL_GL_COLORSPACE_SCRGB_LINEAR_EXT 0x3350 + +#define EGLEW_EXT_gl_colorspace_scrgb_linear EGLEW_GET_VAR(__EGLEW_EXT_gl_colorspace_scrgb_linear) + +#endif /* EGL_EXT_gl_colorspace_scrgb_linear */ + +/* ---------------------- EGL_EXT_image_dma_buf_import --------------------- */ + +#ifndef EGL_EXT_image_dma_buf_import +#define EGL_EXT_image_dma_buf_import 1 + +#define EGL_LINUX_DMA_BUF_EXT 0x3270 +#define EGL_LINUX_DRM_FOURCC_EXT 0x3271 +#define EGL_DMA_BUF_PLANE0_FD_EXT 0x3272 +#define EGL_DMA_BUF_PLANE0_OFFSET_EXT 0x3273 +#define EGL_DMA_BUF_PLANE0_PITCH_EXT 0x3274 +#define EGL_DMA_BUF_PLANE1_FD_EXT 0x3275 +#define EGL_DMA_BUF_PLANE1_OFFSET_EXT 0x3276 +#define EGL_DMA_BUF_PLANE1_PITCH_EXT 0x3277 +#define EGL_DMA_BUF_PLANE2_FD_EXT 0x3278 +#define EGL_DMA_BUF_PLANE2_OFFSET_EXT 0x3279 +#define EGL_DMA_BUF_PLANE2_PITCH_EXT 0x327A +#define EGL_YUV_COLOR_SPACE_HINT_EXT 0x327B +#define EGL_SAMPLE_RANGE_HINT_EXT 0x327C +#define EGL_YUV_CHROMA_HORIZONTAL_SITING_HINT_EXT 0x327D +#define EGL_YUV_CHROMA_VERTICAL_SITING_HINT_EXT 0x327E +#define EGL_ITU_REC601_EXT 0x327F +#define EGL_ITU_REC709_EXT 0x3280 +#define EGL_ITU_REC2020_EXT 0x3281 +#define EGL_YUV_FULL_RANGE_EXT 0x3282 +#define EGL_YUV_NARROW_RANGE_EXT 0x3283 +#define EGL_YUV_CHROMA_SITING_0_EXT 0x3284 +#define EGL_YUV_CHROMA_SITING_0_5_EXT 0x3285 + +#define EGLEW_EXT_image_dma_buf_import EGLEW_GET_VAR(__EGLEW_EXT_image_dma_buf_import) + +#endif /* EGL_EXT_image_dma_buf_import */ + +/* ----------------- EGL_EXT_image_dma_buf_import_modifiers ---------------- */ + +#ifndef EGL_EXT_image_dma_buf_import_modifiers +#define EGL_EXT_image_dma_buf_import_modifiers 1 + +#define EGL_DMA_BUF_PLANE3_FD_EXT 0x3440 +#define EGL_DMA_BUF_PLANE3_OFFSET_EXT 0x3441 +#define EGL_DMA_BUF_PLANE3_PITCH_EXT 0x3442 +#define EGL_DMA_BUF_PLANE0_MODIFIER_LO_EXT 0x3443 +#define EGL_DMA_BUF_PLANE0_MODIFIER_HI_EXT 0x3444 +#define EGL_DMA_BUF_PLANE1_MODIFIER_LO_EXT 0x3445 +#define EGL_DMA_BUF_PLANE1_MODIFIER_HI_EXT 0x3446 +#define EGL_DMA_BUF_PLANE2_MODIFIER_LO_EXT 0x3447 +#define EGL_DMA_BUF_PLANE2_MODIFIER_HI_EXT 0x3448 +#define EGL_DMA_BUF_PLANE3_MODIFIER_LO_EXT 0x3449 +#define EGL_DMA_BUF_PLANE3_MODIFIER_HI_EXT 0x344A + +typedef EGLBoolean ( * PFNEGLQUERYDMABUFFORMATSEXTPROC) (EGLDisplay dpy, EGLint max_formats, EGLint *formats, EGLint *num_formats); +typedef EGLBoolean ( * PFNEGLQUERYDMABUFMODIFIERSEXTPROC) (EGLDisplay dpy, EGLint format, EGLint max_modifiers, EGLuint64KHR *modifiers, EGLBoolean *external_only, EGLint *num_modifiers); + +#define eglQueryDmaBufFormatsEXT EGLEW_GET_FUN(__eglewQueryDmaBufFormatsEXT) +#define eglQueryDmaBufModifiersEXT EGLEW_GET_FUN(__eglewQueryDmaBufModifiersEXT) + +#define EGLEW_EXT_image_dma_buf_import_modifiers EGLEW_GET_VAR(__EGLEW_EXT_image_dma_buf_import_modifiers) + +#endif /* EGL_EXT_image_dma_buf_import_modifiers */ + +/* ------------------------ EGL_EXT_multiview_window ----------------------- */ + +#ifndef EGL_EXT_multiview_window +#define EGL_EXT_multiview_window 1 + +#define EGL_MULTIVIEW_VIEW_COUNT_EXT 0x3134 + +#define EGLEW_EXT_multiview_window EGLEW_GET_VAR(__EGLEW_EXT_multiview_window) + +#endif /* EGL_EXT_multiview_window */ + +/* -------------------------- EGL_EXT_output_base -------------------------- */ + +#ifndef EGL_EXT_output_base +#define EGL_EXT_output_base 1 + +#define EGL_BAD_OUTPUT_LAYER_EXT 0x322D +#define EGL_BAD_OUTPUT_PORT_EXT 0x322E +#define EGL_SWAP_INTERVAL_EXT 0x322F + +typedef EGLBoolean ( * PFNEGLGETOUTPUTLAYERSEXTPROC) (EGLDisplay dpy, const EGLAttrib * attrib_list, EGLOutputLayerEXT * layers, EGLint max_layers, EGLint * num_layers); +typedef EGLBoolean ( * PFNEGLGETOUTPUTPORTSEXTPROC) (EGLDisplay dpy, const EGLAttrib * attrib_list, EGLOutputPortEXT * ports, EGLint max_ports, EGLint * num_ports); +typedef EGLBoolean ( * PFNEGLOUTPUTLAYERATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint attribute, EGLAttrib value); +typedef EGLBoolean ( * PFNEGLOUTPUTPORTATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputPortEXT port, EGLint attribute, EGLAttrib value); +typedef EGLBoolean ( * PFNEGLQUERYOUTPUTLAYERATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint attribute, EGLAttrib * value); +typedef const char * ( * PFNEGLQUERYOUTPUTLAYERSTRINGEXTPROC) (EGLDisplay dpy, EGLOutputLayerEXT layer, EGLint name); +typedef EGLBoolean ( * PFNEGLQUERYOUTPUTPORTATTRIBEXTPROC) (EGLDisplay dpy, EGLOutputPortEXT port, EGLint attribute, EGLAttrib * value); +typedef const char * ( * PFNEGLQUERYOUTPUTPORTSTRINGEXTPROC) (EGLDisplay dpy, EGLOutputPortEXT port, EGLint name); + +#define eglGetOutputLayersEXT EGLEW_GET_FUN(__eglewGetOutputLayersEXT) +#define eglGetOutputPortsEXT EGLEW_GET_FUN(__eglewGetOutputPortsEXT) +#define eglOutputLayerAttribEXT EGLEW_GET_FUN(__eglewOutputLayerAttribEXT) +#define eglOutputPortAttribEXT EGLEW_GET_FUN(__eglewOutputPortAttribEXT) +#define eglQueryOutputLayerAttribEXT EGLEW_GET_FUN(__eglewQueryOutputLayerAttribEXT) +#define eglQueryOutputLayerStringEXT EGLEW_GET_FUN(__eglewQueryOutputLayerStringEXT) +#define eglQueryOutputPortAttribEXT EGLEW_GET_FUN(__eglewQueryOutputPortAttribEXT) +#define eglQueryOutputPortStringEXT EGLEW_GET_FUN(__eglewQueryOutputPortStringEXT) + +#define EGLEW_EXT_output_base EGLEW_GET_VAR(__EGLEW_EXT_output_base) + +#endif /* EGL_EXT_output_base */ + +/* --------------------------- EGL_EXT_output_drm -------------------------- */ + +#ifndef EGL_EXT_output_drm +#define EGL_EXT_output_drm 1 + +#define EGL_DRM_CRTC_EXT 0x3234 +#define EGL_DRM_PLANE_EXT 0x3235 +#define EGL_DRM_CONNECTOR_EXT 0x3236 + +#define EGLEW_EXT_output_drm EGLEW_GET_VAR(__EGLEW_EXT_output_drm) + +#endif /* EGL_EXT_output_drm */ + +/* ------------------------- EGL_EXT_output_openwf ------------------------- */ + +#ifndef EGL_EXT_output_openwf +#define EGL_EXT_output_openwf 1 + +#define EGL_OPENWF_PIPELINE_ID_EXT 0x3238 +#define EGL_OPENWF_PORT_ID_EXT 0x3239 + +#define EGLEW_EXT_output_openwf EGLEW_GET_VAR(__EGLEW_EXT_output_openwf) + +#endif /* EGL_EXT_output_openwf */ + +/* ----------------------- EGL_EXT_pixel_format_float ---------------------- */ + +#ifndef EGL_EXT_pixel_format_float +#define EGL_EXT_pixel_format_float 1 + +#define EGL_COLOR_COMPONENT_TYPE_EXT 0x3339 +#define EGL_COLOR_COMPONENT_TYPE_FIXED_EXT 0x333A +#define EGL_COLOR_COMPONENT_TYPE_FLOAT_EXT 0x333B + +#define EGLEW_EXT_pixel_format_float EGLEW_GET_VAR(__EGLEW_EXT_pixel_format_float) + +#endif /* EGL_EXT_pixel_format_float */ + +/* ------------------------- EGL_EXT_platform_base ------------------------- */ + +#ifndef EGL_EXT_platform_base +#define EGL_EXT_platform_base 1 + +typedef EGLSurface ( * PFNEGLCREATEPLATFORMPIXMAPSURFACEEXTPROC) (EGLDisplay dpy, EGLConfig config, void * native_pixmap, const EGLint * attrib_list); +typedef EGLSurface ( * PFNEGLCREATEPLATFORMWINDOWSURFACEEXTPROC) (EGLDisplay dpy, EGLConfig config, void * native_window, const EGLint * attrib_list); +typedef EGLDisplay ( * PFNEGLGETPLATFORMDISPLAYEXTPROC) (EGLenum platform, void * native_display, const EGLint * attrib_list); + +#define eglCreatePlatformPixmapSurfaceEXT EGLEW_GET_FUN(__eglewCreatePlatformPixmapSurfaceEXT) +#define eglCreatePlatformWindowSurfaceEXT EGLEW_GET_FUN(__eglewCreatePlatformWindowSurfaceEXT) +#define eglGetPlatformDisplayEXT EGLEW_GET_FUN(__eglewGetPlatformDisplayEXT) + +#define EGLEW_EXT_platform_base EGLEW_GET_VAR(__EGLEW_EXT_platform_base) + +#endif /* EGL_EXT_platform_base */ + +/* ------------------------ EGL_EXT_platform_device ------------------------ */ + +#ifndef EGL_EXT_platform_device +#define EGL_EXT_platform_device 1 + +#define EGL_PLATFORM_DEVICE_EXT 0x313F + +#define EGLEW_EXT_platform_device EGLEW_GET_VAR(__EGLEW_EXT_platform_device) + +#endif /* EGL_EXT_platform_device */ + +/* ------------------------ EGL_EXT_platform_wayland ----------------------- */ + +#ifndef EGL_EXT_platform_wayland +#define EGL_EXT_platform_wayland 1 + +#define EGL_PLATFORM_WAYLAND_EXT 0x31D8 + +#define EGLEW_EXT_platform_wayland EGLEW_GET_VAR(__EGLEW_EXT_platform_wayland) + +#endif /* EGL_EXT_platform_wayland */ + +/* -------------------------- EGL_EXT_platform_x11 ------------------------- */ + +#ifndef EGL_EXT_platform_x11 +#define EGL_EXT_platform_x11 1 + +#define EGL_PLATFORM_X11_EXT 0x31D5 +#define EGL_PLATFORM_X11_SCREEN_EXT 0x31D6 + +#define EGLEW_EXT_platform_x11 EGLEW_GET_VAR(__EGLEW_EXT_platform_x11) + +#endif /* EGL_EXT_platform_x11 */ + +/* ----------------------- EGL_EXT_protected_content ----------------------- */ + +#ifndef EGL_EXT_protected_content +#define EGL_EXT_protected_content 1 + +#define EGL_PROTECTED_CONTENT_EXT 0x32C0 + +#define EGLEW_EXT_protected_content EGLEW_GET_VAR(__EGLEW_EXT_protected_content) + +#endif /* EGL_EXT_protected_content */ + +/* ----------------------- EGL_EXT_protected_surface ----------------------- */ + +#ifndef EGL_EXT_protected_surface +#define EGL_EXT_protected_surface 1 + +#define EGL_PROTECTED_CONTENT_EXT 0x32C0 + +#define EGLEW_EXT_protected_surface EGLEW_GET_VAR(__EGLEW_EXT_protected_surface) + +#endif /* EGL_EXT_protected_surface */ + +/* ------------------- EGL_EXT_stream_consumer_egloutput ------------------- */ + +#ifndef EGL_EXT_stream_consumer_egloutput +#define EGL_EXT_stream_consumer_egloutput 1 + +typedef EGLBoolean ( * PFNEGLSTREAMCONSUMEROUTPUTEXTPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLOutputLayerEXT layer); + +#define eglStreamConsumerOutputEXT EGLEW_GET_FUN(__eglewStreamConsumerOutputEXT) + +#define EGLEW_EXT_stream_consumer_egloutput EGLEW_GET_VAR(__EGLEW_EXT_stream_consumer_egloutput) + +#endif /* EGL_EXT_stream_consumer_egloutput */ + +/* ------------------- EGL_EXT_surface_SMPTE2086_metadata ------------------ */ + +#ifndef EGL_EXT_surface_SMPTE2086_metadata +#define EGL_EXT_surface_SMPTE2086_metadata 1 + +#define EGL_SMPTE2086_DISPLAY_PRIMARY_RX_EXT 0x3341 +#define EGL_SMPTE2086_DISPLAY_PRIMARY_RY_EXT 0x3342 +#define EGL_SMPTE2086_DISPLAY_PRIMARY_GX_EXT 0x3343 +#define EGL_SMPTE2086_DISPLAY_PRIMARY_GY_EXT 0x3344 +#define EGL_SMPTE2086_DISPLAY_PRIMARY_BX_EXT 0x3345 +#define EGL_SMPTE2086_DISPLAY_PRIMARY_BY_EXT 0x3346 +#define EGL_SMPTE2086_WHITE_POINT_X_EXT 0x3347 +#define EGL_SMPTE2086_WHITE_POINT_Y_EXT 0x3348 +#define EGL_SMPTE2086_MAX_LUMINANCE_EXT 0x3349 +#define EGL_SMPTE2086_MIN_LUMINANCE_EXT 0x334A + +#define EGLEW_EXT_surface_SMPTE2086_metadata EGLEW_GET_VAR(__EGLEW_EXT_surface_SMPTE2086_metadata) + +#endif /* EGL_EXT_surface_SMPTE2086_metadata */ + +/* -------------------- EGL_EXT_swap_buffers_with_damage ------------------- */ + +#ifndef EGL_EXT_swap_buffers_with_damage +#define EGL_EXT_swap_buffers_with_damage 1 + +typedef EGLBoolean ( * PFNEGLSWAPBUFFERSWITHDAMAGEEXTPROC) (EGLDisplay dpy, EGLSurface surface, EGLint * rects, EGLint n_rects); + +#define eglSwapBuffersWithDamageEXT EGLEW_GET_FUN(__eglewSwapBuffersWithDamageEXT) + +#define EGLEW_EXT_swap_buffers_with_damage EGLEW_GET_VAR(__EGLEW_EXT_swap_buffers_with_damage) + +#endif /* EGL_EXT_swap_buffers_with_damage */ + +/* -------------------------- EGL_EXT_yuv_surface -------------------------- */ + +#ifndef EGL_EXT_yuv_surface +#define EGL_EXT_yuv_surface 1 + +#define EGL_YUV_BUFFER_EXT 0x3300 +#define EGL_YUV_ORDER_EXT 0x3301 +#define EGL_YUV_ORDER_YUV_EXT 0x3302 +#define EGL_YUV_ORDER_YVU_EXT 0x3303 +#define EGL_YUV_ORDER_YUYV_EXT 0x3304 +#define EGL_YUV_ORDER_UYVY_EXT 0x3305 +#define EGL_YUV_ORDER_YVYU_EXT 0x3306 +#define EGL_YUV_ORDER_VYUY_EXT 0x3307 +#define EGL_YUV_ORDER_AYUV_EXT 0x3308 +#define EGL_YUV_CSC_STANDARD_EXT 0x330A +#define EGL_YUV_CSC_STANDARD_601_EXT 0x330B +#define EGL_YUV_CSC_STANDARD_709_EXT 0x330C +#define EGL_YUV_CSC_STANDARD_2020_EXT 0x330D +#define EGL_YUV_NUMBER_OF_PLANES_EXT 0x3311 +#define EGL_YUV_SUBSAMPLE_EXT 0x3312 +#define EGL_YUV_SUBSAMPLE_4_2_0_EXT 0x3313 +#define EGL_YUV_SUBSAMPLE_4_2_2_EXT 0x3314 +#define EGL_YUV_SUBSAMPLE_4_4_4_EXT 0x3315 +#define EGL_YUV_DEPTH_RANGE_EXT 0x3317 +#define EGL_YUV_DEPTH_RANGE_LIMITED_EXT 0x3318 +#define EGL_YUV_DEPTH_RANGE_FULL_EXT 0x3319 +#define EGL_YUV_PLANE_BPP_EXT 0x331A +#define EGL_YUV_PLANE_BPP_0_EXT 0x331B +#define EGL_YUV_PLANE_BPP_8_EXT 0x331C +#define EGL_YUV_PLANE_BPP_10_EXT 0x331D + +#define EGLEW_EXT_yuv_surface EGLEW_GET_VAR(__EGLEW_EXT_yuv_surface) + +#endif /* EGL_EXT_yuv_surface */ + +/* -------------------------- EGL_HI_clientpixmap -------------------------- */ + +#ifndef EGL_HI_clientpixmap +#define EGL_HI_clientpixmap 1 + +#define EGL_CLIENT_PIXMAP_POINTER_HI 0x8F74 + +typedef EGLSurface ( * PFNEGLCREATEPIXMAPSURFACEHIPROC) (EGLDisplay dpy, EGLConfig config, struct EGLClientPixmapHI * pixmap); + +#define eglCreatePixmapSurfaceHI EGLEW_GET_FUN(__eglewCreatePixmapSurfaceHI) + +#define EGLEW_HI_clientpixmap EGLEW_GET_VAR(__EGLEW_HI_clientpixmap) + +#endif /* EGL_HI_clientpixmap */ + +/* -------------------------- EGL_HI_colorformats -------------------------- */ + +#ifndef EGL_HI_colorformats +#define EGL_HI_colorformats 1 + +#define EGL_COLOR_FORMAT_HI 0x8F70 +#define EGL_COLOR_RGB_HI 0x8F71 +#define EGL_COLOR_RGBA_HI 0x8F72 +#define EGL_COLOR_ARGB_HI 0x8F73 + +#define EGLEW_HI_colorformats EGLEW_GET_VAR(__EGLEW_HI_colorformats) + +#endif /* EGL_HI_colorformats */ + +/* ------------------------ EGL_IMG_context_priority ----------------------- */ + +#ifndef EGL_IMG_context_priority +#define EGL_IMG_context_priority 1 + +#define EGL_CONTEXT_PRIORITY_LEVEL_IMG 0x3100 +#define EGL_CONTEXT_PRIORITY_HIGH_IMG 0x3101 +#define EGL_CONTEXT_PRIORITY_MEDIUM_IMG 0x3102 +#define EGL_CONTEXT_PRIORITY_LOW_IMG 0x3103 + +#define EGLEW_IMG_context_priority EGLEW_GET_VAR(__EGLEW_IMG_context_priority) + +#endif /* EGL_IMG_context_priority */ + +/* ---------------------- EGL_IMG_image_plane_attribs ---------------------- */ + +#ifndef EGL_IMG_image_plane_attribs +#define EGL_IMG_image_plane_attribs 1 + +#define EGL_NATIVE_BUFFER_MULTIPLANE_SEPARATE_IMG 0x3105 +#define EGL_NATIVE_BUFFER_PLANE_OFFSET_IMG 0x3106 + +#define EGLEW_IMG_image_plane_attribs EGLEW_GET_VAR(__EGLEW_IMG_image_plane_attribs) + +#endif /* EGL_IMG_image_plane_attribs */ + +/* ---------------------------- EGL_KHR_cl_event --------------------------- */ + +#ifndef EGL_KHR_cl_event +#define EGL_KHR_cl_event 1 + +#define EGL_CL_EVENT_HANDLE_KHR 0x309C +#define EGL_SYNC_CL_EVENT_KHR 0x30FE +#define EGL_SYNC_CL_EVENT_COMPLETE_KHR 0x30FF + +#define EGLEW_KHR_cl_event EGLEW_GET_VAR(__EGLEW_KHR_cl_event) + +#endif /* EGL_KHR_cl_event */ + +/* --------------------------- EGL_KHR_cl_event2 --------------------------- */ + +#ifndef EGL_KHR_cl_event2 +#define EGL_KHR_cl_event2 1 + +#define EGL_CL_EVENT_HANDLE_KHR 0x309C +#define EGL_SYNC_CL_EVENT_KHR 0x30FE +#define EGL_SYNC_CL_EVENT_COMPLETE_KHR 0x30FF + +typedef EGLSyncKHR ( * PFNEGLCREATESYNC64KHRPROC) (EGLDisplay dpy, EGLenum type, const EGLAttribKHR * attrib_list); + +#define eglCreateSync64KHR EGLEW_GET_FUN(__eglewCreateSync64KHR) + +#define EGLEW_KHR_cl_event2 EGLEW_GET_VAR(__EGLEW_KHR_cl_event2) + +#endif /* EGL_KHR_cl_event2 */ + +/* ----------------- EGL_KHR_client_get_all_proc_addresses ----------------- */ + +#ifndef EGL_KHR_client_get_all_proc_addresses +#define EGL_KHR_client_get_all_proc_addresses 1 + +#define EGLEW_KHR_client_get_all_proc_addresses EGLEW_GET_VAR(__EGLEW_KHR_client_get_all_proc_addresses) + +#endif /* EGL_KHR_client_get_all_proc_addresses */ + +/* ------------------------- EGL_KHR_config_attribs ------------------------ */ + +#ifndef EGL_KHR_config_attribs +#define EGL_KHR_config_attribs 1 + +#define EGL_VG_COLORSPACE_LINEAR_BIT_KHR 0x0020 +#define EGL_VG_ALPHA_FORMAT_PRE_BIT_KHR 0x0040 +#define EGL_CONFORMANT_KHR 0x3042 + +#define EGLEW_KHR_config_attribs EGLEW_GET_VAR(__EGLEW_KHR_config_attribs) + +#endif /* EGL_KHR_config_attribs */ + +/* --------------------- EGL_KHR_context_flush_control --------------------- */ + +#ifndef EGL_KHR_context_flush_control +#define EGL_KHR_context_flush_control 1 + +#define EGL_CONTEXT_RELEASE_BEHAVIOR_NONE_KHR 0 +#define EGL_CONTEXT_RELEASE_BEHAVIOR_KHR 0x2097 +#define EGL_CONTEXT_RELEASE_BEHAVIOR_FLUSH_KHR 0x2098 + +#define EGLEW_KHR_context_flush_control EGLEW_GET_VAR(__EGLEW_KHR_context_flush_control) + +#endif /* EGL_KHR_context_flush_control */ + +/* ------------------------- EGL_KHR_create_context ------------------------ */ + +#ifndef EGL_KHR_create_context +#define EGL_KHR_create_context 1 + +#define EGL_CONTEXT_OPENGL_CORE_PROFILE_BIT_KHR 0x00000001 +#define EGL_CONTEXT_OPENGL_DEBUG_BIT_KHR 0x00000001 +#define EGL_CONTEXT_OPENGL_COMPATIBILITY_PROFILE_BIT_KHR 0x00000002 +#define EGL_CONTEXT_OPENGL_FORWARD_COMPATIBLE_BIT_KHR 0x00000002 +#define EGL_CONTEXT_OPENGL_ROBUST_ACCESS_BIT_KHR 0x00000004 +#define EGL_OPENGL_ES3_BIT 0x00000040 +#define EGL_OPENGL_ES3_BIT_KHR 0x00000040 +#define EGL_CONTEXT_MAJOR_VERSION_KHR 0x3098 +#define EGL_CONTEXT_MINOR_VERSION_KHR 0x30FB +#define EGL_CONTEXT_FLAGS_KHR 0x30FC +#define EGL_CONTEXT_OPENGL_PROFILE_MASK_KHR 0x30FD +#define EGL_CONTEXT_OPENGL_RESET_NOTIFICATION_STRATEGY_KHR 0x31BD +#define EGL_NO_RESET_NOTIFICATION_KHR 0x31BE +#define EGL_LOSE_CONTEXT_ON_RESET_KHR 0x31BF + +#define EGLEW_KHR_create_context EGLEW_GET_VAR(__EGLEW_KHR_create_context) + +#endif /* EGL_KHR_create_context */ + +/* -------------------- EGL_KHR_create_context_no_error -------------------- */ + +#ifndef EGL_KHR_create_context_no_error +#define EGL_KHR_create_context_no_error 1 + +#define EGL_CONTEXT_OPENGL_NO_ERROR_KHR 0x31B3 + +#define EGLEW_KHR_create_context_no_error EGLEW_GET_VAR(__EGLEW_KHR_create_context_no_error) + +#endif /* EGL_KHR_create_context_no_error */ + +/* ----------------------------- EGL_KHR_debug ----------------------------- */ + +#ifndef EGL_KHR_debug +#define EGL_KHR_debug 1 + +#define EGL_OBJECT_THREAD_KHR 0x33B0 +#define EGL_OBJECT_DISPLAY_KHR 0x33B1 +#define EGL_OBJECT_CONTEXT_KHR 0x33B2 +#define EGL_OBJECT_SURFACE_KHR 0x33B3 +#define EGL_OBJECT_IMAGE_KHR 0x33B4 +#define EGL_OBJECT_SYNC_KHR 0x33B5 +#define EGL_OBJECT_STREAM_KHR 0x33B6 +#define EGL_DEBUG_CALLBACK_KHR 0x33B8 +#define EGL_DEBUG_MSG_CRITICAL_KHR 0x33B9 +#define EGL_DEBUG_MSG_ERROR_KHR 0x33BA +#define EGL_DEBUG_MSG_WARN_KHR 0x33BB +#define EGL_DEBUG_MSG_INFO_KHR 0x33BC + +typedef EGLint ( * PFNEGLDEBUGMESSAGECONTROLKHRPROC) (EGLDEBUGPROCKHR callback, const EGLAttrib * attrib_list); +typedef EGLint ( * PFNEGLLABELOBJECTKHRPROC) (EGLDisplay display, EGLenum objectType, EGLObjectKHR object, EGLLabelKHR label); +typedef EGLBoolean ( * PFNEGLQUERYDEBUGKHRPROC) (EGLint attribute, EGLAttrib * value); + +#define eglDebugMessageControlKHR EGLEW_GET_FUN(__eglewDebugMessageControlKHR) +#define eglLabelObjectKHR EGLEW_GET_FUN(__eglewLabelObjectKHR) +#define eglQueryDebugKHR EGLEW_GET_FUN(__eglewQueryDebugKHR) + +#define EGLEW_KHR_debug EGLEW_GET_VAR(__EGLEW_KHR_debug) + +#endif /* EGL_KHR_debug */ + +/* --------------------------- EGL_KHR_fence_sync -------------------------- */ + +#ifndef EGL_KHR_fence_sync +#define EGL_KHR_fence_sync 1 + +#define EGL_SYNC_PRIOR_COMMANDS_COMPLETE_KHR 0x30F0 +#define EGL_SYNC_CONDITION_KHR 0x30F8 +#define EGL_SYNC_FENCE_KHR 0x30F9 + +#define EGLEW_KHR_fence_sync EGLEW_GET_VAR(__EGLEW_KHR_fence_sync) + +#endif /* EGL_KHR_fence_sync */ + +/* --------------------- EGL_KHR_get_all_proc_addresses -------------------- */ + +#ifndef EGL_KHR_get_all_proc_addresses +#define EGL_KHR_get_all_proc_addresses 1 + +#define EGLEW_KHR_get_all_proc_addresses EGLEW_GET_VAR(__EGLEW_KHR_get_all_proc_addresses) + +#endif /* EGL_KHR_get_all_proc_addresses */ + +/* ------------------------- EGL_KHR_gl_colorspace ------------------------- */ + +#ifndef EGL_KHR_gl_colorspace +#define EGL_KHR_gl_colorspace 1 + +#define EGL_GL_COLORSPACE_SRGB_KHR 0x3089 +#define EGL_GL_COLORSPACE_LINEAR_KHR 0x308A +#define EGL_GL_COLORSPACE_KHR 0x309D + +#define EGLEW_KHR_gl_colorspace EGLEW_GET_VAR(__EGLEW_KHR_gl_colorspace) + +#endif /* EGL_KHR_gl_colorspace */ + +/* --------------------- EGL_KHR_gl_renderbuffer_image --------------------- */ + +#ifndef EGL_KHR_gl_renderbuffer_image +#define EGL_KHR_gl_renderbuffer_image 1 + +#define EGL_GL_RENDERBUFFER_KHR 0x30B9 + +#define EGLEW_KHR_gl_renderbuffer_image EGLEW_GET_VAR(__EGLEW_KHR_gl_renderbuffer_image) + +#endif /* EGL_KHR_gl_renderbuffer_image */ + +/* ---------------------- EGL_KHR_gl_texture_2D_image ---------------------- */ + +#ifndef EGL_KHR_gl_texture_2D_image +#define EGL_KHR_gl_texture_2D_image 1 + +#define EGL_GL_TEXTURE_2D_KHR 0x30B1 +#define EGL_GL_TEXTURE_LEVEL_KHR 0x30BC + +#define EGLEW_KHR_gl_texture_2D_image EGLEW_GET_VAR(__EGLEW_KHR_gl_texture_2D_image) + +#endif /* EGL_KHR_gl_texture_2D_image */ + +/* ---------------------- EGL_KHR_gl_texture_3D_image ---------------------- */ + +#ifndef EGL_KHR_gl_texture_3D_image +#define EGL_KHR_gl_texture_3D_image 1 + +#define EGL_GL_TEXTURE_3D_KHR 0x30B2 +#define EGL_GL_TEXTURE_ZOFFSET_KHR 0x30BD + +#define EGLEW_KHR_gl_texture_3D_image EGLEW_GET_VAR(__EGLEW_KHR_gl_texture_3D_image) + +#endif /* EGL_KHR_gl_texture_3D_image */ + +/* -------------------- EGL_KHR_gl_texture_cubemap_image ------------------- */ + +#ifndef EGL_KHR_gl_texture_cubemap_image +#define EGL_KHR_gl_texture_cubemap_image 1 + +#define EGL_GL_TEXTURE_CUBE_MAP_POSITIVE_X_KHR 0x30B3 +#define EGL_GL_TEXTURE_CUBE_MAP_NEGATIVE_X_KHR 0x30B4 +#define EGL_GL_TEXTURE_CUBE_MAP_POSITIVE_Y_KHR 0x30B5 +#define EGL_GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_KHR 0x30B6 +#define EGL_GL_TEXTURE_CUBE_MAP_POSITIVE_Z_KHR 0x30B7 +#define EGL_GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_KHR 0x30B8 + +#define EGLEW_KHR_gl_texture_cubemap_image EGLEW_GET_VAR(__EGLEW_KHR_gl_texture_cubemap_image) + +#endif /* EGL_KHR_gl_texture_cubemap_image */ + +/* ----------------------------- EGL_KHR_image ----------------------------- */ + +#ifndef EGL_KHR_image +#define EGL_KHR_image 1 + +#define EGL_NATIVE_PIXMAP_KHR 0x30B0 + +typedef EGLImageKHR ( * PFNEGLCREATEIMAGEKHRPROC) (EGLDisplay dpy, EGLContext ctx, EGLenum target, EGLClientBuffer buffer, const EGLint * attrib_list); +typedef EGLBoolean ( * PFNEGLDESTROYIMAGEKHRPROC) (EGLDisplay dpy, EGLImageKHR image); + +#define eglCreateImageKHR EGLEW_GET_FUN(__eglewCreateImageKHR) +#define eglDestroyImageKHR EGLEW_GET_FUN(__eglewDestroyImageKHR) + +#define EGLEW_KHR_image EGLEW_GET_VAR(__EGLEW_KHR_image) + +#endif /* EGL_KHR_image */ + +/* --------------------------- EGL_KHR_image_base -------------------------- */ + +#ifndef EGL_KHR_image_base +#define EGL_KHR_image_base 1 + +#define EGL_IMAGE_PRESERVED_KHR 0x30D2 + +#define EGLEW_KHR_image_base EGLEW_GET_VAR(__EGLEW_KHR_image_base) + +#endif /* EGL_KHR_image_base */ + +/* -------------------------- EGL_KHR_image_pixmap ------------------------- */ + +#ifndef EGL_KHR_image_pixmap +#define EGL_KHR_image_pixmap 1 + +#define EGL_NATIVE_PIXMAP_KHR 0x30B0 + +#define EGLEW_KHR_image_pixmap EGLEW_GET_VAR(__EGLEW_KHR_image_pixmap) + +#endif /* EGL_KHR_image_pixmap */ + +/* -------------------------- EGL_KHR_lock_surface ------------------------- */ + +#ifndef EGL_KHR_lock_surface +#define EGL_KHR_lock_surface 1 + +#define EGL_READ_SURFACE_BIT_KHR 0x0001 +#define EGL_WRITE_SURFACE_BIT_KHR 0x0002 +#define EGL_LOCK_SURFACE_BIT_KHR 0x0080 +#define EGL_OPTIMAL_FORMAT_BIT_KHR 0x0100 +#define EGL_MATCH_FORMAT_KHR 0x3043 +#define EGL_FORMAT_RGB_565_EXACT_KHR 0x30C0 +#define EGL_FORMAT_RGB_565_KHR 0x30C1 +#define EGL_FORMAT_RGBA_8888_EXACT_KHR 0x30C2 +#define EGL_FORMAT_RGBA_8888_KHR 0x30C3 +#define EGL_MAP_PRESERVE_PIXELS_KHR 0x30C4 +#define EGL_LOCK_USAGE_HINT_KHR 0x30C5 +#define EGL_BITMAP_POINTER_KHR 0x30C6 +#define EGL_BITMAP_PITCH_KHR 0x30C7 +#define EGL_BITMAP_ORIGIN_KHR 0x30C8 +#define EGL_BITMAP_PIXEL_RED_OFFSET_KHR 0x30C9 +#define EGL_BITMAP_PIXEL_GREEN_OFFSET_KHR 0x30CA +#define EGL_BITMAP_PIXEL_BLUE_OFFSET_KHR 0x30CB +#define EGL_BITMAP_PIXEL_ALPHA_OFFSET_KHR 0x30CC +#define EGL_BITMAP_PIXEL_LUMINANCE_OFFSET_KHR 0x30CD +#define EGL_LOWER_LEFT_KHR 0x30CE +#define EGL_UPPER_LEFT_KHR 0x30CF + +typedef EGLBoolean ( * PFNEGLLOCKSURFACEKHRPROC) (EGLDisplay dpy, EGLSurface surface, const EGLint * attrib_list); +typedef EGLBoolean ( * PFNEGLUNLOCKSURFACEKHRPROC) (EGLDisplay dpy, EGLSurface surface); + +#define eglLockSurfaceKHR EGLEW_GET_FUN(__eglewLockSurfaceKHR) +#define eglUnlockSurfaceKHR EGLEW_GET_FUN(__eglewUnlockSurfaceKHR) + +#define EGLEW_KHR_lock_surface EGLEW_GET_VAR(__EGLEW_KHR_lock_surface) + +#endif /* EGL_KHR_lock_surface */ + +/* ------------------------- EGL_KHR_lock_surface2 ------------------------- */ + +#ifndef EGL_KHR_lock_surface2 +#define EGL_KHR_lock_surface2 1 + +#define EGL_BITMAP_PIXEL_SIZE_KHR 0x3110 + +#define EGLEW_KHR_lock_surface2 EGLEW_GET_VAR(__EGLEW_KHR_lock_surface2) + +#endif /* EGL_KHR_lock_surface2 */ + +/* ------------------------- EGL_KHR_lock_surface3 ------------------------- */ + +#ifndef EGL_KHR_lock_surface3 +#define EGL_KHR_lock_surface3 1 + +#define EGL_READ_SURFACE_BIT_KHR 0x0001 +#define EGL_WRITE_SURFACE_BIT_KHR 0x0002 +#define EGL_LOCK_SURFACE_BIT_KHR 0x0080 +#define EGL_OPTIMAL_FORMAT_BIT_KHR 0x0100 +#define EGL_MATCH_FORMAT_KHR 0x3043 +#define EGL_FORMAT_RGB_565_EXACT_KHR 0x30C0 +#define EGL_FORMAT_RGB_565_KHR 0x30C1 +#define EGL_FORMAT_RGBA_8888_EXACT_KHR 0x30C2 +#define EGL_FORMAT_RGBA_8888_KHR 0x30C3 +#define EGL_MAP_PRESERVE_PIXELS_KHR 0x30C4 +#define EGL_LOCK_USAGE_HINT_KHR 0x30C5 +#define EGL_BITMAP_POINTER_KHR 0x30C6 +#define EGL_BITMAP_PITCH_KHR 0x30C7 +#define EGL_BITMAP_ORIGIN_KHR 0x30C8 +#define EGL_BITMAP_PIXEL_RED_OFFSET_KHR 0x30C9 +#define EGL_BITMAP_PIXEL_GREEN_OFFSET_KHR 0x30CA +#define EGL_BITMAP_PIXEL_BLUE_OFFSET_KHR 0x30CB +#define EGL_BITMAP_PIXEL_ALPHA_OFFSET_KHR 0x30CC +#define EGL_BITMAP_PIXEL_LUMINANCE_OFFSET_KHR 0x30CD +#define EGL_LOWER_LEFT_KHR 0x30CE +#define EGL_UPPER_LEFT_KHR 0x30CF +#define EGL_BITMAP_PIXEL_SIZE_KHR 0x3110 + +typedef EGLBoolean ( * PFNEGLQUERYSURFACE64KHRPROC) (EGLDisplay dpy, EGLSurface surface, EGLint attribute, EGLAttribKHR * value); + +#define eglQuerySurface64KHR EGLEW_GET_FUN(__eglewQuerySurface64KHR) + +#define EGLEW_KHR_lock_surface3 EGLEW_GET_VAR(__EGLEW_KHR_lock_surface3) + +#endif /* EGL_KHR_lock_surface3 */ + +/* --------------------- EGL_KHR_mutable_render_buffer --------------------- */ + +#ifndef EGL_KHR_mutable_render_buffer +#define EGL_KHR_mutable_render_buffer 1 + +#define EGL_MUTABLE_RENDER_BUFFER_BIT_KHR 0x1000 + +#define EGLEW_KHR_mutable_render_buffer EGLEW_GET_VAR(__EGLEW_KHR_mutable_render_buffer) + +#endif /* EGL_KHR_mutable_render_buffer */ + +/* ----------------------- EGL_KHR_no_config_context ----------------------- */ + +#ifndef EGL_KHR_no_config_context +#define EGL_KHR_no_config_context 1 + +#define EGLEW_KHR_no_config_context EGLEW_GET_VAR(__EGLEW_KHR_no_config_context) + +#endif /* EGL_KHR_no_config_context */ + +/* ------------------------- EGL_KHR_partial_update ------------------------ */ + +#ifndef EGL_KHR_partial_update +#define EGL_KHR_partial_update 1 + +#define EGL_BUFFER_AGE_KHR 0x313D + +typedef EGLBoolean ( * PFNEGLSETDAMAGEREGIONKHRPROC) (EGLDisplay dpy, EGLSurface surface, EGLint * rects, EGLint n_rects); + +#define eglSetDamageRegionKHR EGLEW_GET_FUN(__eglewSetDamageRegionKHR) + +#define EGLEW_KHR_partial_update EGLEW_GET_VAR(__EGLEW_KHR_partial_update) + +#endif /* EGL_KHR_partial_update */ + +/* ------------------------ EGL_KHR_platform_android ----------------------- */ + +#ifndef EGL_KHR_platform_android +#define EGL_KHR_platform_android 1 + +#define EGL_PLATFORM_ANDROID_KHR 0x3141 + +#define EGLEW_KHR_platform_android EGLEW_GET_VAR(__EGLEW_KHR_platform_android) + +#endif /* EGL_KHR_platform_android */ + +/* -------------------------- EGL_KHR_platform_gbm ------------------------- */ + +#ifndef EGL_KHR_platform_gbm +#define EGL_KHR_platform_gbm 1 + +#define EGL_PLATFORM_GBM_KHR 0x31D7 + +#define EGLEW_KHR_platform_gbm EGLEW_GET_VAR(__EGLEW_KHR_platform_gbm) + +#endif /* EGL_KHR_platform_gbm */ + +/* ------------------------ EGL_KHR_platform_wayland ----------------------- */ + +#ifndef EGL_KHR_platform_wayland +#define EGL_KHR_platform_wayland 1 + +#define EGL_PLATFORM_WAYLAND_KHR 0x31D8 + +#define EGLEW_KHR_platform_wayland EGLEW_GET_VAR(__EGLEW_KHR_platform_wayland) + +#endif /* EGL_KHR_platform_wayland */ + +/* -------------------------- EGL_KHR_platform_x11 ------------------------- */ + +#ifndef EGL_KHR_platform_x11 +#define EGL_KHR_platform_x11 1 + +#define EGL_PLATFORM_X11_KHR 0x31D5 +#define EGL_PLATFORM_X11_SCREEN_KHR 0x31D6 + +#define EGLEW_KHR_platform_x11 EGLEW_GET_VAR(__EGLEW_KHR_platform_x11) + +#endif /* EGL_KHR_platform_x11 */ + +/* ------------------------- EGL_KHR_reusable_sync ------------------------- */ + +#ifndef EGL_KHR_reusable_sync +#define EGL_KHR_reusable_sync 1 + +#define EGL_SYNC_FLUSH_COMMANDS_BIT_KHR 0x0001 +#define EGL_SYNC_STATUS_KHR 0x30F1 +#define EGL_SIGNALED_KHR 0x30F2 +#define EGL_UNSIGNALED_KHR 0x30F3 +#define EGL_TIMEOUT_EXPIRED_KHR 0x30F5 +#define EGL_CONDITION_SATISFIED_KHR 0x30F6 +#define EGL_SYNC_TYPE_KHR 0x30F7 +#define EGL_SYNC_REUSABLE_KHR 0x30FA +#define EGL_FOREVER_KHR 0xFFFFFFFFFFFFFFFF + +typedef EGLint ( * PFNEGLCLIENTWAITSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint flags, EGLTimeKHR timeout); +typedef EGLSyncKHR ( * PFNEGLCREATESYNCKHRPROC) (EGLDisplay dpy, EGLenum type, const EGLint * attrib_list); +typedef EGLBoolean ( * PFNEGLDESTROYSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync); +typedef EGLBoolean ( * PFNEGLGETSYNCATTRIBKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint attribute, EGLint * value); +typedef EGLBoolean ( * PFNEGLSIGNALSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLenum mode); + +#define eglClientWaitSyncKHR EGLEW_GET_FUN(__eglewClientWaitSyncKHR) +#define eglCreateSyncKHR EGLEW_GET_FUN(__eglewCreateSyncKHR) +#define eglDestroySyncKHR EGLEW_GET_FUN(__eglewDestroySyncKHR) +#define eglGetSyncAttribKHR EGLEW_GET_FUN(__eglewGetSyncAttribKHR) +#define eglSignalSyncKHR EGLEW_GET_FUN(__eglewSignalSyncKHR) + +#define EGLEW_KHR_reusable_sync EGLEW_GET_VAR(__EGLEW_KHR_reusable_sync) + +#endif /* EGL_KHR_reusable_sync */ + +/* ----------------------------- EGL_KHR_stream ---------------------------- */ + +#ifndef EGL_KHR_stream +#define EGL_KHR_stream 1 + +#define EGL_CONSUMER_LATENCY_USEC_KHR 0x3210 +#define EGL_PRODUCER_FRAME_KHR 0x3212 +#define EGL_CONSUMER_FRAME_KHR 0x3213 +#define EGL_STREAM_STATE_KHR 0x3214 +#define EGL_STREAM_STATE_CREATED_KHR 0x3215 +#define EGL_STREAM_STATE_CONNECTING_KHR 0x3216 +#define EGL_STREAM_STATE_EMPTY_KHR 0x3217 +#define EGL_STREAM_STATE_NEW_FRAME_AVAILABLE_KHR 0x3218 +#define EGL_STREAM_STATE_OLD_FRAME_AVAILABLE_KHR 0x3219 +#define EGL_STREAM_STATE_DISCONNECTED_KHR 0x321A +#define EGL_BAD_STREAM_KHR 0x321B +#define EGL_BAD_STATE_KHR 0x321C + +typedef EGLStreamKHR ( * PFNEGLCREATESTREAMKHRPROC) (EGLDisplay dpy, const EGLint * attrib_list); +typedef EGLBoolean ( * PFNEGLDESTROYSTREAMKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream); +typedef EGLBoolean ( * PFNEGLQUERYSTREAMKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLint * value); +typedef EGLBoolean ( * PFNEGLQUERYSTREAMU64KHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLuint64KHR * value); +typedef EGLBoolean ( * PFNEGLSTREAMATTRIBKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLint value); + +#define eglCreateStreamKHR EGLEW_GET_FUN(__eglewCreateStreamKHR) +#define eglDestroyStreamKHR EGLEW_GET_FUN(__eglewDestroyStreamKHR) +#define eglQueryStreamKHR EGLEW_GET_FUN(__eglewQueryStreamKHR) +#define eglQueryStreamu64KHR EGLEW_GET_FUN(__eglewQueryStreamu64KHR) +#define eglStreamAttribKHR EGLEW_GET_FUN(__eglewStreamAttribKHR) + +#define EGLEW_KHR_stream EGLEW_GET_VAR(__EGLEW_KHR_stream) + +#endif /* EGL_KHR_stream */ + +/* ------------------------- EGL_KHR_stream_attrib ------------------------- */ + +#ifndef EGL_KHR_stream_attrib +#define EGL_KHR_stream_attrib 1 + +#define EGL_CONSUMER_LATENCY_USEC_KHR 0x3210 +#define EGL_STREAM_STATE_KHR 0x3214 +#define EGL_STREAM_STATE_CREATED_KHR 0x3215 +#define EGL_STREAM_STATE_CONNECTING_KHR 0x3216 + +typedef EGLStreamKHR ( * PFNEGLCREATESTREAMATTRIBKHRPROC) (EGLDisplay dpy, const EGLAttrib * attrib_list); +typedef EGLBoolean ( * PFNEGLQUERYSTREAMATTRIBKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLAttrib * value); +typedef EGLBoolean ( * PFNEGLSETSTREAMATTRIBKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLAttrib value); +typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERACQUIREATTRIBKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, const EGLAttrib * attrib_list); +typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERRELEASEATTRIBKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, const EGLAttrib * attrib_list); + +#define eglCreateStreamAttribKHR EGLEW_GET_FUN(__eglewCreateStreamAttribKHR) +#define eglQueryStreamAttribKHR EGLEW_GET_FUN(__eglewQueryStreamAttribKHR) +#define eglSetStreamAttribKHR EGLEW_GET_FUN(__eglewSetStreamAttribKHR) +#define eglStreamConsumerAcquireAttribKHR EGLEW_GET_FUN(__eglewStreamConsumerAcquireAttribKHR) +#define eglStreamConsumerReleaseAttribKHR EGLEW_GET_FUN(__eglewStreamConsumerReleaseAttribKHR) + +#define EGLEW_KHR_stream_attrib EGLEW_GET_VAR(__EGLEW_KHR_stream_attrib) + +#endif /* EGL_KHR_stream_attrib */ + +/* ------------------- EGL_KHR_stream_consumer_gltexture ------------------- */ + +#ifndef EGL_KHR_stream_consumer_gltexture +#define EGL_KHR_stream_consumer_gltexture 1 + +#define EGL_CONSUMER_ACQUIRE_TIMEOUT_USEC_KHR 0x321E + +typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERACQUIREKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream); +typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERGLTEXTUREEXTERNALKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream); +typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERRELEASEKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream); + +#define eglStreamConsumerAcquireKHR EGLEW_GET_FUN(__eglewStreamConsumerAcquireKHR) +#define eglStreamConsumerGLTextureExternalKHR EGLEW_GET_FUN(__eglewStreamConsumerGLTextureExternalKHR) +#define eglStreamConsumerReleaseKHR EGLEW_GET_FUN(__eglewStreamConsumerReleaseKHR) + +#define EGLEW_KHR_stream_consumer_gltexture EGLEW_GET_VAR(__EGLEW_KHR_stream_consumer_gltexture) + +#endif /* EGL_KHR_stream_consumer_gltexture */ + +/* -------------------- EGL_KHR_stream_cross_process_fd -------------------- */ + +#ifndef EGL_KHR_stream_cross_process_fd +#define EGL_KHR_stream_cross_process_fd 1 + +typedef EGLStreamKHR ( * PFNEGLCREATESTREAMFROMFILEDESCRIPTORKHRPROC) (EGLDisplay dpy, EGLNativeFileDescriptorKHR file_descriptor); +typedef EGLNativeFileDescriptorKHR ( * PFNEGLGETSTREAMFILEDESCRIPTORKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream); + +#define eglCreateStreamFromFileDescriptorKHR EGLEW_GET_FUN(__eglewCreateStreamFromFileDescriptorKHR) +#define eglGetStreamFileDescriptorKHR EGLEW_GET_FUN(__eglewGetStreamFileDescriptorKHR) + +#define EGLEW_KHR_stream_cross_process_fd EGLEW_GET_VAR(__EGLEW_KHR_stream_cross_process_fd) + +#endif /* EGL_KHR_stream_cross_process_fd */ + +/* -------------------------- EGL_KHR_stream_fifo -------------------------- */ + +#ifndef EGL_KHR_stream_fifo +#define EGL_KHR_stream_fifo 1 + +#define EGL_STREAM_FIFO_LENGTH_KHR 0x31FC +#define EGL_STREAM_TIME_NOW_KHR 0x31FD +#define EGL_STREAM_TIME_CONSUMER_KHR 0x31FE +#define EGL_STREAM_TIME_PRODUCER_KHR 0x31FF + +typedef EGLBoolean ( * PFNEGLQUERYSTREAMTIMEKHRPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum attribute, EGLTimeKHR * value); + +#define eglQueryStreamTimeKHR EGLEW_GET_FUN(__eglewQueryStreamTimeKHR) + +#define EGLEW_KHR_stream_fifo EGLEW_GET_VAR(__EGLEW_KHR_stream_fifo) + +#endif /* EGL_KHR_stream_fifo */ + +/* ----------------- EGL_KHR_stream_producer_aldatalocator ----------------- */ + +#ifndef EGL_KHR_stream_producer_aldatalocator +#define EGL_KHR_stream_producer_aldatalocator 1 + +#define EGLEW_KHR_stream_producer_aldatalocator EGLEW_GET_VAR(__EGLEW_KHR_stream_producer_aldatalocator) + +#endif /* EGL_KHR_stream_producer_aldatalocator */ + +/* ------------------- EGL_KHR_stream_producer_eglsurface ------------------ */ + +#ifndef EGL_KHR_stream_producer_eglsurface +#define EGL_KHR_stream_producer_eglsurface 1 + +#define EGL_STREAM_BIT_KHR 0x0800 + +typedef EGLSurface ( * PFNEGLCREATESTREAMPRODUCERSURFACEKHRPROC) (EGLDisplay dpy, EGLConfig config, EGLStreamKHR stream, const EGLint * attrib_list); + +#define eglCreateStreamProducerSurfaceKHR EGLEW_GET_FUN(__eglewCreateStreamProducerSurfaceKHR) + +#define EGLEW_KHR_stream_producer_eglsurface EGLEW_GET_VAR(__EGLEW_KHR_stream_producer_eglsurface) + +#endif /* EGL_KHR_stream_producer_eglsurface */ + +/* ---------------------- EGL_KHR_surfaceless_context ---------------------- */ + +#ifndef EGL_KHR_surfaceless_context +#define EGL_KHR_surfaceless_context 1 + +#define EGLEW_KHR_surfaceless_context EGLEW_GET_VAR(__EGLEW_KHR_surfaceless_context) + +#endif /* EGL_KHR_surfaceless_context */ + +/* -------------------- EGL_KHR_swap_buffers_with_damage ------------------- */ + +#ifndef EGL_KHR_swap_buffers_with_damage +#define EGL_KHR_swap_buffers_with_damage 1 + +typedef EGLBoolean ( * PFNEGLSWAPBUFFERSWITHDAMAGEKHRPROC) (EGLDisplay dpy, EGLSurface surface, EGLint * rects, EGLint n_rects); + +#define eglSwapBuffersWithDamageKHR EGLEW_GET_FUN(__eglewSwapBuffersWithDamageKHR) + +#define EGLEW_KHR_swap_buffers_with_damage EGLEW_GET_VAR(__EGLEW_KHR_swap_buffers_with_damage) + +#endif /* EGL_KHR_swap_buffers_with_damage */ + +/* ------------------------ EGL_KHR_vg_parent_image ------------------------ */ + +#ifndef EGL_KHR_vg_parent_image +#define EGL_KHR_vg_parent_image 1 + +#define EGL_VG_PARENT_IMAGE_KHR 0x30BA + +#define EGLEW_KHR_vg_parent_image EGLEW_GET_VAR(__EGLEW_KHR_vg_parent_image) + +#endif /* EGL_KHR_vg_parent_image */ + +/* --------------------------- EGL_KHR_wait_sync --------------------------- */ + +#ifndef EGL_KHR_wait_sync +#define EGL_KHR_wait_sync 1 + +typedef EGLint ( * PFNEGLWAITSYNCKHRPROC) (EGLDisplay dpy, EGLSyncKHR sync, EGLint flags); + +#define eglWaitSyncKHR EGLEW_GET_FUN(__eglewWaitSyncKHR) + +#define EGLEW_KHR_wait_sync EGLEW_GET_VAR(__EGLEW_KHR_wait_sync) + +#endif /* EGL_KHR_wait_sync */ + +/* --------------------------- EGL_MESA_drm_image -------------------------- */ + +#ifndef EGL_MESA_drm_image +#define EGL_MESA_drm_image 1 + +#define EGL_DRM_BUFFER_USE_SCANOUT_MESA 0x00000001 +#define EGL_DRM_BUFFER_USE_SHARE_MESA 0x00000002 +#define EGL_DRM_BUFFER_FORMAT_MESA 0x31D0 +#define EGL_DRM_BUFFER_USE_MESA 0x31D1 +#define EGL_DRM_BUFFER_FORMAT_ARGB32_MESA 0x31D2 +#define EGL_DRM_BUFFER_MESA 0x31D3 +#define EGL_DRM_BUFFER_STRIDE_MESA 0x31D4 + +typedef EGLImageKHR ( * PFNEGLCREATEDRMIMAGEMESAPROC) (EGLDisplay dpy, const EGLint * attrib_list); +typedef EGLBoolean ( * PFNEGLEXPORTDRMIMAGEMESAPROC) (EGLDisplay dpy, EGLImageKHR image, EGLint * name, EGLint * handle, EGLint * stride); + +#define eglCreateDRMImageMESA EGLEW_GET_FUN(__eglewCreateDRMImageMESA) +#define eglExportDRMImageMESA EGLEW_GET_FUN(__eglewExportDRMImageMESA) + +#define EGLEW_MESA_drm_image EGLEW_GET_VAR(__EGLEW_MESA_drm_image) + +#endif /* EGL_MESA_drm_image */ + +/* --------------------- EGL_MESA_image_dma_buf_export --------------------- */ + +#ifndef EGL_MESA_image_dma_buf_export +#define EGL_MESA_image_dma_buf_export 1 + +typedef EGLBoolean ( * PFNEGLEXPORTDMABUFIMAGEMESAPROC) (EGLDisplay dpy, EGLImageKHR image, int * fds, EGLint * strides, EGLint * offsets); +typedef EGLBoolean ( * PFNEGLEXPORTDMABUFIMAGEQUERYMESAPROC) (EGLDisplay dpy, EGLImageKHR image, int * fourcc, int * num_planes, EGLuint64KHR * modifiers); + +#define eglExportDMABUFImageMESA EGLEW_GET_FUN(__eglewExportDMABUFImageMESA) +#define eglExportDMABUFImageQueryMESA EGLEW_GET_FUN(__eglewExportDMABUFImageQueryMESA) + +#define EGLEW_MESA_image_dma_buf_export EGLEW_GET_VAR(__EGLEW_MESA_image_dma_buf_export) + +#endif /* EGL_MESA_image_dma_buf_export */ + +/* ------------------------- EGL_MESA_platform_gbm ------------------------- */ + +#ifndef EGL_MESA_platform_gbm +#define EGL_MESA_platform_gbm 1 + +#define EGL_PLATFORM_GBM_MESA 0x31D7 + +#define EGLEW_MESA_platform_gbm EGLEW_GET_VAR(__EGLEW_MESA_platform_gbm) + +#endif /* EGL_MESA_platform_gbm */ + +/* --------------------- EGL_MESA_platform_surfaceless --------------------- */ + +#ifndef EGL_MESA_platform_surfaceless +#define EGL_MESA_platform_surfaceless 1 + +#define EGL_PLATFORM_SURFACELESS_MESA 0x31DD + +#define EGLEW_MESA_platform_surfaceless EGLEW_GET_VAR(__EGLEW_MESA_platform_surfaceless) + +#endif /* EGL_MESA_platform_surfaceless */ + +/* -------------------------- EGL_NOK_swap_region -------------------------- */ + +#ifndef EGL_NOK_swap_region +#define EGL_NOK_swap_region 1 + +typedef EGLBoolean ( * PFNEGLSWAPBUFFERSREGIONNOKPROC) (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint * rects); + +#define eglSwapBuffersRegionNOK EGLEW_GET_FUN(__eglewSwapBuffersRegionNOK) + +#define EGLEW_NOK_swap_region EGLEW_GET_VAR(__EGLEW_NOK_swap_region) + +#endif /* EGL_NOK_swap_region */ + +/* -------------------------- EGL_NOK_swap_region2 ------------------------- */ + +#ifndef EGL_NOK_swap_region2 +#define EGL_NOK_swap_region2 1 + +typedef EGLBoolean ( * PFNEGLSWAPBUFFERSREGION2NOKPROC) (EGLDisplay dpy, EGLSurface surface, EGLint numRects, const EGLint * rects); + +#define eglSwapBuffersRegion2NOK EGLEW_GET_FUN(__eglewSwapBuffersRegion2NOK) + +#define EGLEW_NOK_swap_region2 EGLEW_GET_VAR(__EGLEW_NOK_swap_region2) + +#endif /* EGL_NOK_swap_region2 */ + +/* ---------------------- EGL_NOK_texture_from_pixmap ---------------------- */ + +#ifndef EGL_NOK_texture_from_pixmap +#define EGL_NOK_texture_from_pixmap 1 + +#define EGL_Y_INVERTED_NOK 0x307F + +#define EGLEW_NOK_texture_from_pixmap EGLEW_GET_VAR(__EGLEW_NOK_texture_from_pixmap) + +#endif /* EGL_NOK_texture_from_pixmap */ + +/* ------------------------ EGL_NV_3dvision_surface ------------------------ */ + +#ifndef EGL_NV_3dvision_surface +#define EGL_NV_3dvision_surface 1 + +#define EGL_AUTO_STEREO_NV 0x3136 + +#define EGLEW_NV_3dvision_surface EGLEW_GET_VAR(__EGLEW_NV_3dvision_surface) + +#endif /* EGL_NV_3dvision_surface */ + +/* ------------------------- EGL_NV_coverage_sample ------------------------ */ + +#ifndef EGL_NV_coverage_sample +#define EGL_NV_coverage_sample 1 + +#define EGL_COVERAGE_BUFFERS_NV 0x30E0 +#define EGL_COVERAGE_SAMPLES_NV 0x30E1 + +#define EGLEW_NV_coverage_sample EGLEW_GET_VAR(__EGLEW_NV_coverage_sample) + +#endif /* EGL_NV_coverage_sample */ + +/* --------------------- EGL_NV_coverage_sample_resolve -------------------- */ + +#ifndef EGL_NV_coverage_sample_resolve +#define EGL_NV_coverage_sample_resolve 1 + +#define EGL_COVERAGE_SAMPLE_RESOLVE_NV 0x3131 +#define EGL_COVERAGE_SAMPLE_RESOLVE_DEFAULT_NV 0x3132 +#define EGL_COVERAGE_SAMPLE_RESOLVE_NONE_NV 0x3133 + +#define EGLEW_NV_coverage_sample_resolve EGLEW_GET_VAR(__EGLEW_NV_coverage_sample_resolve) + +#endif /* EGL_NV_coverage_sample_resolve */ + +/* --------------------------- EGL_NV_cuda_event --------------------------- */ + +#ifndef EGL_NV_cuda_event +#define EGL_NV_cuda_event 1 + +#define EGL_CUDA_EVENT_HANDLE_NV 0x323B +#define EGL_SYNC_CUDA_EVENT_NV 0x323C +#define EGL_SYNC_CUDA_EVENT_COMPLETE_NV 0x323D + +#define EGLEW_NV_cuda_event EGLEW_GET_VAR(__EGLEW_NV_cuda_event) + +#endif /* EGL_NV_cuda_event */ + +/* ------------------------- EGL_NV_depth_nonlinear ------------------------ */ + +#ifndef EGL_NV_depth_nonlinear +#define EGL_NV_depth_nonlinear 1 + +#define EGL_DEPTH_ENCODING_NONE_NV 0 +#define EGL_DEPTH_ENCODING_NV 0x30E2 +#define EGL_DEPTH_ENCODING_NONLINEAR_NV 0x30E3 + +#define EGLEW_NV_depth_nonlinear EGLEW_GET_VAR(__EGLEW_NV_depth_nonlinear) + +#endif /* EGL_NV_depth_nonlinear */ + +/* --------------------------- EGL_NV_device_cuda -------------------------- */ + +#ifndef EGL_NV_device_cuda +#define EGL_NV_device_cuda 1 + +#define EGL_CUDA_DEVICE_NV 0x323A + +#define EGLEW_NV_device_cuda EGLEW_GET_VAR(__EGLEW_NV_device_cuda) + +#endif /* EGL_NV_device_cuda */ + +/* -------------------------- EGL_NV_native_query -------------------------- */ + +#ifndef EGL_NV_native_query +#define EGL_NV_native_query 1 + +typedef EGLBoolean ( * PFNEGLQUERYNATIVEDISPLAYNVPROC) (EGLDisplay dpy, EGLNativeDisplayType * display_id); +typedef EGLBoolean ( * PFNEGLQUERYNATIVEPIXMAPNVPROC) (EGLDisplay dpy, EGLSurface surf, EGLNativePixmapType * pixmap); +typedef EGLBoolean ( * PFNEGLQUERYNATIVEWINDOWNVPROC) (EGLDisplay dpy, EGLSurface surf, EGLNativeWindowType * window); + +#define eglQueryNativeDisplayNV EGLEW_GET_FUN(__eglewQueryNativeDisplayNV) +#define eglQueryNativePixmapNV EGLEW_GET_FUN(__eglewQueryNativePixmapNV) +#define eglQueryNativeWindowNV EGLEW_GET_FUN(__eglewQueryNativeWindowNV) + +#define EGLEW_NV_native_query EGLEW_GET_VAR(__EGLEW_NV_native_query) + +#endif /* EGL_NV_native_query */ + +/* ---------------------- EGL_NV_post_convert_rounding --------------------- */ + +#ifndef EGL_NV_post_convert_rounding +#define EGL_NV_post_convert_rounding 1 + +#define EGLEW_NV_post_convert_rounding EGLEW_GET_VAR(__EGLEW_NV_post_convert_rounding) + +#endif /* EGL_NV_post_convert_rounding */ + +/* ------------------------- EGL_NV_post_sub_buffer ------------------------ */ + +#ifndef EGL_NV_post_sub_buffer +#define EGL_NV_post_sub_buffer 1 + +#define EGL_POST_SUB_BUFFER_SUPPORTED_NV 0x30BE + +typedef EGLBoolean ( * PFNEGLPOSTSUBBUFFERNVPROC) (EGLDisplay dpy, EGLSurface surface, EGLint x, EGLint y, EGLint width, EGLint height); + +#define eglPostSubBufferNV EGLEW_GET_FUN(__eglewPostSubBufferNV) + +#define EGLEW_NV_post_sub_buffer EGLEW_GET_VAR(__EGLEW_NV_post_sub_buffer) + +#endif /* EGL_NV_post_sub_buffer */ + +/* ------------------ EGL_NV_robustness_video_memory_purge ----------------- */ + +#ifndef EGL_NV_robustness_video_memory_purge +#define EGL_NV_robustness_video_memory_purge 1 + +#define EGL_GENERATE_RESET_ON_VIDEO_MEMORY_PURGE_NV 0x334C + +#define EGLEW_NV_robustness_video_memory_purge EGLEW_GET_VAR(__EGLEW_NV_robustness_video_memory_purge) + +#endif /* EGL_NV_robustness_video_memory_purge */ + +/* ------------------ EGL_NV_stream_consumer_gltexture_yuv ----------------- */ + +#ifndef EGL_NV_stream_consumer_gltexture_yuv +#define EGL_NV_stream_consumer_gltexture_yuv 1 + +#define EGL_YUV_BUFFER_EXT 0x3300 +#define EGL_YUV_NUMBER_OF_PLANES_EXT 0x3311 +#define EGL_YUV_PLANE0_TEXTURE_UNIT_NV 0x332C +#define EGL_YUV_PLANE1_TEXTURE_UNIT_NV 0x332D +#define EGL_YUV_PLANE2_TEXTURE_UNIT_NV 0x332E + +typedef EGLBoolean ( * PFNEGLSTREAMCONSUMERGLTEXTUREEXTERNALATTRIBSNVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLAttrib *attrib_list); + +#define eglStreamConsumerGLTextureExternalAttribsNV EGLEW_GET_FUN(__eglewStreamConsumerGLTextureExternalAttribsNV) + +#define EGLEW_NV_stream_consumer_gltexture_yuv EGLEW_GET_VAR(__EGLEW_NV_stream_consumer_gltexture_yuv) + +#endif /* EGL_NV_stream_consumer_gltexture_yuv */ + +/* ---------------------- EGL_NV_stream_cross_display ---------------------- */ + +#ifndef EGL_NV_stream_cross_display +#define EGL_NV_stream_cross_display 1 + +#define EGL_STREAM_CROSS_DISPLAY_NV 0x334E + +#define EGLEW_NV_stream_cross_display EGLEW_GET_VAR(__EGLEW_NV_stream_cross_display) + +#endif /* EGL_NV_stream_cross_display */ + +/* ----------------------- EGL_NV_stream_cross_object ---------------------- */ + +#ifndef EGL_NV_stream_cross_object +#define EGL_NV_stream_cross_object 1 + +#define EGL_STREAM_CROSS_OBJECT_NV 0x334D + +#define EGLEW_NV_stream_cross_object EGLEW_GET_VAR(__EGLEW_NV_stream_cross_object) + +#endif /* EGL_NV_stream_cross_object */ + +/* --------------------- EGL_NV_stream_cross_partition --------------------- */ + +#ifndef EGL_NV_stream_cross_partition +#define EGL_NV_stream_cross_partition 1 + +#define EGL_STREAM_CROSS_PARTITION_NV 0x323F + +#define EGLEW_NV_stream_cross_partition EGLEW_GET_VAR(__EGLEW_NV_stream_cross_partition) + +#endif /* EGL_NV_stream_cross_partition */ + +/* ---------------------- EGL_NV_stream_cross_process ---------------------- */ + +#ifndef EGL_NV_stream_cross_process +#define EGL_NV_stream_cross_process 1 + +#define EGL_STREAM_CROSS_PROCESS_NV 0x3245 + +#define EGLEW_NV_stream_cross_process EGLEW_GET_VAR(__EGLEW_NV_stream_cross_process) + +#endif /* EGL_NV_stream_cross_process */ + +/* ----------------------- EGL_NV_stream_cross_system ---------------------- */ + +#ifndef EGL_NV_stream_cross_system +#define EGL_NV_stream_cross_system 1 + +#define EGL_STREAM_CROSS_SYSTEM_NV 0x334F + +#define EGLEW_NV_stream_cross_system EGLEW_GET_VAR(__EGLEW_NV_stream_cross_system) + +#endif /* EGL_NV_stream_cross_system */ + +/* ------------------------ EGL_NV_stream_fifo_next ------------------------ */ + +#ifndef EGL_NV_stream_fifo_next +#define EGL_NV_stream_fifo_next 1 + +#define EGL_PENDING_FRAME_NV 0x3329 +#define EGL_STREAM_TIME_PENDING_NV 0x332A + +#define EGLEW_NV_stream_fifo_next EGLEW_GET_VAR(__EGLEW_NV_stream_fifo_next) + +#endif /* EGL_NV_stream_fifo_next */ + +/* --------------------- EGL_NV_stream_fifo_synchronous -------------------- */ + +#ifndef EGL_NV_stream_fifo_synchronous +#define EGL_NV_stream_fifo_synchronous 1 + +#define EGL_STREAM_FIFO_SYNCHRONOUS_NV 0x3336 + +#define EGLEW_NV_stream_fifo_synchronous EGLEW_GET_VAR(__EGLEW_NV_stream_fifo_synchronous) + +#endif /* EGL_NV_stream_fifo_synchronous */ + +/* ----------------------- EGL_NV_stream_frame_limits ---------------------- */ + +#ifndef EGL_NV_stream_frame_limits +#define EGL_NV_stream_frame_limits 1 + +#define EGL_PRODUCER_MAX_FRAME_HINT_NV 0x3337 +#define EGL_CONSUMER_MAX_FRAME_HINT_NV 0x3338 + +#define EGLEW_NV_stream_frame_limits EGLEW_GET_VAR(__EGLEW_NV_stream_frame_limits) + +#endif /* EGL_NV_stream_frame_limits */ + +/* ------------------------- EGL_NV_stream_metadata ------------------------ */ + +#ifndef EGL_NV_stream_metadata +#define EGL_NV_stream_metadata 1 + +#define EGL_MAX_STREAM_METADATA_BLOCKS_NV 0x3250 +#define EGL_MAX_STREAM_METADATA_BLOCK_SIZE_NV 0x3251 +#define EGL_MAX_STREAM_METADATA_TOTAL_SIZE_NV 0x3252 +#define EGL_PRODUCER_METADATA_NV 0x3253 +#define EGL_CONSUMER_METADATA_NV 0x3254 +#define EGL_METADATA0_SIZE_NV 0x3255 +#define EGL_METADATA1_SIZE_NV 0x3256 +#define EGL_METADATA2_SIZE_NV 0x3257 +#define EGL_METADATA3_SIZE_NV 0x3258 +#define EGL_METADATA0_TYPE_NV 0x3259 +#define EGL_METADATA1_TYPE_NV 0x325A +#define EGL_METADATA2_TYPE_NV 0x325B +#define EGL_METADATA3_TYPE_NV 0x325C +#define EGL_PENDING_METADATA_NV 0x3328 + +typedef EGLBoolean ( * PFNEGLQUERYDISPLAYATTRIBNVPROC) (EGLDisplay dpy, EGLint attribute, EGLAttrib * value); +typedef EGLBoolean ( * PFNEGLQUERYSTREAMMETADATANVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum name, EGLint n, EGLint offset, EGLint size, void * data); +typedef EGLBoolean ( * PFNEGLSETSTREAMMETADATANVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLint n, EGLint offset, EGLint size, const void * data); + +#define eglQueryDisplayAttribNV EGLEW_GET_FUN(__eglewQueryDisplayAttribNV) +#define eglQueryStreamMetadataNV EGLEW_GET_FUN(__eglewQueryStreamMetadataNV) +#define eglSetStreamMetadataNV EGLEW_GET_FUN(__eglewSetStreamMetadataNV) + +#define EGLEW_NV_stream_metadata EGLEW_GET_VAR(__EGLEW_NV_stream_metadata) + +#endif /* EGL_NV_stream_metadata */ + +/* -------------------------- EGL_NV_stream_remote ------------------------- */ + +#ifndef EGL_NV_stream_remote +#define EGL_NV_stream_remote 1 + +#define EGL_STREAM_STATE_INITIALIZING_NV 0x3240 +#define EGL_STREAM_TYPE_NV 0x3241 +#define EGL_STREAM_PROTOCOL_NV 0x3242 +#define EGL_STREAM_ENDPOINT_NV 0x3243 +#define EGL_STREAM_LOCAL_NV 0x3244 +#define EGL_STREAM_PROTOCOL_FD_NV 0x3246 +#define EGL_STREAM_PRODUCER_NV 0x3247 +#define EGL_STREAM_CONSUMER_NV 0x3248 + +#define EGLEW_NV_stream_remote EGLEW_GET_VAR(__EGLEW_NV_stream_remote) + +#endif /* EGL_NV_stream_remote */ + +/* -------------------------- EGL_NV_stream_reset -------------------------- */ + +#ifndef EGL_NV_stream_reset +#define EGL_NV_stream_reset 1 + +#define EGL_SUPPORT_RESET_NV 0x3334 +#define EGL_SUPPORT_REUSE_NV 0x3335 + +typedef EGLBoolean ( * PFNEGLRESETSTREAMNVPROC) (EGLDisplay dpy, EGLStreamKHR stream); + +#define eglResetStreamNV EGLEW_GET_FUN(__eglewResetStreamNV) + +#define EGLEW_NV_stream_reset EGLEW_GET_VAR(__EGLEW_NV_stream_reset) + +#endif /* EGL_NV_stream_reset */ + +/* -------------------------- EGL_NV_stream_socket ------------------------- */ + +#ifndef EGL_NV_stream_socket +#define EGL_NV_stream_socket 1 + +#define EGL_STREAM_PROTOCOL_SOCKET_NV 0x324B +#define EGL_SOCKET_HANDLE_NV 0x324C +#define EGL_SOCKET_TYPE_NV 0x324D + +#define EGLEW_NV_stream_socket EGLEW_GET_VAR(__EGLEW_NV_stream_socket) + +#endif /* EGL_NV_stream_socket */ + +/* ----------------------- EGL_NV_stream_socket_inet ----------------------- */ + +#ifndef EGL_NV_stream_socket_inet +#define EGL_NV_stream_socket_inet 1 + +#define EGL_SOCKET_TYPE_INET_NV 0x324F + +#define EGLEW_NV_stream_socket_inet EGLEW_GET_VAR(__EGLEW_NV_stream_socket_inet) + +#endif /* EGL_NV_stream_socket_inet */ + +/* ----------------------- EGL_NV_stream_socket_unix ----------------------- */ + +#ifndef EGL_NV_stream_socket_unix +#define EGL_NV_stream_socket_unix 1 + +#define EGL_SOCKET_TYPE_UNIX_NV 0x324E + +#define EGLEW_NV_stream_socket_unix EGLEW_GET_VAR(__EGLEW_NV_stream_socket_unix) + +#endif /* EGL_NV_stream_socket_unix */ + +/* --------------------------- EGL_NV_stream_sync -------------------------- */ + +#ifndef EGL_NV_stream_sync +#define EGL_NV_stream_sync 1 + +#define EGL_SYNC_TYPE_KHR 0x30F7 +#define EGL_SYNC_NEW_FRAME_NV 0x321F + +typedef EGLSyncKHR ( * PFNEGLCREATESTREAMSYNCNVPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLenum type, const EGLint * attrib_list); + +#define eglCreateStreamSyncNV EGLEW_GET_FUN(__eglewCreateStreamSyncNV) + +#define EGLEW_NV_stream_sync EGLEW_GET_VAR(__EGLEW_NV_stream_sync) + +#endif /* EGL_NV_stream_sync */ + +/* ------------------------------ EGL_NV_sync ------------------------------ */ + +#ifndef EGL_NV_sync +#define EGL_NV_sync 1 + +#define EGL_SYNC_FLUSH_COMMANDS_BIT_NV 0x0001 +#define EGL_SYNC_PRIOR_COMMANDS_COMPLETE_NV 0x30E6 +#define EGL_SYNC_STATUS_NV 0x30E7 +#define EGL_SIGNALED_NV 0x30E8 +#define EGL_UNSIGNALED_NV 0x30E9 +#define EGL_ALREADY_SIGNALED_NV 0x30EA +#define EGL_TIMEOUT_EXPIRED_NV 0x30EB +#define EGL_CONDITION_SATISFIED_NV 0x30EC +#define EGL_SYNC_TYPE_NV 0x30ED +#define EGL_SYNC_CONDITION_NV 0x30EE +#define EGL_SYNC_FENCE_NV 0x30EF +#define EGL_FOREVER_NV 0xFFFFFFFFFFFFFFFF + +typedef EGLint ( * PFNEGLCLIENTWAITSYNCNVPROC) (EGLSyncNV sync, EGLint flags, EGLTimeNV timeout); +typedef EGLSyncNV ( * PFNEGLCREATEFENCESYNCNVPROC) (EGLDisplay dpy, EGLenum condition, const EGLint * attrib_list); +typedef EGLBoolean ( * PFNEGLDESTROYSYNCNVPROC) (EGLSyncNV sync); +typedef EGLBoolean ( * PFNEGLFENCENVPROC) (EGLSyncNV sync); +typedef EGLBoolean ( * PFNEGLGETSYNCATTRIBNVPROC) (EGLSyncNV sync, EGLint attribute, EGLint * value); +typedef EGLBoolean ( * PFNEGLSIGNALSYNCNVPROC) (EGLSyncNV sync, EGLenum mode); + +#define eglClientWaitSyncNV EGLEW_GET_FUN(__eglewClientWaitSyncNV) +#define eglCreateFenceSyncNV EGLEW_GET_FUN(__eglewCreateFenceSyncNV) +#define eglDestroySyncNV EGLEW_GET_FUN(__eglewDestroySyncNV) +#define eglFenceNV EGLEW_GET_FUN(__eglewFenceNV) +#define eglGetSyncAttribNV EGLEW_GET_FUN(__eglewGetSyncAttribNV) +#define eglSignalSyncNV EGLEW_GET_FUN(__eglewSignalSyncNV) + +#define EGLEW_NV_sync EGLEW_GET_VAR(__EGLEW_NV_sync) + +#endif /* EGL_NV_sync */ + +/* --------------------------- EGL_NV_system_time -------------------------- */ + +#ifndef EGL_NV_system_time +#define EGL_NV_system_time 1 + +typedef EGLuint64NV ( * PFNEGLGETSYSTEMTIMEFREQUENCYNVPROC) ( void ); +typedef EGLuint64NV ( * PFNEGLGETSYSTEMTIMENVPROC) ( void ); + +#define eglGetSystemTimeFrequencyNV EGLEW_GET_FUN(__eglewGetSystemTimeFrequencyNV) +#define eglGetSystemTimeNV EGLEW_GET_FUN(__eglewGetSystemTimeNV) + +#define EGLEW_NV_system_time EGLEW_GET_VAR(__EGLEW_NV_system_time) + +#endif /* EGL_NV_system_time */ + +/* --------------------- EGL_TIZEN_image_native_buffer --------------------- */ + +#ifndef EGL_TIZEN_image_native_buffer +#define EGL_TIZEN_image_native_buffer 1 + +#define EGL_NATIVE_BUFFER_TIZEN 0x32A0 + +#define EGLEW_TIZEN_image_native_buffer EGLEW_GET_VAR(__EGLEW_TIZEN_image_native_buffer) + +#endif /* EGL_TIZEN_image_native_buffer */ + +/* --------------------- EGL_TIZEN_image_native_surface -------------------- */ + +#ifndef EGL_TIZEN_image_native_surface +#define EGL_TIZEN_image_native_surface 1 + +#define EGL_NATIVE_SURFACE_TIZEN 0x32A1 + +#define EGLEW_TIZEN_image_native_surface EGLEW_GET_VAR(__EGLEW_TIZEN_image_native_surface) + +#endif /* EGL_TIZEN_image_native_surface */ + +/* ------------------------------------------------------------------------- */ + +#define EGLEW_FUN_EXPORT GLEW_FUN_EXPORT +#define EGLEW_VAR_EXPORT GLEW_VAR_EXPORT + +EGLEW_FUN_EXPORT PFNEGLCHOOSECONFIGPROC __eglewChooseConfig; +EGLEW_FUN_EXPORT PFNEGLCOPYBUFFERSPROC __eglewCopyBuffers; +EGLEW_FUN_EXPORT PFNEGLCREATECONTEXTPROC __eglewCreateContext; +EGLEW_FUN_EXPORT PFNEGLCREATEPBUFFERSURFACEPROC __eglewCreatePbufferSurface; +EGLEW_FUN_EXPORT PFNEGLCREATEPIXMAPSURFACEPROC __eglewCreatePixmapSurface; +EGLEW_FUN_EXPORT PFNEGLCREATEWINDOWSURFACEPROC __eglewCreateWindowSurface; +EGLEW_FUN_EXPORT PFNEGLDESTROYCONTEXTPROC __eglewDestroyContext; +EGLEW_FUN_EXPORT PFNEGLDESTROYSURFACEPROC __eglewDestroySurface; +EGLEW_FUN_EXPORT PFNEGLGETCONFIGATTRIBPROC __eglewGetConfigAttrib; +EGLEW_FUN_EXPORT PFNEGLGETCONFIGSPROC __eglewGetConfigs; +EGLEW_FUN_EXPORT PFNEGLGETCURRENTDISPLAYPROC __eglewGetCurrentDisplay; +EGLEW_FUN_EXPORT PFNEGLGETCURRENTSURFACEPROC __eglewGetCurrentSurface; +EGLEW_FUN_EXPORT PFNEGLGETDISPLAYPROC __eglewGetDisplay; +EGLEW_FUN_EXPORT PFNEGLGETERRORPROC __eglewGetError; +EGLEW_FUN_EXPORT PFNEGLINITIALIZEPROC __eglewInitialize; +EGLEW_FUN_EXPORT PFNEGLMAKECURRENTPROC __eglewMakeCurrent; +EGLEW_FUN_EXPORT PFNEGLQUERYCONTEXTPROC __eglewQueryContext; +EGLEW_FUN_EXPORT PFNEGLQUERYSTRINGPROC __eglewQueryString; +EGLEW_FUN_EXPORT PFNEGLQUERYSURFACEPROC __eglewQuerySurface; +EGLEW_FUN_EXPORT PFNEGLSWAPBUFFERSPROC __eglewSwapBuffers; +EGLEW_FUN_EXPORT PFNEGLTERMINATEPROC __eglewTerminate; +EGLEW_FUN_EXPORT PFNEGLWAITGLPROC __eglewWaitGL; +EGLEW_FUN_EXPORT PFNEGLWAITNATIVEPROC __eglewWaitNative; + +EGLEW_FUN_EXPORT PFNEGLBINDTEXIMAGEPROC __eglewBindTexImage; +EGLEW_FUN_EXPORT PFNEGLRELEASETEXIMAGEPROC __eglewReleaseTexImage; +EGLEW_FUN_EXPORT PFNEGLSURFACEATTRIBPROC __eglewSurfaceAttrib; +EGLEW_FUN_EXPORT PFNEGLSWAPINTERVALPROC __eglewSwapInterval; + +EGLEW_FUN_EXPORT PFNEGLBINDAPIPROC __eglewBindAPI; +EGLEW_FUN_EXPORT PFNEGLCREATEPBUFFERFROMCLIENTBUFFERPROC __eglewCreatePbufferFromClientBuffer; +EGLEW_FUN_EXPORT PFNEGLQUERYAPIPROC __eglewQueryAPI; +EGLEW_FUN_EXPORT PFNEGLRELEASETHREADPROC __eglewReleaseThread; +EGLEW_FUN_EXPORT PFNEGLWAITCLIENTPROC __eglewWaitClient; + +EGLEW_FUN_EXPORT PFNEGLGETCURRENTCONTEXTPROC __eglewGetCurrentContext; + +EGLEW_FUN_EXPORT PFNEGLCLIENTWAITSYNCPROC __eglewClientWaitSync; +EGLEW_FUN_EXPORT PFNEGLCREATEIMAGEPROC __eglewCreateImage; +EGLEW_FUN_EXPORT PFNEGLCREATEPLATFORMPIXMAPSURFACEPROC __eglewCreatePlatformPixmapSurface; +EGLEW_FUN_EXPORT PFNEGLCREATEPLATFORMWINDOWSURFACEPROC __eglewCreatePlatformWindowSurface; +EGLEW_FUN_EXPORT PFNEGLCREATESYNCPROC __eglewCreateSync; +EGLEW_FUN_EXPORT PFNEGLDESTROYIMAGEPROC __eglewDestroyImage; +EGLEW_FUN_EXPORT PFNEGLDESTROYSYNCPROC __eglewDestroySync; +EGLEW_FUN_EXPORT PFNEGLGETPLATFORMDISPLAYPROC __eglewGetPlatformDisplay; +EGLEW_FUN_EXPORT PFNEGLGETSYNCATTRIBPROC __eglewGetSyncAttrib; +EGLEW_FUN_EXPORT PFNEGLWAITSYNCPROC __eglewWaitSync; + +EGLEW_FUN_EXPORT PFNEGLSETBLOBCACHEFUNCSANDROIDPROC __eglewSetBlobCacheFuncsANDROID; + +EGLEW_FUN_EXPORT PFNEGLCREATENATIVECLIENTBUFFERANDROIDPROC __eglewCreateNativeClientBufferANDROID; + +EGLEW_FUN_EXPORT PFNEGLDUPNATIVEFENCEFDANDROIDPROC __eglewDupNativeFenceFDANDROID; + +EGLEW_FUN_EXPORT PFNEGLPRESENTATIONTIMEANDROIDPROC __eglewPresentationTimeANDROID; + +EGLEW_FUN_EXPORT PFNEGLQUERYSURFACEPOINTERANGLEPROC __eglewQuerySurfacePointerANGLE; + +EGLEW_FUN_EXPORT PFNEGLQUERYDEVICESEXTPROC __eglewQueryDevicesEXT; + +EGLEW_FUN_EXPORT PFNEGLQUERYDEVICEATTRIBEXTPROC __eglewQueryDeviceAttribEXT; +EGLEW_FUN_EXPORT PFNEGLQUERYDEVICESTRINGEXTPROC __eglewQueryDeviceStringEXT; +EGLEW_FUN_EXPORT PFNEGLQUERYDISPLAYATTRIBEXTPROC __eglewQueryDisplayAttribEXT; + +EGLEW_FUN_EXPORT PFNEGLQUERYDMABUFFORMATSEXTPROC __eglewQueryDmaBufFormatsEXT; +EGLEW_FUN_EXPORT PFNEGLQUERYDMABUFMODIFIERSEXTPROC __eglewQueryDmaBufModifiersEXT; + +EGLEW_FUN_EXPORT PFNEGLGETOUTPUTLAYERSEXTPROC __eglewGetOutputLayersEXT; +EGLEW_FUN_EXPORT PFNEGLGETOUTPUTPORTSEXTPROC __eglewGetOutputPortsEXT; +EGLEW_FUN_EXPORT PFNEGLOUTPUTLAYERATTRIBEXTPROC __eglewOutputLayerAttribEXT; +EGLEW_FUN_EXPORT PFNEGLOUTPUTPORTATTRIBEXTPROC __eglewOutputPortAttribEXT; +EGLEW_FUN_EXPORT PFNEGLQUERYOUTPUTLAYERATTRIBEXTPROC __eglewQueryOutputLayerAttribEXT; +EGLEW_FUN_EXPORT PFNEGLQUERYOUTPUTLAYERSTRINGEXTPROC __eglewQueryOutputLayerStringEXT; +EGLEW_FUN_EXPORT PFNEGLQUERYOUTPUTPORTATTRIBEXTPROC __eglewQueryOutputPortAttribEXT; +EGLEW_FUN_EXPORT PFNEGLQUERYOUTPUTPORTSTRINGEXTPROC __eglewQueryOutputPortStringEXT; + +EGLEW_FUN_EXPORT PFNEGLCREATEPLATFORMPIXMAPSURFACEEXTPROC __eglewCreatePlatformPixmapSurfaceEXT; +EGLEW_FUN_EXPORT PFNEGLCREATEPLATFORMWINDOWSURFACEEXTPROC __eglewCreatePlatformWindowSurfaceEXT; +EGLEW_FUN_EXPORT PFNEGLGETPLATFORMDISPLAYEXTPROC __eglewGetPlatformDisplayEXT; + +EGLEW_FUN_EXPORT PFNEGLSTREAMCONSUMEROUTPUTEXTPROC __eglewStreamConsumerOutputEXT; + +EGLEW_FUN_EXPORT PFNEGLSWAPBUFFERSWITHDAMAGEEXTPROC __eglewSwapBuffersWithDamageEXT; + +EGLEW_FUN_EXPORT PFNEGLCREATEPIXMAPSURFACEHIPROC __eglewCreatePixmapSurfaceHI; + +EGLEW_FUN_EXPORT PFNEGLCREATESYNC64KHRPROC __eglewCreateSync64KHR; + +EGLEW_FUN_EXPORT PFNEGLDEBUGMESSAGECONTROLKHRPROC __eglewDebugMessageControlKHR; +EGLEW_FUN_EXPORT PFNEGLLABELOBJECTKHRPROC __eglewLabelObjectKHR; +EGLEW_FUN_EXPORT PFNEGLQUERYDEBUGKHRPROC __eglewQueryDebugKHR; + +EGLEW_FUN_EXPORT PFNEGLCREATEIMAGEKHRPROC __eglewCreateImageKHR; +EGLEW_FUN_EXPORT PFNEGLDESTROYIMAGEKHRPROC __eglewDestroyImageKHR; + +EGLEW_FUN_EXPORT PFNEGLLOCKSURFACEKHRPROC __eglewLockSurfaceKHR; +EGLEW_FUN_EXPORT PFNEGLUNLOCKSURFACEKHRPROC __eglewUnlockSurfaceKHR; + +EGLEW_FUN_EXPORT PFNEGLQUERYSURFACE64KHRPROC __eglewQuerySurface64KHR; + +EGLEW_FUN_EXPORT PFNEGLSETDAMAGEREGIONKHRPROC __eglewSetDamageRegionKHR; + +EGLEW_FUN_EXPORT PFNEGLCLIENTWAITSYNCKHRPROC __eglewClientWaitSyncKHR; +EGLEW_FUN_EXPORT PFNEGLCREATESYNCKHRPROC __eglewCreateSyncKHR; +EGLEW_FUN_EXPORT PFNEGLDESTROYSYNCKHRPROC __eglewDestroySyncKHR; +EGLEW_FUN_EXPORT PFNEGLGETSYNCATTRIBKHRPROC __eglewGetSyncAttribKHR; +EGLEW_FUN_EXPORT PFNEGLSIGNALSYNCKHRPROC __eglewSignalSyncKHR; + +EGLEW_FUN_EXPORT PFNEGLCREATESTREAMKHRPROC __eglewCreateStreamKHR; +EGLEW_FUN_EXPORT PFNEGLDESTROYSTREAMKHRPROC __eglewDestroyStreamKHR; +EGLEW_FUN_EXPORT PFNEGLQUERYSTREAMKHRPROC __eglewQueryStreamKHR; +EGLEW_FUN_EXPORT PFNEGLQUERYSTREAMU64KHRPROC __eglewQueryStreamu64KHR; +EGLEW_FUN_EXPORT PFNEGLSTREAMATTRIBKHRPROC __eglewStreamAttribKHR; + +EGLEW_FUN_EXPORT PFNEGLCREATESTREAMATTRIBKHRPROC __eglewCreateStreamAttribKHR; +EGLEW_FUN_EXPORT PFNEGLQUERYSTREAMATTRIBKHRPROC __eglewQueryStreamAttribKHR; +EGLEW_FUN_EXPORT PFNEGLSETSTREAMATTRIBKHRPROC __eglewSetStreamAttribKHR; +EGLEW_FUN_EXPORT PFNEGLSTREAMCONSUMERACQUIREATTRIBKHRPROC __eglewStreamConsumerAcquireAttribKHR; +EGLEW_FUN_EXPORT PFNEGLSTREAMCONSUMERRELEASEATTRIBKHRPROC __eglewStreamConsumerReleaseAttribKHR; + +EGLEW_FUN_EXPORT PFNEGLSTREAMCONSUMERACQUIREKHRPROC __eglewStreamConsumerAcquireKHR; +EGLEW_FUN_EXPORT PFNEGLSTREAMCONSUMERGLTEXTUREEXTERNALKHRPROC __eglewStreamConsumerGLTextureExternalKHR; +EGLEW_FUN_EXPORT PFNEGLSTREAMCONSUMERRELEASEKHRPROC __eglewStreamConsumerReleaseKHR; + +EGLEW_FUN_EXPORT PFNEGLCREATESTREAMFROMFILEDESCRIPTORKHRPROC __eglewCreateStreamFromFileDescriptorKHR; +EGLEW_FUN_EXPORT PFNEGLGETSTREAMFILEDESCRIPTORKHRPROC __eglewGetStreamFileDescriptorKHR; + +EGLEW_FUN_EXPORT PFNEGLQUERYSTREAMTIMEKHRPROC __eglewQueryStreamTimeKHR; + +EGLEW_FUN_EXPORT PFNEGLCREATESTREAMPRODUCERSURFACEKHRPROC __eglewCreateStreamProducerSurfaceKHR; + +EGLEW_FUN_EXPORT PFNEGLSWAPBUFFERSWITHDAMAGEKHRPROC __eglewSwapBuffersWithDamageKHR; + +EGLEW_FUN_EXPORT PFNEGLWAITSYNCKHRPROC __eglewWaitSyncKHR; + +EGLEW_FUN_EXPORT PFNEGLCREATEDRMIMAGEMESAPROC __eglewCreateDRMImageMESA; +EGLEW_FUN_EXPORT PFNEGLEXPORTDRMIMAGEMESAPROC __eglewExportDRMImageMESA; + +EGLEW_FUN_EXPORT PFNEGLEXPORTDMABUFIMAGEMESAPROC __eglewExportDMABUFImageMESA; +EGLEW_FUN_EXPORT PFNEGLEXPORTDMABUFIMAGEQUERYMESAPROC __eglewExportDMABUFImageQueryMESA; + +EGLEW_FUN_EXPORT PFNEGLSWAPBUFFERSREGIONNOKPROC __eglewSwapBuffersRegionNOK; + +EGLEW_FUN_EXPORT PFNEGLSWAPBUFFERSREGION2NOKPROC __eglewSwapBuffersRegion2NOK; + +EGLEW_FUN_EXPORT PFNEGLQUERYNATIVEDISPLAYNVPROC __eglewQueryNativeDisplayNV; +EGLEW_FUN_EXPORT PFNEGLQUERYNATIVEPIXMAPNVPROC __eglewQueryNativePixmapNV; +EGLEW_FUN_EXPORT PFNEGLQUERYNATIVEWINDOWNVPROC __eglewQueryNativeWindowNV; + +EGLEW_FUN_EXPORT PFNEGLPOSTSUBBUFFERNVPROC __eglewPostSubBufferNV; + +EGLEW_FUN_EXPORT PFNEGLSTREAMCONSUMERGLTEXTUREEXTERNALATTRIBSNVPROC __eglewStreamConsumerGLTextureExternalAttribsNV; + +EGLEW_FUN_EXPORT PFNEGLQUERYDISPLAYATTRIBNVPROC __eglewQueryDisplayAttribNV; +EGLEW_FUN_EXPORT PFNEGLQUERYSTREAMMETADATANVPROC __eglewQueryStreamMetadataNV; +EGLEW_FUN_EXPORT PFNEGLSETSTREAMMETADATANVPROC __eglewSetStreamMetadataNV; + +EGLEW_FUN_EXPORT PFNEGLRESETSTREAMNVPROC __eglewResetStreamNV; + +EGLEW_FUN_EXPORT PFNEGLCREATESTREAMSYNCNVPROC __eglewCreateStreamSyncNV; + +EGLEW_FUN_EXPORT PFNEGLCLIENTWAITSYNCNVPROC __eglewClientWaitSyncNV; +EGLEW_FUN_EXPORT PFNEGLCREATEFENCESYNCNVPROC __eglewCreateFenceSyncNV; +EGLEW_FUN_EXPORT PFNEGLDESTROYSYNCNVPROC __eglewDestroySyncNV; +EGLEW_FUN_EXPORT PFNEGLFENCENVPROC __eglewFenceNV; +EGLEW_FUN_EXPORT PFNEGLGETSYNCATTRIBNVPROC __eglewGetSyncAttribNV; +EGLEW_FUN_EXPORT PFNEGLSIGNALSYNCNVPROC __eglewSignalSyncNV; + +EGLEW_FUN_EXPORT PFNEGLGETSYSTEMTIMEFREQUENCYNVPROC __eglewGetSystemTimeFrequencyNV; +EGLEW_FUN_EXPORT PFNEGLGETSYSTEMTIMENVPROC __eglewGetSystemTimeNV; +EGLEW_VAR_EXPORT GLboolean __EGLEW_VERSION_1_0; +EGLEW_VAR_EXPORT GLboolean __EGLEW_VERSION_1_1; +EGLEW_VAR_EXPORT GLboolean __EGLEW_VERSION_1_2; +EGLEW_VAR_EXPORT GLboolean __EGLEW_VERSION_1_3; +EGLEW_VAR_EXPORT GLboolean __EGLEW_VERSION_1_4; +EGLEW_VAR_EXPORT GLboolean __EGLEW_VERSION_1_5; +EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_blob_cache; +EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_create_native_client_buffer; +EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_framebuffer_target; +EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_front_buffer_auto_refresh; +EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_image_native_buffer; +EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_native_fence_sync; +EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_presentation_time; +EGLEW_VAR_EXPORT GLboolean __EGLEW_ANDROID_recordable; +EGLEW_VAR_EXPORT GLboolean __EGLEW_ANGLE_d3d_share_handle_client_buffer; +EGLEW_VAR_EXPORT GLboolean __EGLEW_ANGLE_device_d3d; +EGLEW_VAR_EXPORT GLboolean __EGLEW_ANGLE_query_surface_pointer; +EGLEW_VAR_EXPORT GLboolean __EGLEW_ANGLE_surface_d3d_texture_2d_share_handle; +EGLEW_VAR_EXPORT GLboolean __EGLEW_ANGLE_window_fixed_size; +EGLEW_VAR_EXPORT GLboolean __EGLEW_ARM_implicit_external_sync; +EGLEW_VAR_EXPORT GLboolean __EGLEW_ARM_pixmap_multisample_discard; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_buffer_age; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_client_extensions; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_create_context_robustness; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_device_base; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_device_drm; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_device_enumeration; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_device_openwf; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_device_query; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_gl_colorspace_bt2020_linear; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_gl_colorspace_bt2020_pq; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_gl_colorspace_scrgb_linear; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_image_dma_buf_import; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_image_dma_buf_import_modifiers; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_multiview_window; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_output_base; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_output_drm; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_output_openwf; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_pixel_format_float; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_platform_base; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_platform_device; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_platform_wayland; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_platform_x11; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_protected_content; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_protected_surface; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_stream_consumer_egloutput; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_surface_SMPTE2086_metadata; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_swap_buffers_with_damage; +EGLEW_VAR_EXPORT GLboolean __EGLEW_EXT_yuv_surface; +EGLEW_VAR_EXPORT GLboolean __EGLEW_HI_clientpixmap; +EGLEW_VAR_EXPORT GLboolean __EGLEW_HI_colorformats; +EGLEW_VAR_EXPORT GLboolean __EGLEW_IMG_context_priority; +EGLEW_VAR_EXPORT GLboolean __EGLEW_IMG_image_plane_attribs; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_cl_event; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_cl_event2; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_client_get_all_proc_addresses; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_config_attribs; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_context_flush_control; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_create_context; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_create_context_no_error; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_debug; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_fence_sync; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_get_all_proc_addresses; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_gl_colorspace; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_gl_renderbuffer_image; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_gl_texture_2D_image; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_gl_texture_3D_image; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_gl_texture_cubemap_image; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_image; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_image_base; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_image_pixmap; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_lock_surface; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_lock_surface2; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_lock_surface3; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_mutable_render_buffer; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_no_config_context; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_partial_update; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_platform_android; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_platform_gbm; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_platform_wayland; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_platform_x11; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_reusable_sync; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_attrib; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_consumer_gltexture; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_cross_process_fd; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_fifo; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_producer_aldatalocator; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_stream_producer_eglsurface; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_surfaceless_context; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_swap_buffers_with_damage; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_vg_parent_image; +EGLEW_VAR_EXPORT GLboolean __EGLEW_KHR_wait_sync; +EGLEW_VAR_EXPORT GLboolean __EGLEW_MESA_drm_image; +EGLEW_VAR_EXPORT GLboolean __EGLEW_MESA_image_dma_buf_export; +EGLEW_VAR_EXPORT GLboolean __EGLEW_MESA_platform_gbm; +EGLEW_VAR_EXPORT GLboolean __EGLEW_MESA_platform_surfaceless; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NOK_swap_region; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NOK_swap_region2; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NOK_texture_from_pixmap; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_3dvision_surface; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_coverage_sample; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_coverage_sample_resolve; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_cuda_event; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_depth_nonlinear; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_device_cuda; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_native_query; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_post_convert_rounding; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_post_sub_buffer; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_robustness_video_memory_purge; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_consumer_gltexture_yuv; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_cross_display; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_cross_object; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_cross_partition; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_cross_process; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_cross_system; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_fifo_next; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_fifo_synchronous; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_frame_limits; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_metadata; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_remote; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_reset; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_socket; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_socket_inet; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_socket_unix; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_stream_sync; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_sync; +EGLEW_VAR_EXPORT GLboolean __EGLEW_NV_system_time; +EGLEW_VAR_EXPORT GLboolean __EGLEW_TIZEN_image_native_buffer; +EGLEW_VAR_EXPORT GLboolean __EGLEW_TIZEN_image_native_surface; +/* ------------------------------------------------------------------------ */ + +GLEWAPI GLenum GLEWAPIENTRY eglewInit (EGLDisplay display); +GLEWAPI GLboolean GLEWAPIENTRY eglewIsSupported (const char *name); + +#define EGLEW_GET_VAR(x) (*(const GLboolean*)&x) +#define EGLEW_GET_FUN(x) x + +GLEWAPI GLboolean GLEWAPIENTRY eglewGetExtension (const char *name); + +#ifdef __cplusplus +} +#endif + +#endif /* __eglew_h__ */ diff --git a/external/include/GL/glew.h b/external/include/GL/glew.h index 702265c38..b5b6987fc 100644 --- a/external/include/GL/glew.h +++ b/external/include/GL/glew.h @@ -1,6 +1,6 @@ /* ** The OpenGL Extension Wrangler Library -** Copyright (C) 2008-2015, Nigel Stewart +** Copyright (C) 2008-2017, Nigel Stewart ** Copyright (C) 2002-2008, Milan Ikits ** Copyright (C) 2002-2008, Marcelo E. Magallon ** Copyright (C) 2002, Lev Povalahev @@ -263,6 +263,9 @@ typedef _W64 int ptrdiff_t; #define GLEWAPIENTRY #endif +#define GLEW_VAR_EXPORT GLEWAPI +#define GLEW_FUN_EXPORT GLEWAPI + #ifdef __cplusplus extern "C" { #endif @@ -2493,6 +2496,46 @@ typedef void (GLAPIENTRY * PFNGLGETNUNIFORMDVPROC) (GLuint program, GLint locati #endif /* GL_VERSION_4_5 */ +/* ----------------------------- GL_VERSION_4_6 ---------------------------- */ + +#ifndef GL_VERSION_4_6 +#define GL_VERSION_4_6 1 + +#define GL_CONTEXT_FLAG_NO_ERROR_BIT 0x00000008 +#define GL_PARAMETER_BUFFER 0x80EE +#define GL_PARAMETER_BUFFER_BINDING 0x80EF +#define GL_TRANSFORM_FEEDBACK_OVERFLOW 0x82EC +#define GL_TRANSFORM_FEEDBACK_STREAM_OVERFLOW 0x82ED +#define GL_VERTICES_SUBMITTED 0x82EE +#define GL_PRIMITIVES_SUBMITTED 0x82EF +#define GL_VERTEX_SHADER_INVOCATIONS 0x82F0 +#define GL_TESS_CONTROL_SHADER_PATCHES 0x82F1 +#define GL_TESS_EVALUATION_SHADER_INVOCATIONS 0x82F2 +#define GL_GEOMETRY_SHADER_PRIMITIVES_EMITTED 0x82F3 +#define GL_FRAGMENT_SHADER_INVOCATIONS 0x82F4 +#define GL_COMPUTE_SHADER_INVOCATIONS 0x82F5 +#define GL_CLIPPING_INPUT_PRIMITIVES 0x82F6 +#define GL_CLIPPING_OUTPUT_PRIMITIVES 0x82F7 +#define GL_TEXTURE_MAX_ANISOTROPY 0x84FE +#define GL_MAX_TEXTURE_MAX_ANISOTROPY 0x84FF +#define GL_POLYGON_OFFSET_CLAMP 0x8E1B +#define GL_SHADER_BINARY_FORMAT_SPIR_V 0x9551 +#define GL_SPIR_V_BINARY 0x9552 +#define GL_SPIR_V_EXTENSIONS 0x9553 +#define GL_NUM_SPIR_V_EXTENSIONS 0x9554 + +typedef void (GLAPIENTRY * PFNGLMULTIDRAWARRAYSINDIRECTCOUNTPROC) (GLenum mode, const GLvoid *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTPROC) (GLenum mode, GLenum type, const GLvoid *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (GLAPIENTRY * PFNGLSPECIALIZESHADERPROC) (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); + +#define glMultiDrawArraysIndirectCount GLEW_GET_FUN(__glewMultiDrawArraysIndirectCount) +#define glMultiDrawElementsIndirectCount GLEW_GET_FUN(__glewMultiDrawElementsIndirectCount) +#define glSpecializeShader GLEW_GET_FUN(__glewSpecializeShader) + +#define GLEW_VERSION_4_6 GLEW_GET_VAR(__GLEW_VERSION_4_6) + +#endif /* GL_VERSION_4_6 */ + /* -------------------------- GL_3DFX_multisample -------------------------- */ #ifndef GL_3DFX_multisample @@ -2544,6 +2587,31 @@ typedef void (GLAPIENTRY * PFNGLTBUFFERMASK3DFXPROC) (GLuint mask); #endif /* GL_AMD_blend_minmax_factor */ +/* --------------------- GL_AMD_compressed_3DC_texture --------------------- */ + +#ifndef GL_AMD_compressed_3DC_texture +#define GL_AMD_compressed_3DC_texture 1 + +#define GL_3DC_X_AMD 0x87F9 +#define GL_3DC_XY_AMD 0x87FA + +#define GLEW_AMD_compressed_3DC_texture GLEW_GET_VAR(__GLEW_AMD_compressed_3DC_texture) + +#endif /* GL_AMD_compressed_3DC_texture */ + +/* --------------------- GL_AMD_compressed_ATC_texture --------------------- */ + +#ifndef GL_AMD_compressed_ATC_texture +#define GL_AMD_compressed_ATC_texture 1 + +#define GL_ATC_RGBA_INTERPOLATED_ALPHA_AMD 0x87EE +#define GL_ATC_RGB_AMD 0x8C92 +#define GL_ATC_RGBA_EXPLICIT_ALPHA_AMD 0x8C93 + +#define GLEW_AMD_compressed_ATC_texture GLEW_GET_VAR(__GLEW_AMD_compressed_ATC_texture) + +#endif /* GL_AMD_compressed_ATC_texture */ + /* ----------------------- GL_AMD_conservative_depth ----------------------- */ #ifndef GL_AMD_conservative_depth @@ -2620,6 +2688,30 @@ typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEINDEXEDAMDPROC) (GLuint buf, GL #endif /* GL_AMD_draw_buffers_blend */ +/* ------------------ GL_AMD_framebuffer_sample_positions ------------------ */ + +#ifndef GL_AMD_framebuffer_sample_positions +#define GL_AMD_framebuffer_sample_positions 1 + +#define GL_SUBSAMPLE_DISTANCE_AMD 0x883F +#define GL_PIXELS_PER_SAMPLE_PATTERN_X_AMD 0x91AE +#define GL_PIXELS_PER_SAMPLE_PATTERN_Y_AMD 0x91AF +#define GL_ALL_PIXELS_AMD 0xFFFFFFFF + +typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERSAMPLEPOSITIONSFVAMDPROC) (GLenum target, GLuint numsamples, GLuint pixelindex, const GLfloat* values); +typedef void (GLAPIENTRY * PFNGLGETFRAMEBUFFERPARAMETERFVAMDPROC) (GLenum target, GLenum pname, GLuint numsamples, GLuint pixelindex, GLsizei size, GLfloat* values); +typedef void (GLAPIENTRY * PFNGLGETNAMEDFRAMEBUFFERPARAMETERFVAMDPROC) (GLuint framebuffer, GLenum pname, GLuint numsamples, GLuint pixelindex, GLsizei size, GLfloat* values); +typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERSAMPLEPOSITIONSFVAMDPROC) (GLuint framebuffer, GLuint numsamples, GLuint pixelindex, const GLfloat* values); + +#define glFramebufferSamplePositionsfvAMD GLEW_GET_FUN(__glewFramebufferSamplePositionsfvAMD) +#define glGetFramebufferParameterfvAMD GLEW_GET_FUN(__glewGetFramebufferParameterfvAMD) +#define glGetNamedFramebufferParameterfvAMD GLEW_GET_FUN(__glewGetNamedFramebufferParameterfvAMD) +#define glNamedFramebufferSamplePositionsfvAMD GLEW_GET_FUN(__glewNamedFramebufferSamplePositionsfvAMD) + +#define GLEW_AMD_framebuffer_sample_positions GLEW_GET_VAR(__GLEW_AMD_framebuffer_sample_positions) + +#endif /* GL_AMD_framebuffer_sample_positions */ + /* --------------------------- GL_AMD_gcn_shader --------------------------- */ #ifndef GL_AMD_gcn_shader @@ -2629,6 +2721,38 @@ typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEINDEXEDAMDPROC) (GLuint buf, GL #endif /* GL_AMD_gcn_shader */ +/* ---------------------- GL_AMD_gpu_shader_half_float --------------------- */ + +#ifndef GL_AMD_gpu_shader_half_float +#define GL_AMD_gpu_shader_half_float 1 + +#define GL_FLOAT16_NV 0x8FF8 +#define GL_FLOAT16_VEC2_NV 0x8FF9 +#define GL_FLOAT16_VEC3_NV 0x8FFA +#define GL_FLOAT16_VEC4_NV 0x8FFB +#define GL_FLOAT16_MAT2_AMD 0x91C5 +#define GL_FLOAT16_MAT3_AMD 0x91C6 +#define GL_FLOAT16_MAT4_AMD 0x91C7 +#define GL_FLOAT16_MAT2x3_AMD 0x91C8 +#define GL_FLOAT16_MAT2x4_AMD 0x91C9 +#define GL_FLOAT16_MAT3x2_AMD 0x91CA +#define GL_FLOAT16_MAT3x4_AMD 0x91CB +#define GL_FLOAT16_MAT4x2_AMD 0x91CC +#define GL_FLOAT16_MAT4x3_AMD 0x91CD + +#define GLEW_AMD_gpu_shader_half_float GLEW_GET_VAR(__GLEW_AMD_gpu_shader_half_float) + +#endif /* GL_AMD_gpu_shader_half_float */ + +/* ------------------------ GL_AMD_gpu_shader_int16 ------------------------ */ + +#ifndef GL_AMD_gpu_shader_int16 +#define GL_AMD_gpu_shader_int16 1 + +#define GLEW_AMD_gpu_shader_int16 GLEW_GET_VAR(__GLEW_AMD_gpu_shader_int16) + +#endif /* GL_AMD_gpu_shader_int16 */ + /* ------------------------ GL_AMD_gpu_shader_int64 ------------------------ */ #ifndef GL_AMD_gpu_shader_int64 @@ -2771,6 +2895,17 @@ typedef void (GLAPIENTRY * PFNGLSELECTPERFMONITORCOUNTERSAMDPROC) (GLuint monito #endif /* GL_AMD_pinned_memory */ +/* ----------------------- GL_AMD_program_binary_Z400 ---------------------- */ + +#ifndef GL_AMD_program_binary_Z400 +#define GL_AMD_program_binary_Z400 1 + +#define GL_Z400_BINARY_AMD 0x8740 + +#define GLEW_AMD_program_binary_Z400 GLEW_GET_VAR(__GLEW_AMD_program_binary_Z400) + +#endif /* GL_AMD_program_binary_Z400 */ + /* ----------------------- GL_AMD_query_buffer_object ---------------------- */ #ifndef GL_AMD_query_buffer_object @@ -2804,7 +2939,7 @@ typedef void (GLAPIENTRY * PFNGLSETMULTISAMPLEFVAMDPROC) (GLenum pname, GLuint i #ifndef GL_AMD_seamless_cubemap_per_texture #define GL_AMD_seamless_cubemap_per_texture 1 -#define GL_TEXTURE_CUBE_MAP_SEAMLESS_ARB 0x884F +#define GL_TEXTURE_CUBE_MAP_SEAMLESS 0x884F #define GLEW_AMD_seamless_cubemap_per_texture GLEW_GET_VAR(__GLEW_AMD_seamless_cubemap_per_texture) @@ -2819,6 +2954,24 @@ typedef void (GLAPIENTRY * PFNGLSETMULTISAMPLEFVAMDPROC) (GLenum pname, GLuint i #endif /* GL_AMD_shader_atomic_counter_ops */ +/* -------------------------- GL_AMD_shader_ballot ------------------------- */ + +#ifndef GL_AMD_shader_ballot +#define GL_AMD_shader_ballot 1 + +#define GLEW_AMD_shader_ballot GLEW_GET_VAR(__GLEW_AMD_shader_ballot) + +#endif /* GL_AMD_shader_ballot */ + +/* ---------------- GL_AMD_shader_explicit_vertex_parameter ---------------- */ + +#ifndef GL_AMD_shader_explicit_vertex_parameter +#define GL_AMD_shader_explicit_vertex_parameter 1 + +#define GLEW_AMD_shader_explicit_vertex_parameter GLEW_GET_VAR(__GLEW_AMD_shader_explicit_vertex_parameter) + +#endif /* GL_AMD_shader_explicit_vertex_parameter */ + /* ---------------------- GL_AMD_shader_stencil_export --------------------- */ #ifndef GL_AMD_shader_stencil_export @@ -2889,6 +3042,15 @@ typedef void (GLAPIENTRY * PFNGLSTENCILOPVALUEAMDPROC) (GLenum face, GLuint valu #endif /* GL_AMD_stencil_operation_extended */ +/* --------------------- GL_AMD_texture_gather_bias_lod -------------------- */ + +#ifndef GL_AMD_texture_gather_bias_lod +#define GL_AMD_texture_gather_bias_lod 1 + +#define GLEW_AMD_texture_gather_bias_lod GLEW_GET_VAR(__GLEW_AMD_texture_gather_bias_lod) + +#endif /* GL_AMD_texture_gather_bias_lod */ + /* ------------------------ GL_AMD_texture_texture4 ------------------------ */ #ifndef GL_AMD_texture_texture4 @@ -2959,6 +3121,15 @@ typedef void (GLAPIENTRY * PFNGLTESSELLATIONMODEAMDPROC) (GLenum mode); #endif /* GL_AMD_vertex_shader_viewport_index */ +/* -------------------- GL_ANDROID_extension_pack_es31a -------------------- */ + +#ifndef GL_ANDROID_extension_pack_es31a +#define GL_ANDROID_extension_pack_es31a 1 + +#define GLEW_ANDROID_extension_pack_es31a GLEW_GET_VAR(__GLEW_ANDROID_extension_pack_es31a) + +#endif /* GL_ANDROID_extension_pack_es31a */ + /* ------------------------- GL_ANGLE_depth_texture ------------------------ */ #ifndef GL_ANGLE_depth_texture @@ -3175,6 +3346,47 @@ typedef void (GLAPIENTRY * PFNGLGETTRANSLATEDSHADERSOURCEANGLEPROC) (GLuint shad #endif /* GL_APPLE_client_storage */ +/* ------------------------- GL_APPLE_clip_distance ------------------------ */ + +#ifndef GL_APPLE_clip_distance +#define GL_APPLE_clip_distance 1 + +#define GL_MAX_CLIP_DISTANCES_APPLE 0x0D32 +#define GL_CLIP_DISTANCE0_APPLE 0x3000 +#define GL_CLIP_DISTANCE1_APPLE 0x3001 +#define GL_CLIP_DISTANCE2_APPLE 0x3002 +#define GL_CLIP_DISTANCE3_APPLE 0x3003 +#define GL_CLIP_DISTANCE4_APPLE 0x3004 +#define GL_CLIP_DISTANCE5_APPLE 0x3005 +#define GL_CLIP_DISTANCE6_APPLE 0x3006 +#define GL_CLIP_DISTANCE7_APPLE 0x3007 + +#define GLEW_APPLE_clip_distance GLEW_GET_VAR(__GLEW_APPLE_clip_distance) + +#endif /* GL_APPLE_clip_distance */ + +/* ------------------- GL_APPLE_color_buffer_packed_float ------------------ */ + +#ifndef GL_APPLE_color_buffer_packed_float +#define GL_APPLE_color_buffer_packed_float 1 + +#define GLEW_APPLE_color_buffer_packed_float GLEW_GET_VAR(__GLEW_APPLE_color_buffer_packed_float) + +#endif /* GL_APPLE_color_buffer_packed_float */ + +/* ---------------------- GL_APPLE_copy_texture_levels --------------------- */ + +#ifndef GL_APPLE_copy_texture_levels +#define GL_APPLE_copy_texture_levels 1 + +typedef void (GLAPIENTRY * PFNGLCOPYTEXTURELEVELSAPPLEPROC) (GLuint destinationTexture, GLuint sourceTexture, GLint sourceBaseLevel, GLsizei sourceLevelCount); + +#define glCopyTextureLevelsAPPLE GLEW_GET_FUN(__glewCopyTextureLevelsAPPLE) + +#define GLEW_APPLE_copy_texture_levels GLEW_GET_VAR(__GLEW_APPLE_copy_texture_levels) + +#endif /* GL_APPLE_copy_texture_levels */ + /* ------------------------- GL_APPLE_element_array ------------------------ */ #ifndef GL_APPLE_element_array @@ -3272,6 +3484,29 @@ typedef void (GLAPIENTRY * PFNGLFLUSHMAPPEDBUFFERRANGEAPPLEPROC) (GLenum target, #endif /* GL_APPLE_flush_buffer_range */ +/* -------------------- GL_APPLE_framebuffer_multisample ------------------- */ + +#ifndef GL_APPLE_framebuffer_multisample +#define GL_APPLE_framebuffer_multisample 1 + +#define GL_DRAW_FRAMEBUFFER_BINDING_APPLE 0x8CA6 +#define GL_READ_FRAMEBUFFER_APPLE 0x8CA8 +#define GL_DRAW_FRAMEBUFFER_APPLE 0x8CA9 +#define GL_READ_FRAMEBUFFER_BINDING_APPLE 0x8CAA +#define GL_RENDERBUFFER_SAMPLES_APPLE 0x8CAB +#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_APPLE 0x8D56 +#define GL_MAX_SAMPLES_APPLE 0x8D57 + +typedef void (GLAPIENTRY * PFNGLRENDERBUFFERSTORAGEMULTISAMPLEAPPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (GLAPIENTRY * PFNGLRESOLVEMULTISAMPLEFRAMEBUFFERAPPLEPROC) (void); + +#define glRenderbufferStorageMultisampleAPPLE GLEW_GET_FUN(__glewRenderbufferStorageMultisampleAPPLE) +#define glResolveMultisampleFramebufferAPPLE GLEW_GET_FUN(__glewResolveMultisampleFramebufferAPPLE) + +#define GLEW_APPLE_framebuffer_multisample GLEW_GET_VAR(__GLEW_APPLE_framebuffer_multisample) + +#endif /* GL_APPLE_framebuffer_multisample */ + /* ----------------------- GL_APPLE_object_purgeable ----------------------- */ #ifndef GL_APPLE_object_purgeable @@ -3344,6 +3579,94 @@ typedef GLenum (GLAPIENTRY * PFNGLOBJECTUNPURGEABLEAPPLEPROC) (GLenum objectType #endif /* GL_APPLE_specular_vector */ +/* ----------------------------- GL_APPLE_sync ----------------------------- */ + +#ifndef GL_APPLE_sync +#define GL_APPLE_sync 1 + +#define GL_SYNC_FLUSH_COMMANDS_BIT_APPLE 0x00000001 +#define GL_SYNC_OBJECT_APPLE 0x8A53 +#define GL_MAX_SERVER_WAIT_TIMEOUT_APPLE 0x9111 +#define GL_OBJECT_TYPE_APPLE 0x9112 +#define GL_SYNC_CONDITION_APPLE 0x9113 +#define GL_SYNC_STATUS_APPLE 0x9114 +#define GL_SYNC_FLAGS_APPLE 0x9115 +#define GL_SYNC_FENCE_APPLE 0x9116 +#define GL_SYNC_GPU_COMMANDS_COMPLETE_APPLE 0x9117 +#define GL_UNSIGNALED_APPLE 0x9118 +#define GL_SIGNALED_APPLE 0x9119 +#define GL_ALREADY_SIGNALED_APPLE 0x911A +#define GL_TIMEOUT_EXPIRED_APPLE 0x911B +#define GL_CONDITION_SATISFIED_APPLE 0x911C +#define GL_WAIT_FAILED_APPLE 0x911D +#define GL_TIMEOUT_IGNORED_APPLE 0xFFFFFFFFFFFFFFFFull + +typedef GLenum (GLAPIENTRY * PFNGLCLIENTWAITSYNCAPPLEPROC) (GLsync GLsync, GLbitfield flags, GLuint64 timeout); +typedef void (GLAPIENTRY * PFNGLDELETESYNCAPPLEPROC) (GLsync GLsync); +typedef GLsync (GLAPIENTRY * PFNGLFENCESYNCAPPLEPROC) (GLenum condition, GLbitfield flags); +typedef void (GLAPIENTRY * PFNGLGETINTEGER64VAPPLEPROC) (GLenum pname, GLint64* params); +typedef void (GLAPIENTRY * PFNGLGETSYNCIVAPPLEPROC) (GLsync GLsync, GLenum pname, GLsizei bufSize, GLsizei* length, GLint *values); +typedef GLboolean (GLAPIENTRY * PFNGLISSYNCAPPLEPROC) (GLsync GLsync); +typedef void (GLAPIENTRY * PFNGLWAITSYNCAPPLEPROC) (GLsync GLsync, GLbitfield flags, GLuint64 timeout); + +#define glClientWaitSyncAPPLE GLEW_GET_FUN(__glewClientWaitSyncAPPLE) +#define glDeleteSyncAPPLE GLEW_GET_FUN(__glewDeleteSyncAPPLE) +#define glFenceSyncAPPLE GLEW_GET_FUN(__glewFenceSyncAPPLE) +#define glGetInteger64vAPPLE GLEW_GET_FUN(__glewGetInteger64vAPPLE) +#define glGetSyncivAPPLE GLEW_GET_FUN(__glewGetSyncivAPPLE) +#define glIsSyncAPPLE GLEW_GET_FUN(__glewIsSyncAPPLE) +#define glWaitSyncAPPLE GLEW_GET_FUN(__glewWaitSyncAPPLE) + +#define GLEW_APPLE_sync GLEW_GET_VAR(__GLEW_APPLE_sync) + +#endif /* GL_APPLE_sync */ + +/* -------------------- GL_APPLE_texture_2D_limited_npot ------------------- */ + +#ifndef GL_APPLE_texture_2D_limited_npot +#define GL_APPLE_texture_2D_limited_npot 1 + +#define GLEW_APPLE_texture_2D_limited_npot GLEW_GET_VAR(__GLEW_APPLE_texture_2D_limited_npot) + +#endif /* GL_APPLE_texture_2D_limited_npot */ + +/* -------------------- GL_APPLE_texture_format_BGRA8888 ------------------- */ + +#ifndef GL_APPLE_texture_format_BGRA8888 +#define GL_APPLE_texture_format_BGRA8888 1 + +#define GL_BGRA_EXT 0x80E1 +#define GL_BGRA8_EXT 0x93A1 + +#define GLEW_APPLE_texture_format_BGRA8888 GLEW_GET_VAR(__GLEW_APPLE_texture_format_BGRA8888) + +#endif /* GL_APPLE_texture_format_BGRA8888 */ + +/* ----------------------- GL_APPLE_texture_max_level ---------------------- */ + +#ifndef GL_APPLE_texture_max_level +#define GL_APPLE_texture_max_level 1 + +#define GL_TEXTURE_MAX_LEVEL_APPLE 0x813D + +#define GLEW_APPLE_texture_max_level GLEW_GET_VAR(__GLEW_APPLE_texture_max_level) + +#endif /* GL_APPLE_texture_max_level */ + +/* --------------------- GL_APPLE_texture_packed_float --------------------- */ + +#ifndef GL_APPLE_texture_packed_float +#define GL_APPLE_texture_packed_float 1 + +#define GL_R11F_G11F_B10F_APPLE 0x8C3A +#define GL_UNSIGNED_INT_10F_11F_11F_REV_APPLE 0x8C3B +#define GL_RGB9_E5_APPLE 0x8C3D +#define GL_UNSIGNED_INT_5_9_9_9_REV_APPLE 0x8C3E + +#define GLEW_APPLE_texture_packed_float GLEW_GET_VAR(__GLEW_APPLE_texture_packed_float) + +#endif /* GL_APPLE_texture_packed_float */ + /* ------------------------- GL_APPLE_texture_range ------------------------ */ #ifndef GL_APPLE_texture_range @@ -3672,10 +3995,8 @@ typedef GLint (GLAPIENTRY * PFNGLGETFRAGDATAINDEXPROC) (GLuint program, const GL #define GL_BUFFER_STORAGE_FLAGS 0x8220 typedef void (GLAPIENTRY * PFNGLBUFFERSTORAGEPROC) (GLenum target, GLsizeiptr size, const void *data, GLbitfield flags); -typedef void (GLAPIENTRY * PFNGLNAMEDBUFFERSTORAGEEXTPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); #define glBufferStorage GLEW_GET_FUN(__glewBufferStorage) -#define glNamedBufferStorageEXT GLEW_GET_FUN(__glewNamedBufferStorageEXT) #define GLEW_ARB_buffer_storage GLEW_GET_VAR(__GLEW_ARB_buffer_storage) @@ -4023,8 +4344,8 @@ typedef void (GLAPIENTRY * PFNGLBLITNAMEDFRAMEBUFFERPROC) (GLuint readFramebuffe typedef GLenum (GLAPIENTRY * PFNGLCHECKNAMEDFRAMEBUFFERSTATUSPROC) (GLuint framebuffer, GLenum target); typedef void (GLAPIENTRY * PFNGLCLEARNAMEDBUFFERDATAPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); typedef void (GLAPIENTRY * PFNGLCLEARNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); -typedef void (GLAPIENTRY * PFNGLCLEARNAMEDFRAMEBUFFERFIPROC) (GLuint framebuffer, GLenum buffer, GLfloat depth, GLint stencil); -typedef void (GLAPIENTRY * PFNGLCLEARNAMEDFRAMEBUFFERFVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLfloat* value); +typedef void (GLAPIENTRY * PFNGLCLEARNAMEDFRAMEBUFFERFIPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, GLfloat depth, GLint stencil); +typedef void (GLAPIENTRY * PFNGLCLEARNAMEDFRAMEBUFFERFVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, GLfloat* value); typedef void (GLAPIENTRY * PFNGLCLEARNAMEDFRAMEBUFFERIVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLint* value); typedef void (GLAPIENTRY * PFNGLCLEARNAMEDFRAMEBUFFERUIVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLuint* value); typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); @@ -4055,10 +4376,10 @@ typedef void (GLAPIENTRY * PFNGLGETNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLint typedef void (GLAPIENTRY * PFNGLGETNAMEDFRAMEBUFFERATTACHMENTPARAMETERIVPROC) (GLuint framebuffer, GLenum attachment, GLenum pname, GLint* params); typedef void (GLAPIENTRY * PFNGLGETNAMEDFRAMEBUFFERPARAMETERIVPROC) (GLuint framebuffer, GLenum pname, GLint* param); typedef void (GLAPIENTRY * PFNGLGETNAMEDRENDERBUFFERPARAMETERIVPROC) (GLuint renderbuffer, GLenum pname, GLint* params); -typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTI64VPROC) (GLuint id,GLuint buffer,GLenum pname,GLintptr offset); -typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTIVPROC) (GLuint id,GLuint buffer,GLenum pname,GLintptr offset); -typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTUI64VPROC) (GLuint id,GLuint buffer,GLenum pname,GLintptr offset); -typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTUIVPROC) (GLuint id,GLuint buffer,GLenum pname,GLintptr offset); +typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTUI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (GLAPIENTRY * PFNGLGETQUERYBUFFEROBJECTUIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); typedef void (GLAPIENTRY * PFNGLGETTEXTUREIMAGEPROC) (GLuint texture, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); typedef void (GLAPIENTRY * PFNGLGETTEXTURELEVELPARAMETERFVPROC) (GLuint texture, GLint level, GLenum pname, GLfloat* params); typedef void (GLAPIENTRY * PFNGLGETTEXTURELEVELPARAMETERIVPROC) (GLuint texture, GLint level, GLenum pname, GLint* params); @@ -4273,10 +4594,10 @@ typedef void (GLAPIENTRY * PFNGLBLENDFUNCIARBPROC) (GLuint buf, GLenum src, GLen #ifndef GL_ARB_draw_elements_base_vertex #define GL_ARB_draw_elements_base_vertex 1 -typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); +typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, void *indices, GLint basevertex); typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount, GLint basevertex); -typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); -typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, const GLsizei* count, GLenum type, const void *const *indices, GLsizei primcount, const GLint *basevertex); +typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, void *indices, GLint basevertex); +typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei* count, GLenum type, void**indices, GLsizei primcount, GLint *basevertex); #define glDrawElementsBaseVertex GLEW_GET_FUN(__glewDrawElementsBaseVertex) #define glDrawElementsInstancedBaseVertex GLEW_GET_FUN(__glewDrawElementsInstancedBaseVertex) @@ -4663,6 +4984,22 @@ typedef void (GLAPIENTRY * PFNGLGETTEXTURESUBIMAGEPROC) (GLuint texture, GLint l #endif /* GL_ARB_get_texture_sub_image */ +/* ---------------------------- GL_ARB_gl_spirv ---------------------------- */ + +#ifndef GL_ARB_gl_spirv +#define GL_ARB_gl_spirv 1 + +#define GL_SHADER_BINARY_FORMAT_SPIR_V_ARB 0x9551 +#define GL_SPIR_V_BINARY_ARB 0x9552 + +typedef void (GLAPIENTRY * PFNGLSPECIALIZESHADERARBPROC) (GLuint shader, const GLchar* pEntryPoint, GLuint numSpecializationConstants, const GLuint* pConstantIndex, const GLuint* pConstantValue); + +#define glSpecializeShaderARB GLEW_GET_FUN(__glewSpecializeShaderARB) + +#define GLEW_ARB_gl_spirv GLEW_GET_VAR(__GLEW_ARB_gl_spirv) + +#endif /* GL_ARB_gl_spirv */ + /* --------------------------- GL_ARB_gpu_shader5 -------------------------- */ #ifndef GL_ARB_gpu_shader5 @@ -5562,6 +5899,21 @@ typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, const GL #endif /* GL_ARB_point_sprite */ +/* ---------------------- GL_ARB_polygon_offset_clamp ---------------------- */ + +#ifndef GL_ARB_polygon_offset_clamp +#define GL_ARB_polygon_offset_clamp 1 + +#define GL_POLYGON_OFFSET_CLAMP 0x8E1B + +typedef void (GLAPIENTRY * PFNGLPOLYGONOFFSETCLAMPPROC) (GLfloat factor, GLfloat units, GLfloat clamp); + +#define glPolygonOffsetClamp GLEW_GET_FUN(__glewPolygonOffsetClamp) + +#define GLEW_ARB_polygon_offset_clamp GLEW_GET_VAR(__GLEW_ARB_polygon_offset_clamp) + +#endif /* GL_ARB_polygon_offset_clamp */ + /* ----------------------- GL_ARB_post_depth_coverage ---------------------- */ #ifndef GL_ARB_post_depth_coverage @@ -6543,10 +6895,8 @@ typedef void (GLAPIENTRY * PFNGLBUFFERPAGECOMMITMENTARBPROC) (GLenum target, GLi #define GL_NUM_SPARSE_LEVELS_ARB 0x91AA typedef void (GLAPIENTRY * PFNGLTEXPAGECOMMITMENTARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); -typedef void (GLAPIENTRY * PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); #define glTexPageCommitmentARB GLEW_GET_FUN(__glewTexPageCommitmentARB) -#define glTexturePageCommitmentEXT GLEW_GET_FUN(__glewTexturePageCommitmentEXT) #define GLEW_ARB_sparse_texture GLEW_GET_VAR(__GLEW_ARB_sparse_texture) @@ -6570,6 +6920,18 @@ typedef void (GLAPIENTRY * PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, G #endif /* GL_ARB_sparse_texture_clamp */ +/* ------------------------ GL_ARB_spirv_extensions ------------------------ */ + +#ifndef GL_ARB_spirv_extensions +#define GL_ARB_spirv_extensions 1 + +#define GL_SPIR_V_EXTENSIONS 0x9553 +#define GL_NUM_SPIR_V_EXTENSIONS 0x9554 + +#define GLEW_ARB_spirv_extensions GLEW_GET_VAR(__GLEW_ARB_spirv_extensions) + +#endif /* GL_ARB_spirv_extensions */ + /* ------------------------ GL_ARB_stencil_texturing ----------------------- */ #ifndef GL_ARB_stencil_texturing @@ -6600,7 +6962,7 @@ typedef void (GLAPIENTRY * PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, G #define GL_TIMEOUT_EXPIRED 0x911B #define GL_CONDITION_SATISFIED 0x911C #define GL_WAIT_FAILED 0x911D -#define GL_TIMEOUT_IGNORED 0xFFFFFFFFFFFFFFFF +#define GL_TIMEOUT_IGNORED 0xFFFFFFFFFFFFFFFFull typedef GLenum (GLAPIENTRY * PFNGLCLIENTWAITSYNCPROC) (GLsync GLsync,GLbitfield flags,GLuint64 timeout); typedef void (GLAPIENTRY * PFNGLDELETESYNCPROC) (GLsync GLsync); @@ -6907,6 +7269,18 @@ typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GL #endif /* GL_ARB_texture_env_dot3 */ +/* ------------------- GL_ARB_texture_filter_anisotropic ------------------- */ + +#ifndef GL_ARB_texture_filter_anisotropic +#define GL_ARB_texture_filter_anisotropic 1 + +#define GL_TEXTURE_MAX_ANISOTROPY 0x84FE +#define GL_MAX_TEXTURE_MAX_ANISOTROPY 0x84FF + +#define GLEW_ARB_texture_filter_anisotropic GLEW_GET_VAR(__GLEW_ARB_texture_filter_anisotropic) + +#endif /* GL_ARB_texture_filter_anisotropic */ + /* ---------------------- GL_ARB_texture_filter_minmax --------------------- */ #ifndef GL_ARB_texture_filter_minmax @@ -7135,16 +7509,10 @@ typedef void (GLAPIENTRY * PFNGLTEXIMAGE3DMULTISAMPLEPROC) (GLenum target, GLsiz typedef void (GLAPIENTRY * PFNGLTEXSTORAGE1DPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); typedef void (GLAPIENTRY * PFNGLTEXSTORAGE2DPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); typedef void (GLAPIENTRY * PFNGLTEXSTORAGE3DPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); -typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE1DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); -typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE2DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); -typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE3DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); #define glTexStorage1D GLEW_GET_FUN(__glewTexStorage1D) #define glTexStorage2D GLEW_GET_FUN(__glewTexStorage2D) #define glTexStorage3D GLEW_GET_FUN(__glewTexStorage3D) -#define glTextureStorage1DEXT GLEW_GET_FUN(__glewTextureStorage1DEXT) -#define glTextureStorage2DEXT GLEW_GET_FUN(__glewTextureStorage2DEXT) -#define glTextureStorage3DEXT GLEW_GET_FUN(__glewTextureStorage3DEXT) #define GLEW_ARB_texture_storage GLEW_GET_VAR(__GLEW_ARB_texture_storage) @@ -7363,7 +7731,7 @@ typedef void (GLAPIENTRY * PFNGLMULTTRANSPOSEMATRIXFARBPROC) (GLfloat m[16]); #define GL_UNIFORM_BLOCK_REFERENCED_BY_VERTEX_SHADER 0x8A44 #define GL_UNIFORM_BLOCK_REFERENCED_BY_GEOMETRY_SHADER 0x8A45 #define GL_UNIFORM_BLOCK_REFERENCED_BY_FRAGMENT_SHADER 0x8A46 -#define GL_INVALID_INDEX 0xFFFFFFFF +#define GL_INVALID_INDEX 0xFFFFFFFFu typedef void (GLAPIENTRY * PFNGLBINDBUFFERBASEPROC) (GLenum target, GLuint index, GLuint buffer); typedef void (GLAPIENTRY * PFNGLBINDBUFFERRANGEPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); @@ -8069,6 +8437,60 @@ typedef void (GLAPIENTRY * PFNGLWINDOWPOS3SVARBPROC) (const GLshort* p); #endif /* GL_ARB_window_pos */ +/* ----------------------- GL_ARM_mali_program_binary ---------------------- */ + +#ifndef GL_ARM_mali_program_binary +#define GL_ARM_mali_program_binary 1 + +#define GL_MALI_PROGRAM_BINARY_ARM 0x8F61 + +#define GLEW_ARM_mali_program_binary GLEW_GET_VAR(__GLEW_ARM_mali_program_binary) + +#endif /* GL_ARM_mali_program_binary */ + +/* ----------------------- GL_ARM_mali_shader_binary ----------------------- */ + +#ifndef GL_ARM_mali_shader_binary +#define GL_ARM_mali_shader_binary 1 + +#define GL_MALI_SHADER_BINARY_ARM 0x8F60 + +#define GLEW_ARM_mali_shader_binary GLEW_GET_VAR(__GLEW_ARM_mali_shader_binary) + +#endif /* GL_ARM_mali_shader_binary */ + +/* ------------------------------ GL_ARM_rgba8 ----------------------------- */ + +#ifndef GL_ARM_rgba8 +#define GL_ARM_rgba8 1 + +#define GL_RGBA8_OES 0x8058 + +#define GLEW_ARM_rgba8 GLEW_GET_VAR(__GLEW_ARM_rgba8) + +#endif /* GL_ARM_rgba8 */ + +/* -------------------- GL_ARM_shader_framebuffer_fetch -------------------- */ + +#ifndef GL_ARM_shader_framebuffer_fetch +#define GL_ARM_shader_framebuffer_fetch 1 + +#define GL_FETCH_PER_SAMPLE_ARM 0x8F65 +#define GL_FRAGMENT_SHADER_FRAMEBUFFER_FETCH_MRT_ARM 0x8F66 + +#define GLEW_ARM_shader_framebuffer_fetch GLEW_GET_VAR(__GLEW_ARM_shader_framebuffer_fetch) + +#endif /* GL_ARM_shader_framebuffer_fetch */ + +/* ------------- GL_ARM_shader_framebuffer_fetch_depth_stencil ------------- */ + +#ifndef GL_ARM_shader_framebuffer_fetch_depth_stencil +#define GL_ARM_shader_framebuffer_fetch_depth_stencil 1 + +#define GLEW_ARM_shader_framebuffer_fetch_depth_stencil GLEW_GET_VAR(__GLEW_ARM_shader_framebuffer_fetch_depth_stencil) + +#endif /* GL_ARM_shader_framebuffer_fetch_depth_stencil */ + /* ------------------------- GL_ATIX_point_sprites ------------------------- */ #ifndef GL_ATIX_point_sprites @@ -8620,6 +9042,27 @@ typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GL #endif /* GL_ATI_vertex_streams */ +/* -------------------- GL_EGL_KHR_context_flush_control ------------------- */ + +#ifndef GL_EGL_KHR_context_flush_control +#define GL_EGL_KHR_context_flush_control 1 + +#define GLEW_EGL_KHR_context_flush_control GLEW_GET_VAR(__GLEW_EGL_KHR_context_flush_control) + +#endif /* GL_EGL_KHR_context_flush_control */ + +/* ---------------- GL_EGL_NV_robustness_video_memory_purge ---------------- */ + +#ifndef GL_EGL_NV_robustness_video_memory_purge +#define GL_EGL_NV_robustness_video_memory_purge 1 + +#define GL_EGL_GENERATE_RESET_ON_VIDEO_MEMORY_PURGE_NV 0x334C +#define GL_PURGED_CONTEXT_RESET_NV 0x92BB + +#define GLEW_EGL_NV_robustness_video_memory_purge GLEW_GET_VAR(__GLEW_EGL_NV_robustness_video_memory_purge) + +#endif /* GL_EGL_NV_robustness_video_memory_purge */ + /* --------------------------- GL_EXT_422_pixels --------------------------- */ #ifndef GL_EXT_422_pixels @@ -8646,6 +9089,26 @@ typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GL #endif /* GL_EXT_Cg_shader */ +/* ------------------------- GL_EXT_EGL_image_array ------------------------ */ + +#ifndef GL_EXT_EGL_image_array +#define GL_EXT_EGL_image_array 1 + +#define GLEW_EXT_EGL_image_array GLEW_GET_VAR(__GLEW_EXT_EGL_image_array) + +#endif /* GL_EXT_EGL_image_array */ + +/* --------------------------- GL_EXT_YUV_target --------------------------- */ + +#ifndef GL_EXT_YUV_target +#define GL_EXT_YUV_target 1 + +#define GL_SAMPLER_EXTERNAL_2D_Y2Y_EXT 0x8BE7 + +#define GLEW_EXT_YUV_target GLEW_GET_VAR(__GLEW_EXT_YUV_target) + +#endif /* GL_EXT_YUV_target */ + /* ------------------------------ GL_EXT_abgr ------------------------------ */ #ifndef GL_EXT_abgr @@ -8657,6 +9120,23 @@ typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GL #endif /* GL_EXT_abgr */ +/* -------------------------- GL_EXT_base_instance ------------------------- */ + +#ifndef GL_EXT_base_instance +#define GL_EXT_base_instance 1 + +typedef void (GLAPIENTRY * PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEEXTPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance); +typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance); +typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance); + +#define glDrawArraysInstancedBaseInstanceEXT GLEW_GET_FUN(__glewDrawArraysInstancedBaseInstanceEXT) +#define glDrawElementsInstancedBaseInstanceEXT GLEW_GET_FUN(__glewDrawElementsInstancedBaseInstanceEXT) +#define glDrawElementsInstancedBaseVertexBaseInstanceEXT GLEW_GET_FUN(__glewDrawElementsInstancedBaseVertexBaseInstanceEXT) + +#define GLEW_EXT_base_instance GLEW_GET_VAR(__GLEW_EXT_base_instance) + +#endif /* GL_EXT_base_instance */ + /* ------------------------------ GL_EXT_bgra ------------------------------ */ #ifndef GL_EXT_bgra @@ -8728,6 +9208,31 @@ typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONSEPARATEEXTPROC) (GLenum modeRGB, G #endif /* GL_EXT_blend_equation_separate */ +/* ----------------------- GL_EXT_blend_func_extended ---------------------- */ + +#ifndef GL_EXT_blend_func_extended +#define GL_EXT_blend_func_extended 1 + +#define GL_SRC_ALPHA_SATURATE_EXT 0x0308 +#define GL_SRC1_ALPHA_EXT 0x8589 +#define GL_SRC1_COLOR_EXT 0x88F9 +#define GL_ONE_MINUS_SRC1_COLOR_EXT 0x88FA +#define GL_ONE_MINUS_SRC1_ALPHA_EXT 0x88FB +#define GL_MAX_DUAL_SOURCE_DRAW_BUFFERS_EXT 0x88FC +#define GL_LOCATION_INDEX_EXT 0x930F + +typedef void (GLAPIENTRY * PFNGLBINDFRAGDATALOCATIONINDEXEDEXTPROC) (GLuint program, GLuint colorNumber, GLuint index, const GLchar * name); +typedef GLint (GLAPIENTRY * PFNGLGETFRAGDATAINDEXEXTPROC) (GLuint program, const GLchar * name); +typedef GLint (GLAPIENTRY * PFNGLGETPROGRAMRESOURCELOCATIONINDEXEXTPROC) (GLuint program, GLenum programInterface, const GLchar* name); + +#define glBindFragDataLocationIndexedEXT GLEW_GET_FUN(__glewBindFragDataLocationIndexedEXT) +#define glGetFragDataIndexEXT GLEW_GET_FUN(__glewGetFragDataIndexEXT) +#define glGetProgramResourceLocationIndexEXT GLEW_GET_FUN(__glewGetProgramResourceLocationIndexEXT) + +#define GLEW_EXT_blend_func_extended GLEW_GET_VAR(__GLEW_EXT_blend_func_extended) + +#endif /* GL_EXT_blend_func_extended */ + /* ----------------------- GL_EXT_blend_func_separate ---------------------- */ #ifndef GL_EXT_blend_func_separate @@ -8785,6 +9290,67 @@ typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONEXTPROC) (GLenum mode); #endif /* GL_EXT_blend_subtract */ +/* ------------------------- GL_EXT_buffer_storage ------------------------- */ + +#ifndef GL_EXT_buffer_storage +#define GL_EXT_buffer_storage 1 + +#define GL_MAP_READ_BIT 0x0001 +#define GL_MAP_WRITE_BIT 0x0002 +#define GL_MAP_PERSISTENT_BIT_EXT 0x0040 +#define GL_MAP_COHERENT_BIT_EXT 0x0080 +#define GL_DYNAMIC_STORAGE_BIT_EXT 0x0100 +#define GL_CLIENT_STORAGE_BIT_EXT 0x0200 +#define GL_CLIENT_MAPPED_BUFFER_BARRIER_BIT_EXT 0x00004000 +#define GL_BUFFER_IMMUTABLE_STORAGE_EXT 0x821F +#define GL_BUFFER_STORAGE_FLAGS_EXT 0x8220 + +typedef void (GLAPIENTRY * PFNGLBUFFERSTORAGEEXTPROC) (GLenum target, GLsizeiptr size, const void *data, GLbitfield flags); +typedef void (GLAPIENTRY * PFNGLNAMEDBUFFERSTORAGEEXTPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); + +#define glBufferStorageEXT GLEW_GET_FUN(__glewBufferStorageEXT) +#define glNamedBufferStorageEXT GLEW_GET_FUN(__glewNamedBufferStorageEXT) + +#define GLEW_EXT_buffer_storage GLEW_GET_VAR(__GLEW_EXT_buffer_storage) + +#endif /* GL_EXT_buffer_storage */ + +/* -------------------------- GL_EXT_clear_texture ------------------------- */ + +#ifndef GL_EXT_clear_texture +#define GL_EXT_clear_texture 1 + +typedef void (GLAPIENTRY * PFNGLCLEARTEXIMAGEEXTPROC) (GLuint texture, GLint level, GLenum format, GLenum type, const void *data); +typedef void (GLAPIENTRY * PFNGLCLEARTEXSUBIMAGEEXTPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *data); + +#define glClearTexImageEXT GLEW_GET_FUN(__glewClearTexImageEXT) +#define glClearTexSubImageEXT GLEW_GET_FUN(__glewClearTexSubImageEXT) + +#define GLEW_EXT_clear_texture GLEW_GET_VAR(__GLEW_EXT_clear_texture) + +#endif /* GL_EXT_clear_texture */ + +/* ----------------------- GL_EXT_clip_cull_distance ----------------------- */ + +#ifndef GL_EXT_clip_cull_distance +#define GL_EXT_clip_cull_distance 1 + +#define GL_MAX_CLIP_DISTANCES_EXT 0x0D32 +#define GL_CLIP_DISTANCE0_EXT 0x3000 +#define GL_CLIP_DISTANCE1_EXT 0x3001 +#define GL_CLIP_DISTANCE2_EXT 0x3002 +#define GL_CLIP_DISTANCE3_EXT 0x3003 +#define GL_CLIP_DISTANCE4_EXT 0x3004 +#define GL_CLIP_DISTANCE5_EXT 0x3005 +#define GL_CLIP_DISTANCE6_EXT 0x3006 +#define GL_CLIP_DISTANCE7_EXT 0x3007 +#define GL_MAX_CULL_DISTANCES_EXT 0x82F9 +#define GL_MAX_COMBINED_CLIP_AND_CULL_DISTANCES_EXT 0x82FA + +#define GLEW_EXT_clip_cull_distance GLEW_GET_VAR(__GLEW_EXT_clip_cull_distance) + +#endif /* GL_EXT_clip_cull_distance */ + /* ------------------------ GL_EXT_clip_volume_hint ------------------------ */ #ifndef GL_EXT_clip_volume_hint @@ -8810,6 +9376,31 @@ typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONEXTPROC) (GLenum mode); #endif /* GL_EXT_cmyka */ +/* ----------------------- GL_EXT_color_buffer_float ----------------------- */ + +#ifndef GL_EXT_color_buffer_float +#define GL_EXT_color_buffer_float 1 + +#define GLEW_EXT_color_buffer_float GLEW_GET_VAR(__GLEW_EXT_color_buffer_float) + +#endif /* GL_EXT_color_buffer_float */ + +/* --------------------- GL_EXT_color_buffer_half_float -------------------- */ + +#ifndef GL_EXT_color_buffer_half_float +#define GL_EXT_color_buffer_half_float 1 + +#define GL_FRAMEBUFFER_ATTACHMENT_COMPONENT_TYPE_EXT 0x8211 +#define GL_R16F_EXT 0x822D +#define GL_RG16F_EXT 0x822F +#define GL_RGBA16F_EXT 0x881A +#define GL_RGB16F_EXT 0x881B +#define GL_UNSIGNED_NORMALIZED_EXT 0x8C17 + +#define GLEW_EXT_color_buffer_half_float GLEW_GET_VAR(__GLEW_EXT_color_buffer_half_float) + +#endif /* GL_EXT_color_buffer_half_float */ + /* ------------------------- GL_EXT_color_subtable ------------------------- */ #ifndef GL_EXT_color_subtable @@ -8843,6 +9434,24 @@ typedef void (GLAPIENTRY * PFNGLUNLOCKARRAYSEXTPROC) (void); #endif /* GL_EXT_compiled_vertex_array */ +/* ---------------- GL_EXT_compressed_ETC1_RGB8_sub_texture ---------------- */ + +#ifndef GL_EXT_compressed_ETC1_RGB8_sub_texture +#define GL_EXT_compressed_ETC1_RGB8_sub_texture 1 + +#define GLEW_EXT_compressed_ETC1_RGB8_sub_texture GLEW_GET_VAR(__GLEW_EXT_compressed_ETC1_RGB8_sub_texture) + +#endif /* GL_EXT_compressed_ETC1_RGB8_sub_texture */ + +/* ----------------------- GL_EXT_conservative_depth ----------------------- */ + +#ifndef GL_EXT_conservative_depth +#define GL_EXT_conservative_depth 1 + +#define GLEW_EXT_conservative_depth GLEW_GET_VAR(__GLEW_EXT_conservative_depth) + +#endif /* GL_EXT_conservative_depth */ + /* --------------------------- GL_EXT_convolution -------------------------- */ #ifndef GL_EXT_convolution @@ -8931,6 +9540,19 @@ typedef void (GLAPIENTRY * PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei str #endif /* GL_EXT_coordinate_frame */ +/* --------------------------- GL_EXT_copy_image --------------------------- */ + +#ifndef GL_EXT_copy_image +#define GL_EXT_copy_image 1 + +typedef void (GLAPIENTRY * PFNGLCOPYIMAGESUBDATAEXTPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); + +#define glCopyImageSubDataEXT GLEW_GET_FUN(__glewCopyImageSubDataEXT) + +#define GLEW_EXT_copy_image GLEW_GET_VAR(__GLEW_EXT_copy_image) + +#endif /* GL_EXT_copy_image */ + /* -------------------------- GL_EXT_copy_texture -------------------------- */ #ifndef GL_EXT_copy_texture @@ -9469,28 +10091,139 @@ typedef void (GLAPIENTRY * PFNGLVERTEXARRAYVERTEXOFFSETEXTPROC) (GLuint vaobj, G #endif /* GL_EXT_direct_state_access */ -/* -------------------------- GL_EXT_draw_buffers2 ------------------------- */ +/* ----------------------- GL_EXT_discard_framebuffer ---------------------- */ -#ifndef GL_EXT_draw_buffers2 -#define GL_EXT_draw_buffers2 1 +#ifndef GL_EXT_discard_framebuffer +#define GL_EXT_discard_framebuffer 1 -typedef void (GLAPIENTRY * PFNGLCOLORMASKINDEXEDEXTPROC) (GLuint buf, GLboolean r, GLboolean g, GLboolean b, GLboolean a); -typedef void (GLAPIENTRY * PFNGLDISABLEINDEXEDEXTPROC) (GLenum target, GLuint index); -typedef void (GLAPIENTRY * PFNGLENABLEINDEXEDEXTPROC) (GLenum target, GLuint index); -typedef void (GLAPIENTRY * PFNGLGETBOOLEANINDEXEDVEXTPROC) (GLenum value, GLuint index, GLboolean* data); -typedef void (GLAPIENTRY * PFNGLGETINTEGERINDEXEDVEXTPROC) (GLenum value, GLuint index, GLint* data); -typedef GLboolean (GLAPIENTRY * PFNGLISENABLEDINDEXEDEXTPROC) (GLenum target, GLuint index); +#define GL_COLOR_EXT 0x1800 +#define GL_DEPTH_EXT 0x1801 +#define GL_STENCIL_EXT 0x1802 -#define glColorMaskIndexedEXT GLEW_GET_FUN(__glewColorMaskIndexedEXT) -#define glDisableIndexedEXT GLEW_GET_FUN(__glewDisableIndexedEXT) -#define glEnableIndexedEXT GLEW_GET_FUN(__glewEnableIndexedEXT) -#define glGetBooleanIndexedvEXT GLEW_GET_FUN(__glewGetBooleanIndexedvEXT) -#define glGetIntegerIndexedvEXT GLEW_GET_FUN(__glewGetIntegerIndexedvEXT) -#define glIsEnabledIndexedEXT GLEW_GET_FUN(__glewIsEnabledIndexedEXT) +typedef void (GLAPIENTRY * PFNGLDISCARDFRAMEBUFFEREXTPROC) (GLenum target, GLsizei numAttachments, const GLenum* attachments); -#define GLEW_EXT_draw_buffers2 GLEW_GET_VAR(__GLEW_EXT_draw_buffers2) +#define glDiscardFramebufferEXT GLEW_GET_FUN(__glewDiscardFramebufferEXT) -#endif /* GL_EXT_draw_buffers2 */ +#define GLEW_EXT_discard_framebuffer GLEW_GET_VAR(__GLEW_EXT_discard_framebuffer) + +#endif /* GL_EXT_discard_framebuffer */ + +/* -------------------------- GL_EXT_draw_buffers -------------------------- */ + +#ifndef GL_EXT_draw_buffers +#define GL_EXT_draw_buffers 1 + +#define GL_MAX_DRAW_BUFFERS_EXT 0x8824 +#define GL_DRAW_BUFFER0_EXT 0x8825 +#define GL_DRAW_BUFFER1_EXT 0x8826 +#define GL_DRAW_BUFFER2_EXT 0x8827 +#define GL_DRAW_BUFFER3_EXT 0x8828 +#define GL_DRAW_BUFFER4_EXT 0x8829 +#define GL_DRAW_BUFFER5_EXT 0x882A +#define GL_DRAW_BUFFER6_EXT 0x882B +#define GL_DRAW_BUFFER7_EXT 0x882C +#define GL_DRAW_BUFFER8_EXT 0x882D +#define GL_DRAW_BUFFER9_EXT 0x882E +#define GL_DRAW_BUFFER10_EXT 0x882F +#define GL_DRAW_BUFFER11_EXT 0x8830 +#define GL_DRAW_BUFFER12_EXT 0x8831 +#define GL_DRAW_BUFFER13_EXT 0x8832 +#define GL_DRAW_BUFFER14_EXT 0x8833 +#define GL_DRAW_BUFFER15_EXT 0x8834 +#define GL_MAX_COLOR_ATTACHMENTS_EXT 0x8CDF +#define GL_COLOR_ATTACHMENT0_EXT 0x8CE0 +#define GL_COLOR_ATTACHMENT1_EXT 0x8CE1 +#define GL_COLOR_ATTACHMENT2_EXT 0x8CE2 +#define GL_COLOR_ATTACHMENT3_EXT 0x8CE3 +#define GL_COLOR_ATTACHMENT4_EXT 0x8CE4 +#define GL_COLOR_ATTACHMENT5_EXT 0x8CE5 +#define GL_COLOR_ATTACHMENT6_EXT 0x8CE6 +#define GL_COLOR_ATTACHMENT7_EXT 0x8CE7 +#define GL_COLOR_ATTACHMENT8_EXT 0x8CE8 +#define GL_COLOR_ATTACHMENT9_EXT 0x8CE9 +#define GL_COLOR_ATTACHMENT10_EXT 0x8CEA +#define GL_COLOR_ATTACHMENT11_EXT 0x8CEB +#define GL_COLOR_ATTACHMENT12_EXT 0x8CEC +#define GL_COLOR_ATTACHMENT13_EXT 0x8CED +#define GL_COLOR_ATTACHMENT14_EXT 0x8CEE +#define GL_COLOR_ATTACHMENT15_EXT 0x8CEF + +typedef void (GLAPIENTRY * PFNGLDRAWBUFFERSEXTPROC) (GLsizei n, const GLenum* bufs); + +#define glDrawBuffersEXT GLEW_GET_FUN(__glewDrawBuffersEXT) + +#define GLEW_EXT_draw_buffers GLEW_GET_VAR(__GLEW_EXT_draw_buffers) + +#endif /* GL_EXT_draw_buffers */ + +/* -------------------------- GL_EXT_draw_buffers2 ------------------------- */ + +#ifndef GL_EXT_draw_buffers2 +#define GL_EXT_draw_buffers2 1 + +typedef void (GLAPIENTRY * PFNGLCOLORMASKINDEXEDEXTPROC) (GLuint buf, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +typedef void (GLAPIENTRY * PFNGLDISABLEINDEXEDEXTPROC) (GLenum target, GLuint index); +typedef void (GLAPIENTRY * PFNGLENABLEINDEXEDEXTPROC) (GLenum target, GLuint index); +typedef void (GLAPIENTRY * PFNGLGETBOOLEANINDEXEDVEXTPROC) (GLenum value, GLuint index, GLboolean* data); +typedef void (GLAPIENTRY * PFNGLGETINTEGERINDEXEDVEXTPROC) (GLenum value, GLuint index, GLint* data); +typedef GLboolean (GLAPIENTRY * PFNGLISENABLEDINDEXEDEXTPROC) (GLenum target, GLuint index); + +#define glColorMaskIndexedEXT GLEW_GET_FUN(__glewColorMaskIndexedEXT) +#define glDisableIndexedEXT GLEW_GET_FUN(__glewDisableIndexedEXT) +#define glEnableIndexedEXT GLEW_GET_FUN(__glewEnableIndexedEXT) +#define glGetBooleanIndexedvEXT GLEW_GET_FUN(__glewGetBooleanIndexedvEXT) +#define glGetIntegerIndexedvEXT GLEW_GET_FUN(__glewGetIntegerIndexedvEXT) +#define glIsEnabledIndexedEXT GLEW_GET_FUN(__glewIsEnabledIndexedEXT) + +#define GLEW_EXT_draw_buffers2 GLEW_GET_VAR(__GLEW_EXT_draw_buffers2) + +#endif /* GL_EXT_draw_buffers2 */ + +/* ---------------------- GL_EXT_draw_buffers_indexed ---------------------- */ + +#ifndef GL_EXT_draw_buffers_indexed +#define GL_EXT_draw_buffers_indexed 1 + +typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONSEPARATEIEXTPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONIEXTPROC) (GLuint buf, GLenum mode); +typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEIEXTPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +typedef void (GLAPIENTRY * PFNGLBLENDFUNCIEXTPROC) (GLuint buf, GLenum src, GLenum dst); +typedef void (GLAPIENTRY * PFNGLCOLORMASKIEXTPROC) (GLuint buf, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +typedef void (GLAPIENTRY * PFNGLDISABLEIEXTPROC) (GLenum target, GLuint index); +typedef void (GLAPIENTRY * PFNGLENABLEIEXTPROC) (GLenum target, GLuint index); +typedef GLboolean (GLAPIENTRY * PFNGLISENABLEDIEXTPROC) (GLenum target, GLuint index); + +#define glBlendEquationSeparateiEXT GLEW_GET_FUN(__glewBlendEquationSeparateiEXT) +#define glBlendEquationiEXT GLEW_GET_FUN(__glewBlendEquationiEXT) +#define glBlendFuncSeparateiEXT GLEW_GET_FUN(__glewBlendFuncSeparateiEXT) +#define glBlendFunciEXT GLEW_GET_FUN(__glewBlendFunciEXT) +#define glColorMaskiEXT GLEW_GET_FUN(__glewColorMaskiEXT) +#define glDisableiEXT GLEW_GET_FUN(__glewDisableiEXT) +#define glEnableiEXT GLEW_GET_FUN(__glewEnableiEXT) +#define glIsEnablediEXT GLEW_GET_FUN(__glewIsEnablediEXT) + +#define GLEW_EXT_draw_buffers_indexed GLEW_GET_VAR(__GLEW_EXT_draw_buffers_indexed) + +#endif /* GL_EXT_draw_buffers_indexed */ + +/* -------------------- GL_EXT_draw_elements_base_vertex ------------------- */ + +#ifndef GL_EXT_draw_elements_base_vertex +#define GL_EXT_draw_elements_base_vertex 1 + +typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSBASEVERTEXEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); +typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); +typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTSBASEVERTEXEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); +typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSBASEVERTEXEXTPROC) (GLenum mode, const GLsizei* count, GLenum type, const void *const *indices, GLsizei primcount, const GLint *basevertex); + +#define glDrawElementsBaseVertexEXT GLEW_GET_FUN(__glewDrawElementsBaseVertexEXT) +#define glDrawElementsInstancedBaseVertexEXT GLEW_GET_FUN(__glewDrawElementsInstancedBaseVertexEXT) +#define glDrawRangeElementsBaseVertexEXT GLEW_GET_FUN(__glewDrawRangeElementsBaseVertexEXT) +#define glMultiDrawElementsBaseVertexEXT GLEW_GET_FUN(__glewMultiDrawElementsBaseVertexEXT) + +#define GLEW_EXT_draw_elements_base_vertex GLEW_GET_VAR(__GLEW_EXT_draw_elements_base_vertex) + +#endif /* GL_EXT_draw_elements_base_vertex */ /* ------------------------- GL_EXT_draw_instanced ------------------------- */ @@ -9523,6 +10256,32 @@ typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint s #endif /* GL_EXT_draw_range_elements */ +/* ------------------------- GL_EXT_external_buffer ------------------------ */ + +#ifndef GL_EXT_external_buffer +#define GL_EXT_external_buffer 1 + +typedef void* GLeglClientBufferEXT; + +typedef void (GLAPIENTRY * PFNGLBUFFERSTORAGEEXTERNALEXTPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +typedef void (GLAPIENTRY * PFNGLNAMEDBUFFERSTORAGEEXTERNALEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); + +#define glBufferStorageExternalEXT GLEW_GET_FUN(__glewBufferStorageExternalEXT) +#define glNamedBufferStorageExternalEXT GLEW_GET_FUN(__glewNamedBufferStorageExternalEXT) + +#define GLEW_EXT_external_buffer GLEW_GET_VAR(__GLEW_EXT_external_buffer) + +#endif /* GL_EXT_external_buffer */ + +/* --------------------------- GL_EXT_float_blend -------------------------- */ + +#ifndef GL_EXT_float_blend +#define GL_EXT_float_blend 1 + +#define GLEW_EXT_float_blend GLEW_GET_VAR(__GLEW_EXT_float_blend) + +#endif /* GL_EXT_float_blend */ + /* ---------------------------- GL_EXT_fog_coord --------------------------- */ #ifndef GL_EXT_fog_coord @@ -9553,6 +10312,15 @@ typedef void (GLAPIENTRY * PFNGLFOGCOORDFVEXTPROC) (const GLfloat *coord); #endif /* GL_EXT_fog_coord */ +/* --------------------------- GL_EXT_frag_depth --------------------------- */ + +#ifndef GL_EXT_frag_depth +#define GL_EXT_frag_depth 1 + +#define GLEW_EXT_frag_depth GLEW_GET_VAR(__GLEW_EXT_frag_depth) + +#endif /* GL_EXT_frag_depth */ + /* ------------------------ GL_EXT_fragment_lighting ----------------------- */ #ifndef GL_EXT_fragment_lighting @@ -9771,6 +10539,92 @@ typedef void (GLAPIENTRY * PFNGLRENDERBUFFERSTORAGEEXTPROC) (GLenum target, GLen #endif /* GL_EXT_framebuffer_sRGB */ +/* ----------------------- GL_EXT_geometry_point_size ---------------------- */ + +#ifndef GL_EXT_geometry_point_size +#define GL_EXT_geometry_point_size 1 + +#define GL_GEOMETRY_SHADER_BIT_EXT 0x00000004 +#define GL_LINES_ADJACENCY_EXT 0xA +#define GL_LINE_STRIP_ADJACENCY_EXT 0xB +#define GL_TRIANGLES_ADJACENCY_EXT 0xC +#define GL_TRIANGLE_STRIP_ADJACENCY_EXT 0xD +#define GL_LAYER_PROVOKING_VERTEX_EXT 0x825E +#define GL_UNDEFINED_VERTEX_EXT 0x8260 +#define GL_GEOMETRY_SHADER_INVOCATIONS_EXT 0x887F +#define GL_GEOMETRY_LINKED_VERTICES_OUT_EXT 0x8916 +#define GL_GEOMETRY_LINKED_INPUT_TYPE_EXT 0x8917 +#define GL_GEOMETRY_LINKED_OUTPUT_TYPE_EXT 0x8918 +#define GL_MAX_GEOMETRY_UNIFORM_BLOCKS_EXT 0x8A2C +#define GL_MAX_COMBINED_GEOMETRY_UNIFORM_COMPONENTS_EXT 0x8A32 +#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_EXT 0x8C29 +#define GL_PRIMITIVES_GENERATED_EXT 0x8C87 +#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED_EXT 0x8DA7 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_EXT 0x8DA8 +#define GL_GEOMETRY_SHADER_EXT 0x8DD9 +#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS_EXT 0x8DDF +#define GL_MAX_GEOMETRY_OUTPUT_VERTICES_EXT 0x8DE0 +#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS_EXT 0x8DE1 +#define GL_FIRST_VERTEX_CONVENTION_EXT 0x8E4D +#define GL_LAST_VERTEX_CONVENTION_EXT 0x8E4E +#define GL_MAX_GEOMETRY_SHADER_INVOCATIONS_EXT 0x8E5A +#define GL_MAX_GEOMETRY_IMAGE_UNIFORMS_EXT 0x90CD +#define GL_MAX_GEOMETRY_SHADER_STORAGE_BLOCKS_EXT 0x90D7 +#define GL_MAX_GEOMETRY_INPUT_COMPONENTS_EXT 0x9123 +#define GL_MAX_GEOMETRY_OUTPUT_COMPONENTS_EXT 0x9124 +#define GL_MAX_GEOMETRY_ATOMIC_COUNTER_BUFFERS_EXT 0x92CF +#define GL_MAX_GEOMETRY_ATOMIC_COUNTERS_EXT 0x92D5 +#define GL_REFERENCED_BY_GEOMETRY_SHADER_EXT 0x9309 +#define GL_FRAMEBUFFER_DEFAULT_LAYERS_EXT 0x9312 +#define GL_MAX_FRAMEBUFFER_LAYERS_EXT 0x9317 + +#define GLEW_EXT_geometry_point_size GLEW_GET_VAR(__GLEW_EXT_geometry_point_size) + +#endif /* GL_EXT_geometry_point_size */ + +/* ------------------------- GL_EXT_geometry_shader ------------------------ */ + +#ifndef GL_EXT_geometry_shader +#define GL_EXT_geometry_shader 1 + +#define GL_GEOMETRY_SHADER_BIT_EXT 0x00000004 +#define GL_LINES_ADJACENCY_EXT 0xA +#define GL_LINE_STRIP_ADJACENCY_EXT 0xB +#define GL_TRIANGLES_ADJACENCY_EXT 0xC +#define GL_TRIANGLE_STRIP_ADJACENCY_EXT 0xD +#define GL_LAYER_PROVOKING_VERTEX_EXT 0x825E +#define GL_UNDEFINED_VERTEX_EXT 0x8260 +#define GL_GEOMETRY_SHADER_INVOCATIONS_EXT 0x887F +#define GL_GEOMETRY_LINKED_VERTICES_OUT_EXT 0x8916 +#define GL_GEOMETRY_LINKED_INPUT_TYPE_EXT 0x8917 +#define GL_GEOMETRY_LINKED_OUTPUT_TYPE_EXT 0x8918 +#define GL_MAX_GEOMETRY_UNIFORM_BLOCKS_EXT 0x8A2C +#define GL_MAX_COMBINED_GEOMETRY_UNIFORM_COMPONENTS_EXT 0x8A32 +#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_EXT 0x8C29 +#define GL_PRIMITIVES_GENERATED_EXT 0x8C87 +#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED_EXT 0x8DA7 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_EXT 0x8DA8 +#define GL_GEOMETRY_SHADER_EXT 0x8DD9 +#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS_EXT 0x8DDF +#define GL_MAX_GEOMETRY_OUTPUT_VERTICES_EXT 0x8DE0 +#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS_EXT 0x8DE1 +#define GL_FIRST_VERTEX_CONVENTION_EXT 0x8E4D +#define GL_LAST_VERTEX_CONVENTION_EXT 0x8E4E +#define GL_MAX_GEOMETRY_SHADER_INVOCATIONS_EXT 0x8E5A +#define GL_MAX_GEOMETRY_IMAGE_UNIFORMS_EXT 0x90CD +#define GL_MAX_GEOMETRY_SHADER_STORAGE_BLOCKS_EXT 0x90D7 +#define GL_MAX_GEOMETRY_INPUT_COMPONENTS_EXT 0x9123 +#define GL_MAX_GEOMETRY_OUTPUT_COMPONENTS_EXT 0x9124 +#define GL_MAX_GEOMETRY_ATOMIC_COUNTER_BUFFERS_EXT 0x92CF +#define GL_MAX_GEOMETRY_ATOMIC_COUNTERS_EXT 0x92D5 +#define GL_REFERENCED_BY_GEOMETRY_SHADER_EXT 0x9309 +#define GL_FRAMEBUFFER_DEFAULT_LAYERS_EXT 0x9312 +#define GL_MAX_FRAMEBUFFER_LAYERS_EXT 0x9317 + +#define GLEW_EXT_geometry_shader GLEW_GET_VAR(__GLEW_EXT_geometry_shader) + +#endif /* GL_EXT_geometry_shader */ + /* ------------------------ GL_EXT_geometry_shader4 ------------------------ */ #ifndef GL_EXT_geometry_shader4 @@ -9930,6 +10784,15 @@ typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBIPOINTEREXTPROC) (GLuint index, GLin #endif /* GL_EXT_gpu_shader4 */ +/* --------------------------- GL_EXT_gpu_shader5 -------------------------- */ + +#ifndef GL_EXT_gpu_shader5 +#define GL_EXT_gpu_shader5 1 + +#define GLEW_EXT_gpu_shader5 GLEW_GET_VAR(__GLEW_EXT_gpu_shader5) + +#endif /* GL_EXT_gpu_shader5 */ + /* ---------------------------- GL_EXT_histogram --------------------------- */ #ifndef GL_EXT_histogram @@ -10019,6 +10882,21 @@ typedef void (GLAPIENTRY * PFNGLINDEXMATERIALEXTPROC) (GLenum face, GLenum mode) #endif /* GL_EXT_index_texture */ +/* ------------------------ GL_EXT_instanced_arrays ------------------------ */ + +#ifndef GL_EXT_instanced_arrays +#define GL_EXT_instanced_arrays 1 + +#define GL_VERTEX_ATTRIB_ARRAY_DIVISOR_EXT 0x88FE + +typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBDIVISOREXTPROC) (GLuint index, GLuint divisor); + +#define glVertexAttribDivisorEXT GLEW_GET_FUN(__glewVertexAttribDivisorEXT) + +#define GLEW_EXT_instanced_arrays GLEW_GET_VAR(__GLEW_EXT_instanced_arrays) + +#endif /* GL_EXT_instanced_arrays */ + /* -------------------------- GL_EXT_light_texture ------------------------- */ #ifndef GL_EXT_light_texture @@ -10046,6 +10924,138 @@ typedef void (GLAPIENTRY * PFNGLTEXTUREMATERIALEXTPROC) (GLenum face, GLenum mod #endif /* GL_EXT_light_texture */ +/* ------------------------ GL_EXT_map_buffer_range ------------------------ */ + +#ifndef GL_EXT_map_buffer_range +#define GL_EXT_map_buffer_range 1 + +#define GL_MAP_READ_BIT_EXT 0x0001 +#define GL_MAP_WRITE_BIT_EXT 0x0002 +#define GL_MAP_INVALIDATE_RANGE_BIT_EXT 0x0004 +#define GL_MAP_INVALIDATE_BUFFER_BIT_EXT 0x0008 +#define GL_MAP_FLUSH_EXPLICIT_BIT_EXT 0x0010 +#define GL_MAP_UNSYNCHRONIZED_BIT_EXT 0x0020 + +typedef void (GLAPIENTRY * PFNGLFLUSHMAPPEDBUFFERRANGEEXTPROC) (GLenum target, GLintptr offset, GLsizeiptr length); +typedef void * (GLAPIENTRY * PFNGLMAPBUFFERRANGEEXTPROC) (GLenum target, GLintptr offset, GLsizeiptr length, GLbitfield access); + +#define glFlushMappedBufferRangeEXT GLEW_GET_FUN(__glewFlushMappedBufferRangeEXT) +#define glMapBufferRangeEXT GLEW_GET_FUN(__glewMapBufferRangeEXT) + +#define GLEW_EXT_map_buffer_range GLEW_GET_VAR(__GLEW_EXT_map_buffer_range) + +#endif /* GL_EXT_map_buffer_range */ + +/* -------------------------- GL_EXT_memory_object ------------------------- */ + +#ifndef GL_EXT_memory_object +#define GL_EXT_memory_object 1 + +#define GL_UUID_SIZE_EXT 16 +#define GL_TEXTURE_TILING_EXT 0x9580 +#define GL_DEDICATED_MEMORY_OBJECT_EXT 0x9581 +#define GL_NUM_TILING_TYPES_EXT 0x9582 +#define GL_TILING_TYPES_EXT 0x9583 +#define GL_OPTIMAL_TILING_EXT 0x9584 +#define GL_LINEAR_TILING_EXT 0x9585 +#define GL_LAYOUT_GENERAL_EXT 0x958D +#define GL_LAYOUT_COLOR_ATTACHMENT_EXT 0x958E +#define GL_LAYOUT_DEPTH_STENCIL_ATTACHMENT_EXT 0x958F +#define GL_LAYOUT_DEPTH_STENCIL_READ_ONLY_EXT 0x9590 +#define GL_LAYOUT_SHADER_READ_ONLY_EXT 0x9591 +#define GL_LAYOUT_TRANSFER_SRC_EXT 0x9592 +#define GL_LAYOUT_TRANSFER_DST_EXT 0x9593 +#define GL_NUM_DEVICE_UUIDS_EXT 0x9596 +#define GL_DEVICE_UUID_EXT 0x9597 +#define GL_DRIVER_UUID_EXT 0x9598 +#define GL_PROTECTED_MEMORY_OBJECT_EXT 0x959B + +typedef void (GLAPIENTRY * PFNGLBUFFERSTORAGEMEMEXTPROC) (GLenum target, GLsizeiptr size, GLuint memory, GLuint64 offset); +typedef void (GLAPIENTRY * PFNGLCREATEMEMORYOBJECTSEXTPROC) (GLsizei n, GLuint* memoryObjects); +typedef void (GLAPIENTRY * PFNGLDELETEMEMORYOBJECTSEXTPROC) (GLsizei n, const GLuint* memoryObjects); +typedef void (GLAPIENTRY * PFNGLGETMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, GLint* params); +typedef void (GLAPIENTRY * PFNGLGETUNSIGNEDBYTEI_VEXTPROC) (GLenum target, GLuint index, GLubyte* data); +typedef void (GLAPIENTRY * PFNGLGETUNSIGNEDBYTEVEXTPROC) (GLenum pname, GLubyte* data); +typedef GLboolean (GLAPIENTRY * PFNGLISMEMORYOBJECTEXTPROC) (GLuint memoryObject); +typedef void (GLAPIENTRY * PFNGLMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, const GLint* params); +typedef void (GLAPIENTRY * PFNGLNAMEDBUFFERSTORAGEMEMEXTPROC) (GLuint buffer, GLsizeiptr size, GLuint memory, GLuint64 offset); +typedef void (GLAPIENTRY * PFNGLTEXSTORAGEMEM1DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +typedef void (GLAPIENTRY * PFNGLTEXSTORAGEMEM2DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (GLAPIENTRY * PFNGLTEXSTORAGEMEM2DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (GLAPIENTRY * PFNGLTEXSTORAGEMEM3DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (GLAPIENTRY * PFNGLTEXSTORAGEMEM3DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGEMEM1DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGEMEM2DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGEMEM2DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGEMEM3DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGEMEM3DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); + +#define glBufferStorageMemEXT GLEW_GET_FUN(__glewBufferStorageMemEXT) +#define glCreateMemoryObjectsEXT GLEW_GET_FUN(__glewCreateMemoryObjectsEXT) +#define glDeleteMemoryObjectsEXT GLEW_GET_FUN(__glewDeleteMemoryObjectsEXT) +#define glGetMemoryObjectParameterivEXT GLEW_GET_FUN(__glewGetMemoryObjectParameterivEXT) +#define glGetUnsignedBytei_vEXT GLEW_GET_FUN(__glewGetUnsignedBytei_vEXT) +#define glGetUnsignedBytevEXT GLEW_GET_FUN(__glewGetUnsignedBytevEXT) +#define glIsMemoryObjectEXT GLEW_GET_FUN(__glewIsMemoryObjectEXT) +#define glMemoryObjectParameterivEXT GLEW_GET_FUN(__glewMemoryObjectParameterivEXT) +#define glNamedBufferStorageMemEXT GLEW_GET_FUN(__glewNamedBufferStorageMemEXT) +#define glTexStorageMem1DEXT GLEW_GET_FUN(__glewTexStorageMem1DEXT) +#define glTexStorageMem2DEXT GLEW_GET_FUN(__glewTexStorageMem2DEXT) +#define glTexStorageMem2DMultisampleEXT GLEW_GET_FUN(__glewTexStorageMem2DMultisampleEXT) +#define glTexStorageMem3DEXT GLEW_GET_FUN(__glewTexStorageMem3DEXT) +#define glTexStorageMem3DMultisampleEXT GLEW_GET_FUN(__glewTexStorageMem3DMultisampleEXT) +#define glTextureStorageMem1DEXT GLEW_GET_FUN(__glewTextureStorageMem1DEXT) +#define glTextureStorageMem2DEXT GLEW_GET_FUN(__glewTextureStorageMem2DEXT) +#define glTextureStorageMem2DMultisampleEXT GLEW_GET_FUN(__glewTextureStorageMem2DMultisampleEXT) +#define glTextureStorageMem3DEXT GLEW_GET_FUN(__glewTextureStorageMem3DEXT) +#define glTextureStorageMem3DMultisampleEXT GLEW_GET_FUN(__glewTextureStorageMem3DMultisampleEXT) + +#define GLEW_EXT_memory_object GLEW_GET_VAR(__GLEW_EXT_memory_object) + +#endif /* GL_EXT_memory_object */ + +/* ------------------------ GL_EXT_memory_object_fd ------------------------ */ + +#ifndef GL_EXT_memory_object_fd +#define GL_EXT_memory_object_fd 1 + +#define GL_HANDLE_TYPE_OPAQUE_FD_EXT 0x9586 + +typedef void (GLAPIENTRY * PFNGLIMPORTMEMORYFDEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, GLint fd); + +#define glImportMemoryFdEXT GLEW_GET_FUN(__glewImportMemoryFdEXT) + +#define GLEW_EXT_memory_object_fd GLEW_GET_VAR(__GLEW_EXT_memory_object_fd) + +#endif /* GL_EXT_memory_object_fd */ + +/* ----------------------- GL_EXT_memory_object_win32 ---------------------- */ + +#ifndef GL_EXT_memory_object_win32 +#define GL_EXT_memory_object_win32 1 + +#define GL_LUID_SIZE_EXT 8 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_EXT 0x9587 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_KMT_EXT 0x9588 +#define GL_HANDLE_TYPE_D3D12_TILEPOOL_EXT 0x9589 +#define GL_HANDLE_TYPE_D3D12_RESOURCE_EXT 0x958A +#define GL_HANDLE_TYPE_D3D11_IMAGE_EXT 0x958B +#define GL_HANDLE_TYPE_D3D11_IMAGE_KMT_EXT 0x958C +#define GL_HANDLE_TYPE_D3D12_FENCE_EXT 0x9594 +#define GL_D3D12_FENCE_VALUE_EXT 0x9595 +#define GL_DEVICE_LUID_EXT 0x9599 +#define GL_DEVICE_NODE_MASK_EXT 0x959A + +typedef void (GLAPIENTRY * PFNGLIMPORTMEMORYWIN32HANDLEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, void *handle); +typedef void (GLAPIENTRY * PFNGLIMPORTMEMORYWIN32NAMEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, const void *name); + +#define glImportMemoryWin32HandleEXT GLEW_GET_FUN(__glewImportMemoryWin32HandleEXT) +#define glImportMemoryWin32NameEXT GLEW_GET_FUN(__glewImportMemoryWin32NameEXT) + +#define GLEW_EXT_memory_object_win32 GLEW_GET_VAR(__GLEW_EXT_memory_object_win32) + +#endif /* GL_EXT_memory_object_win32 */ + /* ------------------------- GL_EXT_misc_attribute ------------------------- */ #ifndef GL_EXT_misc_attribute @@ -10070,6 +11080,30 @@ typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, GLsizei* #endif /* GL_EXT_multi_draw_arrays */ +/* ----------------------- GL_EXT_multi_draw_indirect ---------------------- */ + +#ifndef GL_EXT_multi_draw_indirect +#define GL_EXT_multi_draw_indirect 1 + +typedef void (GLAPIENTRY * PFNGLMULTIDRAWARRAYSINDIRECTEXTPROC) (GLenum mode, const void *indirect, GLsizei drawcount, GLsizei stride); +typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSINDIRECTEXTPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei drawcount, GLsizei stride); + +#define glMultiDrawArraysIndirectEXT GLEW_GET_FUN(__glewMultiDrawArraysIndirectEXT) +#define glMultiDrawElementsIndirectEXT GLEW_GET_FUN(__glewMultiDrawElementsIndirectEXT) + +#define GLEW_EXT_multi_draw_indirect GLEW_GET_VAR(__GLEW_EXT_multi_draw_indirect) + +#endif /* GL_EXT_multi_draw_indirect */ + +/* ------------------------ GL_EXT_multiple_textures ----------------------- */ + +#ifndef GL_EXT_multiple_textures +#define GL_EXT_multiple_textures 1 + +#define GLEW_EXT_multiple_textures GLEW_GET_VAR(__GLEW_EXT_multiple_textures) + +#endif /* GL_EXT_multiple_textures */ + /* --------------------------- GL_EXT_multisample -------------------------- */ #ifndef GL_EXT_multisample @@ -10103,6 +11137,68 @@ typedef void (GLAPIENTRY * PFNGLSAMPLEPATTERNEXTPROC) (GLenum pattern); #endif /* GL_EXT_multisample */ +/* -------------------- GL_EXT_multisample_compatibility ------------------- */ + +#ifndef GL_EXT_multisample_compatibility +#define GL_EXT_multisample_compatibility 1 + +#define GL_MULTISAMPLE_EXT 0x809D +#define GL_SAMPLE_ALPHA_TO_ONE_EXT 0x809F + +#define GLEW_EXT_multisample_compatibility GLEW_GET_VAR(__GLEW_EXT_multisample_compatibility) + +#endif /* GL_EXT_multisample_compatibility */ + +/* ----------------- GL_EXT_multisampled_render_to_texture ----------------- */ + +#ifndef GL_EXT_multisampled_render_to_texture +#define GL_EXT_multisampled_render_to_texture 1 + +#define GL_RENDERBUFFER_SAMPLES_EXT 0x8CAB +#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_EXT 0x8D56 +#define GL_MAX_SAMPLES_EXT 0x8D57 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_SAMPLES_EXT 0x8D6C + +typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURE2DMULTISAMPLEEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLsizei samples); + +#define glFramebufferTexture2DMultisampleEXT GLEW_GET_FUN(__glewFramebufferTexture2DMultisampleEXT) + +#define GLEW_EXT_multisampled_render_to_texture GLEW_GET_VAR(__GLEW_EXT_multisampled_render_to_texture) + +#endif /* GL_EXT_multisampled_render_to_texture */ + +/* ----------------- GL_EXT_multisampled_render_to_texture2 ---------------- */ + +#ifndef GL_EXT_multisampled_render_to_texture2 +#define GL_EXT_multisampled_render_to_texture2 1 + +#define GLEW_EXT_multisampled_render_to_texture2 GLEW_GET_VAR(__GLEW_EXT_multisampled_render_to_texture2) + +#endif /* GL_EXT_multisampled_render_to_texture2 */ + +/* --------------------- GL_EXT_multiview_draw_buffers --------------------- */ + +#ifndef GL_EXT_multiview_draw_buffers +#define GL_EXT_multiview_draw_buffers 1 + +#define GL_DRAW_BUFFER_EXT 0x0C01 +#define GL_READ_BUFFER_EXT 0x0C02 +#define GL_COLOR_ATTACHMENT_EXT 0x90F0 +#define GL_MULTIVIEW_EXT 0x90F1 +#define GL_MAX_MULTIVIEW_BUFFERS_EXT 0x90F2 + +typedef void (GLAPIENTRY * PFNGLDRAWBUFFERSINDEXEDEXTPROC) (GLint n, const GLenum* location, const GLint *indices); +typedef void (GLAPIENTRY * PFNGLGETINTEGERI_VEXTPROC) (GLenum target, GLuint index, GLint* data); +typedef void (GLAPIENTRY * PFNGLREADBUFFERINDEXEDEXTPROC) (GLenum src, GLint index); + +#define glDrawBuffersIndexedEXT GLEW_GET_FUN(__glewDrawBuffersIndexedEXT) +#define glGetIntegeri_vEXT GLEW_GET_FUN(__glewGetIntegeri_vEXT) +#define glReadBufferIndexedEXT GLEW_GET_FUN(__glewReadBufferIndexedEXT) + +#define GLEW_EXT_multiview_draw_buffers GLEW_GET_VAR(__GLEW_EXT_multiview_draw_buffers) + +#endif /* GL_EXT_multiview_draw_buffers */ + /* ---------------------- GL_EXT_packed_depth_stencil ---------------------- */ #ifndef GL_EXT_packed_depth_stencil @@ -10321,6 +11417,20 @@ typedef void (GLAPIENTRY * PFNGLPROVOKINGVERTEXEXTPROC) (GLenum mode); #endif /* GL_EXT_provoking_vertex */ +/* --------------------------- GL_EXT_pvrtc_sRGB --------------------------- */ + +#ifndef GL_EXT_pvrtc_sRGB +#define GL_EXT_pvrtc_sRGB 1 + +#define GL_COMPRESSED_SRGB_PVRTC_2BPPV1_EXT 0x8A54 +#define GL_COMPRESSED_SRGB_PVRTC_4BPPV1_EXT 0x8A55 +#define GL_COMPRESSED_SRGB_ALPHA_PVRTC_2BPPV1_EXT 0x8A56 +#define GL_COMPRESSED_SRGB_ALPHA_PVRTC_4BPPV1_EXT 0x8A57 + +#define GLEW_EXT_pvrtc_sRGB GLEW_GET_VAR(__GLEW_EXT_pvrtc_sRGB) + +#endif /* GL_EXT_pvrtc_sRGB */ + /* ----------------------- GL_EXT_raster_multisample ----------------------- */ #ifndef GL_EXT_raster_multisample @@ -10355,6 +11465,37 @@ typedef void (GLAPIENTRY * PFNGLRASTERSAMPLESEXTPROC) (GLuint samples, GLboolean #endif /* GL_EXT_raster_multisample */ +/* ------------------------ GL_EXT_read_format_bgra ------------------------ */ + +#ifndef GL_EXT_read_format_bgra +#define GL_EXT_read_format_bgra 1 + +#define GL_BGRA_EXT 0x80E1 +#define GL_UNSIGNED_SHORT_4_4_4_4_REV_EXT 0x8365 +#define GL_UNSIGNED_SHORT_1_5_5_5_REV_EXT 0x8366 + +#define GLEW_EXT_read_format_bgra GLEW_GET_VAR(__GLEW_EXT_read_format_bgra) + +#endif /* GL_EXT_read_format_bgra */ + +/* -------------------------- GL_EXT_render_snorm -------------------------- */ + +#ifndef GL_EXT_render_snorm +#define GL_EXT_render_snorm 1 + +#define GL_BYTE 0x1400 +#define GL_SHORT 0x1402 +#define GL_R8_SNORM 0x8F94 +#define GL_RG8_SNORM 0x8F95 +#define GL_RGBA8_SNORM 0x8F97 +#define GL_R16_SNORM_EXT 0x8F98 +#define GL_RG16_SNORM_EXT 0x8F99 +#define GL_RGBA16_SNORM_EXT 0x8F9B + +#define GLEW_EXT_render_snorm GLEW_GET_VAR(__GLEW_EXT_render_snorm) + +#endif /* GL_EXT_render_snorm */ + /* ------------------------- GL_EXT_rescale_normal ------------------------- */ #ifndef GL_EXT_rescale_normal @@ -10366,6 +11507,31 @@ typedef void (GLAPIENTRY * PFNGLRASTERSAMPLESEXTPROC) (GLuint samples, GLboolean #endif /* GL_EXT_rescale_normal */ +/* ------------------------------ GL_EXT_sRGB ------------------------------ */ + +#ifndef GL_EXT_sRGB +#define GL_EXT_sRGB 1 + +#define GL_FRAMEBUFFER_ATTACHMENT_COLOR_ENCODING_EXT 0x8210 +#define GL_SRGB_EXT 0x8C40 +#define GL_SRGB_ALPHA_EXT 0x8C42 +#define GL_SRGB8_ALPHA8_EXT 0x8C43 + +#define GLEW_EXT_sRGB GLEW_GET_VAR(__GLEW_EXT_sRGB) + +#endif /* GL_EXT_sRGB */ + +/* ----------------------- GL_EXT_sRGB_write_control ----------------------- */ + +#ifndef GL_EXT_sRGB_write_control +#define GL_EXT_sRGB_write_control 1 + +#define GL_FRAMEBUFFER_SRGB_EXT 0x8DB9 + +#define GLEW_EXT_sRGB_write_control GLEW_GET_VAR(__GLEW_EXT_sRGB_write_control) + +#endif /* GL_EXT_sRGB_write_control */ + /* -------------------------- GL_EXT_scene_marker -------------------------- */ #ifndef GL_EXT_scene_marker @@ -10434,6 +11600,59 @@ typedef void (GLAPIENTRY * PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenu #endif /* GL_EXT_secondary_color */ +/* ---------------------------- GL_EXT_semaphore --------------------------- */ + +#ifndef GL_EXT_semaphore +#define GL_EXT_semaphore 1 + +typedef void (GLAPIENTRY * PFNGLDELETESEMAPHORESEXTPROC) (GLsizei n, const GLuint* semaphores); +typedef void (GLAPIENTRY * PFNGLGENSEMAPHORESEXTPROC) (GLsizei n, GLuint* semaphores); +typedef void (GLAPIENTRY * PFNGLGETSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, GLuint64* params); +typedef GLboolean (GLAPIENTRY * PFNGLISSEMAPHOREEXTPROC) (GLuint semaphore); +typedef void (GLAPIENTRY * PFNGLSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, const GLuint64* params); +typedef void (GLAPIENTRY * PFNGLSIGNALSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint* buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *dstLayouts); +typedef void (GLAPIENTRY * PFNGLWAITSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint* buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *srcLayouts); + +#define glDeleteSemaphoresEXT GLEW_GET_FUN(__glewDeleteSemaphoresEXT) +#define glGenSemaphoresEXT GLEW_GET_FUN(__glewGenSemaphoresEXT) +#define glGetSemaphoreParameterui64vEXT GLEW_GET_FUN(__glewGetSemaphoreParameterui64vEXT) +#define glIsSemaphoreEXT GLEW_GET_FUN(__glewIsSemaphoreEXT) +#define glSemaphoreParameterui64vEXT GLEW_GET_FUN(__glewSemaphoreParameterui64vEXT) +#define glSignalSemaphoreEXT GLEW_GET_FUN(__glewSignalSemaphoreEXT) +#define glWaitSemaphoreEXT GLEW_GET_FUN(__glewWaitSemaphoreEXT) + +#define GLEW_EXT_semaphore GLEW_GET_VAR(__GLEW_EXT_semaphore) + +#endif /* GL_EXT_semaphore */ + +/* -------------------------- GL_EXT_semaphore_fd -------------------------- */ + +#ifndef GL_EXT_semaphore_fd +#define GL_EXT_semaphore_fd 1 + +typedef void (GLAPIENTRY * PFNGLIMPORTSEMAPHOREFDEXTPROC) (GLuint semaphore, GLenum handleType, GLint fd); + +#define glImportSemaphoreFdEXT GLEW_GET_FUN(__glewImportSemaphoreFdEXT) + +#define GLEW_EXT_semaphore_fd GLEW_GET_VAR(__GLEW_EXT_semaphore_fd) + +#endif /* GL_EXT_semaphore_fd */ + +/* ------------------------- GL_EXT_semaphore_win32 ------------------------ */ + +#ifndef GL_EXT_semaphore_win32 +#define GL_EXT_semaphore_win32 1 + +typedef void (GLAPIENTRY * PFNGLIMPORTSEMAPHOREWIN32HANDLEEXTPROC) (GLuint semaphore, GLenum handleType, void *handle); +typedef void (GLAPIENTRY * PFNGLIMPORTSEMAPHOREWIN32NAMEEXTPROC) (GLuint semaphore, GLenum handleType, const void *name); + +#define glImportSemaphoreWin32HandleEXT GLEW_GET_FUN(__glewImportSemaphoreWin32HandleEXT) +#define glImportSemaphoreWin32NameEXT GLEW_GET_FUN(__glewImportSemaphoreWin32NameEXT) + +#define GLEW_EXT_semaphore_win32 GLEW_GET_VAR(__GLEW_EXT_semaphore_win32) + +#endif /* GL_EXT_semaphore_win32 */ + /* --------------------- GL_EXT_separate_shader_objects -------------------- */ #ifndef GL_EXT_separate_shader_objects @@ -10466,6 +11685,26 @@ typedef void (GLAPIENTRY * PFNGLUSESHADERPROGRAMEXTPROC) (GLenum type, GLuint pr #endif /* GL_EXT_separate_specular_color */ +/* -------------------- GL_EXT_shader_framebuffer_fetch -------------------- */ + +#ifndef GL_EXT_shader_framebuffer_fetch +#define GL_EXT_shader_framebuffer_fetch 1 + +#define GL_FRAGMENT_SHADER_DISCARDS_SAMPLES_EXT 0x8A52 + +#define GLEW_EXT_shader_framebuffer_fetch GLEW_GET_VAR(__GLEW_EXT_shader_framebuffer_fetch) + +#endif /* GL_EXT_shader_framebuffer_fetch */ + +/* ------------------------ GL_EXT_shader_group_vote ----------------------- */ + +#ifndef GL_EXT_shader_group_vote +#define GL_EXT_shader_group_vote 1 + +#define GLEW_EXT_shader_group_vote GLEW_GET_VAR(__GLEW_EXT_shader_group_vote) + +#endif /* GL_EXT_shader_group_vote */ + /* ------------------- GL_EXT_shader_image_load_formatted ------------------ */ #ifndef GL_EXT_shader_image_load_formatted @@ -10546,6 +11785,15 @@ typedef void (GLAPIENTRY * PFNGLMEMORYBARRIEREXTPROC) (GLbitfield barriers); #endif /* GL_EXT_shader_image_load_store */ +/* ------------------- GL_EXT_shader_implicit_conversions ------------------ */ + +#ifndef GL_EXT_shader_implicit_conversions +#define GL_EXT_shader_implicit_conversions 1 + +#define GLEW_EXT_shader_implicit_conversions GLEW_GET_VAR(__GLEW_EXT_shader_implicit_conversions) + +#endif /* GL_EXT_shader_implicit_conversions */ + /* ----------------------- GL_EXT_shader_integer_mix ----------------------- */ #ifndef GL_EXT_shader_integer_mix @@ -10555,6 +11803,67 @@ typedef void (GLAPIENTRY * PFNGLMEMORYBARRIEREXTPROC) (GLbitfield barriers); #endif /* GL_EXT_shader_integer_mix */ +/* ------------------------ GL_EXT_shader_io_blocks ------------------------ */ + +#ifndef GL_EXT_shader_io_blocks +#define GL_EXT_shader_io_blocks 1 + +#define GLEW_EXT_shader_io_blocks GLEW_GET_VAR(__GLEW_EXT_shader_io_blocks) + +#endif /* GL_EXT_shader_io_blocks */ + +/* ------------- GL_EXT_shader_non_constant_global_initializers ------------ */ + +#ifndef GL_EXT_shader_non_constant_global_initializers +#define GL_EXT_shader_non_constant_global_initializers 1 + +#define GLEW_EXT_shader_non_constant_global_initializers GLEW_GET_VAR(__GLEW_EXT_shader_non_constant_global_initializers) + +#endif /* GL_EXT_shader_non_constant_global_initializers */ + +/* ------------------- GL_EXT_shader_pixel_local_storage ------------------- */ + +#ifndef GL_EXT_shader_pixel_local_storage +#define GL_EXT_shader_pixel_local_storage 1 + +#define GL_MAX_SHADER_PIXEL_LOCAL_STORAGE_FAST_SIZE_EXT 0x8F63 +#define GL_SHADER_PIXEL_LOCAL_STORAGE_EXT 0x8F64 +#define GL_MAX_SHADER_PIXEL_LOCAL_STORAGE_SIZE_EXT 0x8F67 + +#define GLEW_EXT_shader_pixel_local_storage GLEW_GET_VAR(__GLEW_EXT_shader_pixel_local_storage) + +#endif /* GL_EXT_shader_pixel_local_storage */ + +/* ------------------- GL_EXT_shader_pixel_local_storage2 ------------------ */ + +#ifndef GL_EXT_shader_pixel_local_storage2 +#define GL_EXT_shader_pixel_local_storage2 1 + +#define GL_MAX_SHADER_COMBINED_LOCAL_STORAGE_FAST_SIZE_EXT 0x9650 +#define GL_MAX_SHADER_COMBINED_LOCAL_STORAGE_SIZE_EXT 0x9651 +#define GL_FRAMEBUFFER_INCOMPLETE_INSUFFICIENT_SHADER_COMBINED_LOCAL_STORAGE_EXT 0x9652 + +typedef void (GLAPIENTRY * PFNGLCLEARPIXELLOCALSTORAGEUIEXTPROC) (GLsizei offset, GLsizei n, const GLuint* values); +typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERPIXELLOCALSTORAGESIZEEXTPROC) (GLuint target, GLsizei size); +typedef GLsizei (GLAPIENTRY * PFNGLGETFRAMEBUFFERPIXELLOCALSTORAGESIZEEXTPROC) (GLuint target); + +#define glClearPixelLocalStorageuiEXT GLEW_GET_FUN(__glewClearPixelLocalStorageuiEXT) +#define glFramebufferPixelLocalStorageSizeEXT GLEW_GET_FUN(__glewFramebufferPixelLocalStorageSizeEXT) +#define glGetFramebufferPixelLocalStorageSizeEXT GLEW_GET_FUN(__glewGetFramebufferPixelLocalStorageSizeEXT) + +#define GLEW_EXT_shader_pixel_local_storage2 GLEW_GET_VAR(__GLEW_EXT_shader_pixel_local_storage2) + +#endif /* GL_EXT_shader_pixel_local_storage2 */ + +/* ----------------------- GL_EXT_shader_texture_lod ----------------------- */ + +#ifndef GL_EXT_shader_texture_lod +#define GL_EXT_shader_texture_lod 1 + +#define GLEW_EXT_shader_texture_lod GLEW_GET_VAR(__GLEW_EXT_shader_texture_lod) + +#endif /* GL_EXT_shader_texture_lod */ + /* -------------------------- GL_EXT_shadow_funcs -------------------------- */ #ifndef GL_EXT_shadow_funcs @@ -10564,6 +11873,20 @@ typedef void (GLAPIENTRY * PFNGLMEMORYBARRIEREXTPROC) (GLbitfield barriers); #endif /* GL_EXT_shadow_funcs */ +/* ------------------------- GL_EXT_shadow_samplers ------------------------ */ + +#ifndef GL_EXT_shadow_samplers +#define GL_EXT_shadow_samplers 1 + +#define GL_TEXTURE_COMPARE_MODE_EXT 0x884C +#define GL_TEXTURE_COMPARE_FUNC_EXT 0x884D +#define GL_COMPARE_REF_TO_TEXTURE_EXT 0x884E +#define GL_SAMPLER_2D_SHADOW_EXT 0x8B62 + +#define GLEW_EXT_shadow_samplers GLEW_GET_VAR(__GLEW_EXT_shadow_samplers) + +#endif /* GL_EXT_shadow_samplers */ + /* --------------------- GL_EXT_shared_texture_palette --------------------- */ #ifndef GL_EXT_shared_texture_palette @@ -10575,6 +11898,38 @@ typedef void (GLAPIENTRY * PFNGLMEMORYBARRIEREXTPROC) (GLbitfield barriers); #endif /* GL_EXT_shared_texture_palette */ +/* ------------------------- GL_EXT_sparse_texture ------------------------- */ + +#ifndef GL_EXT_sparse_texture +#define GL_EXT_sparse_texture 1 + +#define GL_TEXTURE_2D 0x0DE1 +#define GL_TEXTURE_3D 0x806F +#define GL_TEXTURE_CUBE_MAP 0x8513 +#define GL_TEXTURE_2D_ARRAY 0x8C1A +#define GL_TEXTURE_CUBE_MAP_ARRAY_OES 0x9009 +#define GL_VIRTUAL_PAGE_SIZE_X_EXT 0x9195 +#define GL_VIRTUAL_PAGE_SIZE_Y_EXT 0x9196 +#define GL_VIRTUAL_PAGE_SIZE_Z_EXT 0x9197 +#define GL_MAX_SPARSE_TEXTURE_SIZE_EXT 0x9198 +#define GL_MAX_SPARSE_3D_TEXTURE_SIZE_EXT 0x9199 +#define GL_MAX_SPARSE_ARRAY_TEXTURE_LAYERS_EXT 0x919A +#define GL_TEXTURE_SPARSE_EXT 0x91A6 +#define GL_VIRTUAL_PAGE_SIZE_INDEX_EXT 0x91A7 +#define GL_NUM_VIRTUAL_PAGE_SIZES_EXT 0x91A8 +#define GL_SPARSE_TEXTURE_FULL_ARRAY_CUBE_MIPMAPS_EXT 0x91A9 +#define GL_NUM_SPARSE_LEVELS_EXT 0x91AA + +typedef void (GLAPIENTRY * PFNGLTEXPAGECOMMITMENTEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); +typedef void (GLAPIENTRY * PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); + +#define glTexPageCommitmentEXT GLEW_GET_FUN(__glewTexPageCommitmentEXT) +#define glTexturePageCommitmentEXT GLEW_GET_FUN(__glewTexturePageCommitmentEXT) + +#define GLEW_EXT_sparse_texture GLEW_GET_VAR(__GLEW_EXT_sparse_texture) + +#endif /* GL_EXT_sparse_texture */ + /* ------------------------- GL_EXT_sparse_texture2 ------------------------ */ #ifndef GL_EXT_sparse_texture2 @@ -10757,6 +12112,42 @@ typedef void (GLAPIENTRY * PFNGLTEXBUFFEREXTPROC) (GLenum target, GLenum interna #endif /* GL_EXT_texture_buffer_object */ +/* -------------- GL_EXT_texture_compression_astc_decode_mode -------------- */ + +#ifndef GL_EXT_texture_compression_astc_decode_mode +#define GL_EXT_texture_compression_astc_decode_mode 1 + +#define GL_TEXTURE_ASTC_DECODE_PRECISION_EXT 0x8F69 + +#define GLEW_EXT_texture_compression_astc_decode_mode GLEW_GET_VAR(__GLEW_EXT_texture_compression_astc_decode_mode) + +#endif /* GL_EXT_texture_compression_astc_decode_mode */ + +/* ----------- GL_EXT_texture_compression_astc_decode_mode_rgb9e5 ---------- */ + +#ifndef GL_EXT_texture_compression_astc_decode_mode_rgb9e5 +#define GL_EXT_texture_compression_astc_decode_mode_rgb9e5 1 + +#define GL_TEXTURE_ASTC_DECODE_PRECISION_EXT 0x8F69 + +#define GLEW_EXT_texture_compression_astc_decode_mode_rgb9e5 GLEW_GET_VAR(__GLEW_EXT_texture_compression_astc_decode_mode_rgb9e5) + +#endif /* GL_EXT_texture_compression_astc_decode_mode_rgb9e5 */ + +/* -------------------- GL_EXT_texture_compression_bptc -------------------- */ + +#ifndef GL_EXT_texture_compression_bptc +#define GL_EXT_texture_compression_bptc 1 + +#define GL_COMPRESSED_RGBA_BPTC_UNORM_EXT 0x8E8C +#define GL_COMPRESSED_SRGB_ALPHA_BPTC_UNORM_EXT 0x8E8D +#define GL_COMPRESSED_RGB_BPTC_SIGNED_FLOAT_EXT 0x8E8E +#define GL_COMPRESSED_RGB_BPTC_UNSIGNED_FLOAT_EXT 0x8E8F + +#define GLEW_EXT_texture_compression_bptc GLEW_GET_VAR(__GLEW_EXT_texture_compression_bptc) + +#endif /* GL_EXT_texture_compression_bptc */ + /* -------------------- GL_EXT_texture_compression_dxt1 -------------------- */ #ifndef GL_EXT_texture_compression_dxt1 @@ -10830,6 +12221,25 @@ typedef void (GLAPIENTRY * PFNGLTEXBUFFEREXTPROC) (GLenum target, GLenum interna #endif /* GL_EXT_texture_cube_map */ +/* --------------------- GL_EXT_texture_cube_map_array --------------------- */ + +#ifndef GL_EXT_texture_cube_map_array +#define GL_EXT_texture_cube_map_array 1 + +#define GL_TEXTURE_CUBE_MAP_ARRAY_EXT 0x9009 +#define GL_TEXTURE_BINDING_CUBE_MAP_ARRAY_EXT 0x900A +#define GL_SAMPLER_CUBE_MAP_ARRAY_EXT 0x900C +#define GL_SAMPLER_CUBE_MAP_ARRAY_SHADOW_EXT 0x900D +#define GL_INT_SAMPLER_CUBE_MAP_ARRAY_EXT 0x900E +#define GL_UNSIGNED_INT_SAMPLER_CUBE_MAP_ARRAY_EXT 0x900F +#define GL_IMAGE_CUBE_MAP_ARRAY_EXT 0x9054 +#define GL_INT_IMAGE_CUBE_MAP_ARRAY_EXT 0x905F +#define GL_UNSIGNED_INT_IMAGE_CUBE_MAP_ARRAY_EXT 0x906A + +#define GLEW_EXT_texture_cube_map_array GLEW_GET_VAR(__GLEW_EXT_texture_cube_map_array) + +#endif /* GL_EXT_texture_cube_map_array */ + /* ----------------------- GL_EXT_texture_edge_clamp ----------------------- */ #ifndef GL_EXT_texture_edge_clamp @@ -10926,6 +12336,17 @@ typedef void (GLAPIENTRY * PFNGLTEXBUFFEREXTPROC) (GLenum target, GLenum interna #endif /* GL_EXT_texture_filter_minmax */ +/* --------------------- GL_EXT_texture_format_BGRA8888 -------------------- */ + +#ifndef GL_EXT_texture_format_BGRA8888 +#define GL_EXT_texture_format_BGRA8888 1 + +#define GL_BGRA_EXT 0x80E1 + +#define GLEW_EXT_texture_format_BGRA8888 GLEW_GET_VAR(__GLEW_EXT_texture_format_BGRA8888) + +#endif /* GL_EXT_texture_format_BGRA8888 */ + /* ------------------------- GL_EXT_texture_integer ------------------------ */ #ifndef GL_EXT_texture_integer @@ -11023,6 +12444,24 @@ typedef void (GLAPIENTRY * PFNGLTEXPARAMETERIUIVEXTPROC) (GLenum target, GLenum #endif /* GL_EXT_texture_mirror_clamp */ +/* ------------------------- GL_EXT_texture_norm16 ------------------------- */ + +#ifndef GL_EXT_texture_norm16 +#define GL_EXT_texture_norm16 1 + +#define GL_RGB16_EXT 0x8054 +#define GL_RGBA16_EXT 0x805B +#define GL_R16_EXT 0x822A +#define GL_RG16_EXT 0x822C +#define GL_R16_SNORM_EXT 0x8F98 +#define GL_RG16_SNORM_EXT 0x8F99 +#define GL_RGB16_SNORM_EXT 0x8F9A +#define GL_RGBA16_SNORM_EXT 0x8F9B + +#define GLEW_EXT_texture_norm16 GLEW_GET_VAR(__GLEW_EXT_texture_norm16) + +#endif /* GL_EXT_texture_norm16 */ + /* ------------------------- GL_EXT_texture_object ------------------------- */ #ifndef GL_EXT_texture_object @@ -11082,6 +12521,20 @@ typedef void (GLAPIENTRY * PFNGLTEXTURENORMALEXTPROC) (GLenum mode); #endif /* GL_EXT_texture_rectangle */ +/* --------------------------- GL_EXT_texture_rg --------------------------- */ + +#ifndef GL_EXT_texture_rg +#define GL_EXT_texture_rg 1 + +#define GL_RED_EXT 0x1903 +#define GL_RG_EXT 0x8227 +#define GL_R8_EXT 0x8229 +#define GL_RG8_EXT 0x822B + +#define GLEW_EXT_texture_rg GLEW_GET_VAR(__GLEW_EXT_texture_rg) + +#endif /* GL_EXT_texture_rg */ + /* -------------------------- GL_EXT_texture_sRGB -------------------------- */ #ifndef GL_EXT_texture_sRGB @@ -11108,6 +12561,28 @@ typedef void (GLAPIENTRY * PFNGLTEXTURENORMALEXTPROC) (GLenum mode); #endif /* GL_EXT_texture_sRGB */ +/* ------------------------- GL_EXT_texture_sRGB_R8 ------------------------ */ + +#ifndef GL_EXT_texture_sRGB_R8 +#define GL_EXT_texture_sRGB_R8 1 + +#define GL_SR8_EXT 0x8FBD + +#define GLEW_EXT_texture_sRGB_R8 GLEW_GET_VAR(__GLEW_EXT_texture_sRGB_R8) + +#endif /* GL_EXT_texture_sRGB_R8 */ + +/* ------------------------ GL_EXT_texture_sRGB_RG8 ------------------------ */ + +#ifndef GL_EXT_texture_sRGB_RG8 +#define GL_EXT_texture_sRGB_RG8 1 + +#define GL_SRG8_EXT 0x8FBE + +#define GLEW_EXT_texture_sRGB_RG8 GLEW_GET_VAR(__GLEW_EXT_texture_sRGB_RG8) + +#endif /* GL_EXT_texture_sRGB_RG8 */ + /* ----------------------- GL_EXT_texture_sRGB_decode ---------------------- */ #ifndef GL_EXT_texture_sRGB_decode @@ -11165,9 +12640,57 @@ typedef void (GLAPIENTRY * PFNGLTEXTURENORMALEXTPROC) (GLenum mode); #define GL_LUMINANCE16_ALPHA16_SNORM 0x901A #define GL_INTENSITY16_SNORM 0x901B -#define GLEW_EXT_texture_snorm GLEW_GET_VAR(__GLEW_EXT_texture_snorm) +#define GLEW_EXT_texture_snorm GLEW_GET_VAR(__GLEW_EXT_texture_snorm) + +#endif /* GL_EXT_texture_snorm */ + +/* ------------------------- GL_EXT_texture_storage ------------------------ */ + +#ifndef GL_EXT_texture_storage +#define GL_EXT_texture_storage 1 + +#define GL_ALPHA8_EXT 0x803C +#define GL_LUMINANCE8_EXT 0x8040 +#define GL_LUMINANCE8_ALPHA8_EXT 0x8045 +#define GL_RGB10_EXT 0x8052 +#define GL_RGB10_A2_EXT 0x8059 +#define GL_R8_EXT 0x8229 +#define GL_RG8_EXT 0x822B +#define GL_R16F_EXT 0x822D +#define GL_R32F_EXT 0x822E +#define GL_RG16F_EXT 0x822F +#define GL_RG32F_EXT 0x8230 +#define GL_RGBA32F_EXT 0x8814 +#define GL_RGB32F_EXT 0x8815 +#define GL_ALPHA32F_EXT 0x8816 +#define GL_LUMINANCE32F_EXT 0x8818 +#define GL_LUMINANCE_ALPHA32F_EXT 0x8819 +#define GL_RGBA16F_EXT 0x881A +#define GL_RGB16F_EXT 0x881B +#define GL_ALPHA16F_EXT 0x881C +#define GL_LUMINANCE16F_EXT 0x881E +#define GL_LUMINANCE_ALPHA16F_EXT 0x881F +#define GL_RGB_RAW_422_APPLE 0x8A51 +#define GL_TEXTURE_IMMUTABLE_FORMAT_EXT 0x912F +#define GL_BGRA8_EXT 0x93A1 -#endif /* GL_EXT_texture_snorm */ +typedef void (GLAPIENTRY * PFNGLTEXSTORAGE1DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +typedef void (GLAPIENTRY * PFNGLTEXSTORAGE2DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (GLAPIENTRY * PFNGLTEXSTORAGE3DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE1DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE2DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (GLAPIENTRY * PFNGLTEXTURESTORAGE3DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); + +#define glTexStorage1DEXT GLEW_GET_FUN(__glewTexStorage1DEXT) +#define glTexStorage2DEXT GLEW_GET_FUN(__glewTexStorage2DEXT) +#define glTexStorage3DEXT GLEW_GET_FUN(__glewTexStorage3DEXT) +#define glTextureStorage1DEXT GLEW_GET_FUN(__glewTextureStorage1DEXT) +#define glTextureStorage2DEXT GLEW_GET_FUN(__glewTextureStorage2DEXT) +#define glTextureStorage3DEXT GLEW_GET_FUN(__glewTextureStorage3DEXT) + +#define GLEW_EXT_texture_storage GLEW_GET_VAR(__GLEW_EXT_texture_storage) + +#endif /* GL_EXT_texture_storage */ /* ------------------------- GL_EXT_texture_swizzle ------------------------ */ @@ -11184,6 +12707,36 @@ typedef void (GLAPIENTRY * PFNGLTEXTURENORMALEXTPROC) (GLenum mode); #endif /* GL_EXT_texture_swizzle */ +/* ------------------- GL_EXT_texture_type_2_10_10_10_REV ------------------ */ + +#ifndef GL_EXT_texture_type_2_10_10_10_REV +#define GL_EXT_texture_type_2_10_10_10_REV 1 + +#define GL_UNSIGNED_INT_2_10_10_10_REV_EXT 0x8368 + +#define GLEW_EXT_texture_type_2_10_10_10_REV GLEW_GET_VAR(__GLEW_EXT_texture_type_2_10_10_10_REV) + +#endif /* GL_EXT_texture_type_2_10_10_10_REV */ + +/* -------------------------- GL_EXT_texture_view -------------------------- */ + +#ifndef GL_EXT_texture_view +#define GL_EXT_texture_view 1 + +#define GL_TEXTURE_VIEW_MIN_LEVEL_EXT 0x82DB +#define GL_TEXTURE_VIEW_NUM_LEVELS_EXT 0x82DC +#define GL_TEXTURE_VIEW_MIN_LAYER_EXT 0x82DD +#define GL_TEXTURE_VIEW_NUM_LAYERS_EXT 0x82DE +#define GL_TEXTURE_IMMUTABLE_LEVELS 0x82DF + +typedef void (GLAPIENTRY * PFNGLTEXTUREVIEWEXTPROC) (GLuint texture, GLenum target, GLuint origtexture, GLenum internalformat, GLuint minlevel, GLuint numlevels, GLuint minlayer, GLuint numlayers); + +#define glTextureViewEXT GLEW_GET_FUN(__glewTextureViewEXT) + +#define GLEW_EXT_texture_view GLEW_GET_VAR(__GLEW_EXT_texture_view) + +#endif /* GL_EXT_texture_view */ + /* --------------------------- GL_EXT_timer_query -------------------------- */ #ifndef GL_EXT_timer_query @@ -11242,6 +12795,19 @@ typedef void (GLAPIENTRY * PFNGLTRANSFORMFEEDBACKVARYINGSEXTPROC) (GLuint progra #endif /* GL_EXT_transform_feedback */ +/* ------------------------- GL_EXT_unpack_subimage ------------------------ */ + +#ifndef GL_EXT_unpack_subimage +#define GL_EXT_unpack_subimage 1 + +#define GL_UNPACK_ROW_LENGTH_EXT 0x0CF2 +#define GL_UNPACK_SKIP_ROWS_EXT 0x0CF3 +#define GL_UNPACK_SKIP_PIXELS_EXT 0x0CF4 + +#define GLEW_EXT_unpack_subimage GLEW_GET_VAR(__GLEW_EXT_unpack_subimage) + +#endif /* GL_EXT_unpack_subimage */ + /* -------------------------- GL_EXT_vertex_array -------------------------- */ #ifndef GL_EXT_vertex_array @@ -11314,6 +12880,23 @@ typedef void (GLAPIENTRY * PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, #endif /* GL_EXT_vertex_array_bgra */ +/* ----------------------- GL_EXT_vertex_array_setXXX ---------------------- */ + +#ifndef GL_EXT_vertex_array_setXXX +#define GL_EXT_vertex_array_setXXX 1 + +typedef void (GLAPIENTRY * PFNGLBINDARRAYSETEXTPROC) (const void *arrayset); +typedef const void * (GLAPIENTRY * PFNGLCREATEARRAYSETEXTPROC) (void); +typedef void (GLAPIENTRY * PFNGLDELETEARRAYSETSEXTPROC) (GLsizei n, const void *arrayset[]); + +#define glBindArraySetEXT GLEW_GET_FUN(__glewBindArraySetEXT) +#define glCreateArraySetExt GLEW_GET_FUN(__glewCreateArraySetExt) +#define glDeleteArraySetsEXT GLEW_GET_FUN(__glewDeleteArraySetsEXT) + +#define GLEW_EXT_vertex_array_setXXX GLEW_GET_VAR(__GLEW_EXT_vertex_array_setXXX) + +#endif /* GL_EXT_vertex_array_setXXX */ + /* ----------------------- GL_EXT_vertex_attrib_64bit ---------------------- */ #ifndef GL_EXT_vertex_attrib_64bit @@ -11597,6 +13180,41 @@ typedef void (GLAPIENTRY * PFNGLVERTEXWEIGHTFVEXTPROC) (GLfloat* weight); #endif /* GL_EXT_vertex_weighting */ +/* ------------------------ GL_EXT_win32_keyed_mutex ----------------------- */ + +#ifndef GL_EXT_win32_keyed_mutex +#define GL_EXT_win32_keyed_mutex 1 + +typedef GLboolean (GLAPIENTRY * PFNGLACQUIREKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key, GLuint timeout); +typedef GLboolean (GLAPIENTRY * PFNGLRELEASEKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key); + +#define glAcquireKeyedMutexWin32EXT GLEW_GET_FUN(__glewAcquireKeyedMutexWin32EXT) +#define glReleaseKeyedMutexWin32EXT GLEW_GET_FUN(__glewReleaseKeyedMutexWin32EXT) + +#define GLEW_EXT_win32_keyed_mutex GLEW_GET_VAR(__GLEW_EXT_win32_keyed_mutex) + +#endif /* GL_EXT_win32_keyed_mutex */ + +/* ------------------------ GL_EXT_window_rectangles ----------------------- */ + +#ifndef GL_EXT_window_rectangles +#define GL_EXT_window_rectangles 1 + +#define GL_INCLUSIVE_EXT 0x8F10 +#define GL_EXCLUSIVE_EXT 0x8F11 +#define GL_WINDOW_RECTANGLE_EXT 0x8F12 +#define GL_WINDOW_RECTANGLE_MODE_EXT 0x8F13 +#define GL_MAX_WINDOW_RECTANGLES_EXT 0x8F14 +#define GL_NUM_WINDOW_RECTANGLES_EXT 0x8F15 + +typedef void (GLAPIENTRY * PFNGLWINDOWRECTANGLESEXTPROC) (GLenum mode, GLsizei count, const GLint box[]); + +#define glWindowRectanglesEXT GLEW_GET_FUN(__glewWindowRectanglesEXT) + +#define GLEW_EXT_window_rectangles GLEW_GET_VAR(__GLEW_EXT_window_rectangles) + +#endif /* GL_EXT_window_rectangles */ + /* ------------------------- GL_EXT_x11_sync_object ------------------------ */ #ifndef GL_EXT_x11_sync_object @@ -11821,6 +13439,17 @@ typedef void (GLAPIENTRY * PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum ty #endif /* GL_INGR_interlace_read */ +/* ------------------ GL_INTEL_conservative_rasterization ------------------ */ + +#ifndef GL_INTEL_conservative_rasterization +#define GL_INTEL_conservative_rasterization 1 + +#define GL_CONSERVATIVE_RASTERIZATION_INTEL 0x83FE + +#define GLEW_INTEL_conservative_rasterization GLEW_GET_VAR(__GLEW_INTEL_conservative_rasterization) + +#endif /* GL_INTEL_conservative_rasterization */ + /* ------------------- GL_INTEL_fragment_shader_ordering ------------------- */ #ifndef GL_INTEL_fragment_shader_ordering @@ -11997,9 +13626,6 @@ typedef void (GLAPIENTRY * PFNGLBLENDBARRIERKHRPROC) (void); #ifndef GL_KHR_context_flush_control #define GL_KHR_context_flush_control 1 -#define GL_CONTEXT_RELEASE_BEHAVIOR 0x82FB -#define GL_CONTEXT_RELEASE_BEHAVIOR_FLUSH 0x82FC - #define GLEW_KHR_context_flush_control GLEW_GET_VAR(__GLEW_KHR_context_flush_control) #endif /* GL_KHR_context_flush_control */ @@ -12057,9 +13683,9 @@ typedef void (GLAPIENTRY * PFNGLDEBUGMESSAGECONTROLPROC) (GLenum source, GLenum typedef void (GLAPIENTRY * PFNGLDEBUGMESSAGEINSERTPROC) (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar* buf); typedef GLuint (GLAPIENTRY * PFNGLGETDEBUGMESSAGELOGPROC) (GLuint count, GLsizei bufSize, GLenum* sources, GLenum* types, GLuint* ids, GLenum* severities, GLsizei* lengths, GLchar* messageLog); typedef void (GLAPIENTRY * PFNGLGETOBJECTLABELPROC) (GLenum identifier, GLuint name, GLsizei bufSize, GLsizei* length, GLchar *label); -typedef void (GLAPIENTRY * PFNGLGETOBJECTPTRLABELPROC) (const void *ptr, GLsizei bufSize, GLsizei* length, GLchar *label); +typedef void (GLAPIENTRY * PFNGLGETOBJECTPTRLABELPROC) (void* ptr, GLsizei bufSize, GLsizei* length, GLchar *label); typedef void (GLAPIENTRY * PFNGLOBJECTLABELPROC) (GLenum identifier, GLuint name, GLsizei length, const GLchar* label); -typedef void (GLAPIENTRY * PFNGLOBJECTPTRLABELPROC) (const void *ptr, GLsizei length, const GLchar* label); +typedef void (GLAPIENTRY * PFNGLOBJECTPTRLABELPROC) (void* ptr, GLsizei length, const GLchar* label); typedef void (GLAPIENTRY * PFNGLPOPDEBUGGROUPPROC) (void); typedef void (GLAPIENTRY * PFNGLPUSHDEBUGGROUPPROC) (GLenum source, GLuint id, GLsizei length, const GLchar * message); @@ -12089,6 +13715,22 @@ typedef void (GLAPIENTRY * PFNGLPUSHDEBUGGROUPPROC) (GLenum source, GLuint id, G #endif /* GL_KHR_no_error */ +/* --------------------- GL_KHR_parallel_shader_compile -------------------- */ + +#ifndef GL_KHR_parallel_shader_compile +#define GL_KHR_parallel_shader_compile 1 + +#define GL_MAX_SHADER_COMPILER_THREADS_KHR 0x91B0 +#define GL_COMPLETION_STATUS_KHR 0x91B1 + +typedef void (GLAPIENTRY * PFNGLMAXSHADERCOMPILERTHREADSKHRPROC) (GLuint count); + +#define glMaxShaderCompilerThreadsKHR GLEW_GET_FUN(__glewMaxShaderCompilerThreadsKHR) + +#define GLEW_KHR_parallel_shader_compile GLEW_GET_VAR(__GLEW_KHR_parallel_shader_compile) + +#endif /* GL_KHR_parallel_shader_compile */ + /* ------------------ GL_KHR_robust_buffer_access_behavior ----------------- */ #ifndef GL_KHR_robust_buffer_access_behavior @@ -12202,6 +13844,15 @@ typedef void (GLAPIENTRY * PFNGLREADNPIXELSPROC) (GLint x, GLint y, GLsizei widt #endif /* GL_KHR_texture_compression_astc_ldr */ +/* --------------- GL_KHR_texture_compression_astc_sliced_3d --------------- */ + +#ifndef GL_KHR_texture_compression_astc_sliced_3d +#define GL_KHR_texture_compression_astc_sliced_3d 1 + +#define GLEW_KHR_texture_compression_astc_sliced_3d GLEW_GET_VAR(__GLEW_KHR_texture_compression_astc_sliced_3d) + +#endif /* GL_KHR_texture_compression_astc_sliced_3d */ + /* -------------------------- GL_KTX_buffer_region ------------------------- */ #ifndef GL_KTX_buffer_region @@ -12268,6 +13919,15 @@ typedef void (GLAPIENTRY * PFNGLRESIZEBUFFERSMESAPROC) (void); #endif /* GL_MESA_resize_buffers */ +/* -------------------- GL_MESA_shader_integer_functions ------------------- */ + +#ifndef GL_MESA_shader_integer_functions +#define GL_MESA_shader_integer_functions 1 + +#define GLEW_MESA_shader_integer_functions GLEW_GET_VAR(__GLEW_MESA_shader_integer_functions) + +#endif /* GL_MESA_shader_integer_functions */ + /* --------------------------- GL_MESA_window_pos -------------------------- */ #ifndef GL_MESA_window_pos @@ -12340,6 +14000,15 @@ typedef void (GLAPIENTRY * PFNGLWINDOWPOS4SVMESAPROC) (const GLshort* p); #endif /* GL_MESA_ycbcr_texture */ +/* ----------- GL_NVX_blend_equation_advanced_multi_draw_buffers ----------- */ + +#ifndef GL_NVX_blend_equation_advanced_multi_draw_buffers +#define GL_NVX_blend_equation_advanced_multi_draw_buffers 1 + +#define GLEW_NVX_blend_equation_advanced_multi_draw_buffers GLEW_GET_VAR(__GLEW_NVX_blend_equation_advanced_multi_draw_buffers) + +#endif /* GL_NVX_blend_equation_advanced_multi_draw_buffers */ + /* ----------------------- GL_NVX_conditional_render ----------------------- */ #ifndef GL_NVX_conditional_render @@ -12370,6 +14039,88 @@ typedef void (GLAPIENTRY * PFNGLENDCONDITIONALRENDERNVXPROC) (void); #endif /* GL_NVX_gpu_memory_info */ +/* ---------------------- GL_NVX_linked_gpu_multicast ---------------------- */ + +#ifndef GL_NVX_linked_gpu_multicast +#define GL_NVX_linked_gpu_multicast 1 + +#define GL_LGPU_SEPARATE_STORAGE_BIT_NVX 0x0800 +#define GL_MAX_LGPU_GPUS_NVX 0x92BA + +typedef void (GLAPIENTRY * PFNGLLGPUCOPYIMAGESUBDATANVXPROC) (GLuint sourceGpu, GLbitfield destinationGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srxY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); +typedef void (GLAPIENTRY * PFNGLLGPUINTERLOCKNVXPROC) (void); +typedef void (GLAPIENTRY * PFNGLLGPUNAMEDBUFFERSUBDATANVXPROC) (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); + +#define glLGPUCopyImageSubDataNVX GLEW_GET_FUN(__glewLGPUCopyImageSubDataNVX) +#define glLGPUInterlockNVX GLEW_GET_FUN(__glewLGPUInterlockNVX) +#define glLGPUNamedBufferSubDataNVX GLEW_GET_FUN(__glewLGPUNamedBufferSubDataNVX) + +#define GLEW_NVX_linked_gpu_multicast GLEW_GET_VAR(__GLEW_NVX_linked_gpu_multicast) + +#endif /* GL_NVX_linked_gpu_multicast */ + +/* ------------------------ GL_NV_3dvision_settings ------------------------ */ + +#ifndef GL_NV_3dvision_settings +#define GL_NV_3dvision_settings 1 + +#define GL_3DVISION_STEREO_NV 0x90F4 +#define GL_STEREO_SEPARATION_NV 0x90F5 +#define GL_STEREO_CONVERGENCE_NV 0x90F6 +#define GL_STEREO_CUTOFF_NV 0x90F7 +#define GL_STEREO_PROJECTION_NV 0x90F8 +#define GL_STEREO_PROJECTION_PERSPECTIVE_NV 0x90F9 +#define GL_STEREO_PROJECTION_ORTHO_NV 0x90FA + +typedef void (GLAPIENTRY * PFNGLSTEREOPARAMETERFNVPROC) (GLenum pname, GLfloat param); +typedef void (GLAPIENTRY * PFNGLSTEREOPARAMETERINVPROC) (GLenum pname, GLint param); + +#define glStereoParameterfNV GLEW_GET_FUN(__glewStereoParameterfNV) +#define glStereoParameteriNV GLEW_GET_FUN(__glewStereoParameteriNV) + +#define GLEW_NV_3dvision_settings GLEW_GET_VAR(__GLEW_NV_3dvision_settings) + +#endif /* GL_NV_3dvision_settings */ + +/* ------------------- GL_NV_EGL_stream_consumer_external ------------------ */ + +#ifndef GL_NV_EGL_stream_consumer_external +#define GL_NV_EGL_stream_consumer_external 1 + +#define GL_TEXTURE_EXTERNAL_OES 0x8D65 +#define GL_SAMPLER_EXTERNAL_OES 0x8D66 +#define GL_TEXTURE_BINDING_EXTERNAL_OES 0x8D67 +#define GL_REQUIRED_TEXTURE_IMAGE_UNITS_OES 0x8D68 + +#define GLEW_NV_EGL_stream_consumer_external GLEW_GET_VAR(__GLEW_NV_EGL_stream_consumer_external) + +#endif /* GL_NV_EGL_stream_consumer_external */ + +/* ----------------- GL_NV_alpha_to_coverage_dither_control ---------------- */ + +#ifndef GL_NV_alpha_to_coverage_dither_control +#define GL_NV_alpha_to_coverage_dither_control 1 + +#define GL_ALPHA_TO_COVERAGE_DITHER_MODE_NV 0x92BF +#define GL_ALPHA_TO_COVERAGE_DITHER_DEFAULT_NV 0x934D +#define GL_ALPHA_TO_COVERAGE_DITHER_ENABLE_NV 0x934E +#define GL_ALPHA_TO_COVERAGE_DITHER_DISABLE_NV 0x934F + +#define GLEW_NV_alpha_to_coverage_dither_control GLEW_GET_VAR(__GLEW_NV_alpha_to_coverage_dither_control) + +#endif /* GL_NV_alpha_to_coverage_dither_control */ + +/* ------------------------------- GL_NV_bgr ------------------------------- */ + +#ifndef GL_NV_bgr +#define GL_NV_bgr 1 + +#define GL_BGR_NV 0x80E0 + +#define GLEW_NV_bgr GLEW_GET_VAR(__GLEW_NV_bgr) + +#endif /* GL_NV_bgr */ + /* ------------------- GL_NV_bindless_multi_draw_indirect ------------------ */ #ifndef GL_NV_bindless_multi_draw_indirect @@ -12512,6 +14263,18 @@ typedef void (GLAPIENTRY * PFNGLBLENDPARAMETERINVPROC) (GLenum pname, GLint valu #endif /* GL_NV_blend_equation_advanced_coherent */ +/* ----------------------- GL_NV_blend_minmax_factor ----------------------- */ + +#ifndef GL_NV_blend_minmax_factor +#define GL_NV_blend_minmax_factor 1 + +#define GL_FACTOR_MIN_AMD 0x901C +#define GL_FACTOR_MAX_AMD 0x901D + +#define GLEW_NV_blend_minmax_factor GLEW_GET_VAR(__GLEW_NV_blend_minmax_factor) + +#endif /* GL_NV_blend_minmax_factor */ + /* --------------------------- GL_NV_blend_square -------------------------- */ #ifndef GL_NV_blend_square @@ -12521,6 +14284,88 @@ typedef void (GLAPIENTRY * PFNGLBLENDPARAMETERINVPROC) (GLenum pname, GLint valu #endif /* GL_NV_blend_square */ +/* ----------------------- GL_NV_clip_space_w_scaling ---------------------- */ + +#ifndef GL_NV_clip_space_w_scaling +#define GL_NV_clip_space_w_scaling 1 + +#define GL_VIEWPORT_POSITION_W_SCALE_NV 0x937C +#define GL_VIEWPORT_POSITION_W_SCALE_X_COEFF_NV 0x937D +#define GL_VIEWPORT_POSITION_W_SCALE_Y_COEFF_NV 0x937E + +typedef void (GLAPIENTRY * PFNGLVIEWPORTPOSITIONWSCALENVPROC) (GLuint index, GLfloat xcoeff, GLfloat ycoeff); + +#define glViewportPositionWScaleNV GLEW_GET_FUN(__glewViewportPositionWScaleNV) + +#define GLEW_NV_clip_space_w_scaling GLEW_GET_VAR(__GLEW_NV_clip_space_w_scaling) + +#endif /* GL_NV_clip_space_w_scaling */ + +/* --------------------------- GL_NV_command_list -------------------------- */ + +#ifndef GL_NV_command_list +#define GL_NV_command_list 1 + +#define GL_TERMINATE_SEQUENCE_COMMAND_NV 0x0000 +#define GL_NOP_COMMAND_NV 0x0001 +#define GL_DRAW_ELEMENTS_COMMAND_NV 0x0002 +#define GL_DRAW_ARRAYS_COMMAND_NV 0x0003 +#define GL_DRAW_ELEMENTS_STRIP_COMMAND_NV 0x0004 +#define GL_DRAW_ARRAYS_STRIP_COMMAND_NV 0x0005 +#define GL_DRAW_ELEMENTS_INSTANCED_COMMAND_NV 0x0006 +#define GL_DRAW_ARRAYS_INSTANCED_COMMAND_NV 0x0007 +#define GL_ELEMENT_ADDRESS_COMMAND_NV 0x0008 +#define GL_ATTRIBUTE_ADDRESS_COMMAND_NV 0x0009 +#define GL_UNIFORM_ADDRESS_COMMAND_NV 0x000a +#define GL_BLEND_COLOR_COMMAND_NV 0x000b +#define GL_STENCIL_REF_COMMAND_NV 0x000c +#define GL_LINE_WIDTH_COMMAND_NV 0x000d +#define GL_POLYGON_OFFSET_COMMAND_NV 0x000e +#define GL_ALPHA_REF_COMMAND_NV 0x000f +#define GL_VIEWPORT_COMMAND_NV 0x0010 +#define GL_SCISSOR_COMMAND_NV 0x0011 +#define GL_FRONT_FACE_COMMAND_NV 0x0012 + +typedef void (GLAPIENTRY * PFNGLCALLCOMMANDLISTNVPROC) (GLuint list); +typedef void (GLAPIENTRY * PFNGLCOMMANDLISTSEGMENTSNVPROC) (GLuint list, GLuint segments); +typedef void (GLAPIENTRY * PFNGLCOMPILECOMMANDLISTNVPROC) (GLuint list); +typedef void (GLAPIENTRY * PFNGLCREATECOMMANDLISTSNVPROC) (GLsizei n, GLuint* lists); +typedef void (GLAPIENTRY * PFNGLCREATESTATESNVPROC) (GLsizei n, GLuint* states); +typedef void (GLAPIENTRY * PFNGLDELETECOMMANDLISTSNVPROC) (GLsizei n, const GLuint* lists); +typedef void (GLAPIENTRY * PFNGLDELETESTATESNVPROC) (GLsizei n, const GLuint* states); +typedef void (GLAPIENTRY * PFNGLDRAWCOMMANDSADDRESSNVPROC) (GLenum primitiveMode, const GLuint64* indirects, const GLsizei* sizes, GLuint count); +typedef void (GLAPIENTRY * PFNGLDRAWCOMMANDSNVPROC) (GLenum primitiveMode, GLuint buffer, const GLintptr* indirects, const GLsizei* sizes, GLuint count); +typedef void (GLAPIENTRY * PFNGLDRAWCOMMANDSSTATESADDRESSNVPROC) (const GLuint64* indirects, const GLsizei* sizes, const GLuint* states, const GLuint* fbos, GLuint count); +typedef void (GLAPIENTRY * PFNGLDRAWCOMMANDSSTATESNVPROC) (GLuint buffer, const GLintptr* indirects, const GLsizei* sizes, const GLuint* states, const GLuint* fbos, GLuint count); +typedef GLuint (GLAPIENTRY * PFNGLGETCOMMANDHEADERNVPROC) (GLenum tokenID, GLuint size); +typedef GLushort (GLAPIENTRY * PFNGLGETSTAGEINDEXNVPROC) (GLenum shadertype); +typedef GLboolean (GLAPIENTRY * PFNGLISCOMMANDLISTNVPROC) (GLuint list); +typedef GLboolean (GLAPIENTRY * PFNGLISSTATENVPROC) (GLuint state); +typedef void (GLAPIENTRY * PFNGLLISTDRAWCOMMANDSSTATESCLIENTNVPROC) (GLuint list, GLuint segment, const void** indirects, const GLsizei* sizes, const GLuint* states, const GLuint* fbos, GLuint count); +typedef void (GLAPIENTRY * PFNGLSTATECAPTURENVPROC) (GLuint state, GLenum mode); + +#define glCallCommandListNV GLEW_GET_FUN(__glewCallCommandListNV) +#define glCommandListSegmentsNV GLEW_GET_FUN(__glewCommandListSegmentsNV) +#define glCompileCommandListNV GLEW_GET_FUN(__glewCompileCommandListNV) +#define glCreateCommandListsNV GLEW_GET_FUN(__glewCreateCommandListsNV) +#define glCreateStatesNV GLEW_GET_FUN(__glewCreateStatesNV) +#define glDeleteCommandListsNV GLEW_GET_FUN(__glewDeleteCommandListsNV) +#define glDeleteStatesNV GLEW_GET_FUN(__glewDeleteStatesNV) +#define glDrawCommandsAddressNV GLEW_GET_FUN(__glewDrawCommandsAddressNV) +#define glDrawCommandsNV GLEW_GET_FUN(__glewDrawCommandsNV) +#define glDrawCommandsStatesAddressNV GLEW_GET_FUN(__glewDrawCommandsStatesAddressNV) +#define glDrawCommandsStatesNV GLEW_GET_FUN(__glewDrawCommandsStatesNV) +#define glGetCommandHeaderNV GLEW_GET_FUN(__glewGetCommandHeaderNV) +#define glGetStageIndexNV GLEW_GET_FUN(__glewGetStageIndexNV) +#define glIsCommandListNV GLEW_GET_FUN(__glewIsCommandListNV) +#define glIsStateNV GLEW_GET_FUN(__glewIsStateNV) +#define glListDrawCommandsStatesClientNV GLEW_GET_FUN(__glewListDrawCommandsStatesClientNV) +#define glStateCaptureNV GLEW_GET_FUN(__glewStateCaptureNV) + +#define GLEW_NV_command_list GLEW_GET_VAR(__GLEW_NV_command_list) + +#endif /* GL_NV_command_list */ + /* ------------------------- GL_NV_compute_program5 ------------------------ */ #ifndef GL_NV_compute_program5 @@ -12588,6 +14433,39 @@ typedef void (GLAPIENTRY * PFNGLCONSERVATIVERASTERPARAMETERFNVPROC) (GLenum pnam #endif /* GL_NV_conservative_raster_dilate */ +/* -------------- GL_NV_conservative_raster_pre_snap_triangles ------------- */ + +#ifndef GL_NV_conservative_raster_pre_snap_triangles +#define GL_NV_conservative_raster_pre_snap_triangles 1 + +#define GL_CONSERVATIVE_RASTER_MODE_NV 0x954D +#define GL_CONSERVATIVE_RASTER_MODE_POST_SNAP_NV 0x954E +#define GL_CONSERVATIVE_RASTER_MODE_PRE_SNAP_TRIANGLES_NV 0x954F + +typedef void (GLAPIENTRY * PFNGLCONSERVATIVERASTERPARAMETERINVPROC) (GLenum pname, GLint param); + +#define glConservativeRasterParameteriNV GLEW_GET_FUN(__glewConservativeRasterParameteriNV) + +#define GLEW_NV_conservative_raster_pre_snap_triangles GLEW_GET_VAR(__GLEW_NV_conservative_raster_pre_snap_triangles) + +#endif /* GL_NV_conservative_raster_pre_snap_triangles */ + +/* --------------------------- GL_NV_copy_buffer --------------------------- */ + +#ifndef GL_NV_copy_buffer +#define GL_NV_copy_buffer 1 + +#define GL_COPY_READ_BUFFER_NV 0x8F36 +#define GL_COPY_WRITE_BUFFER_NV 0x8F37 + +typedef void (GLAPIENTRY * PFNGLCOPYBUFFERSUBDATANVPROC) (GLenum readtarget, GLenum writetarget, GLintptr readoffset, GLintptr writeoffset, GLsizeiptr size); + +#define glCopyBufferSubDataNV GLEW_GET_FUN(__glewCopyBufferSubDataNV) + +#define GLEW_NV_copy_buffer GLEW_GET_VAR(__GLEW_NV_copy_buffer) + +#endif /* GL_NV_copy_buffer */ + /* ----------------------- GL_NV_copy_depth_to_color ----------------------- */ #ifndef GL_NV_copy_depth_to_color @@ -12673,6 +14551,68 @@ typedef void (GLAPIENTRY * PFNGLDEPTHRANGEDNVPROC) (GLdouble zNear, GLdouble zFa #endif /* GL_NV_depth_range_unclamped */ +/* --------------------------- GL_NV_draw_buffers -------------------------- */ + +#ifndef GL_NV_draw_buffers +#define GL_NV_draw_buffers 1 + +#define GL_MAX_DRAW_BUFFERS_NV 0x8824 +#define GL_DRAW_BUFFER0_NV 0x8825 +#define GL_DRAW_BUFFER1_NV 0x8826 +#define GL_DRAW_BUFFER2_NV 0x8827 +#define GL_DRAW_BUFFER3_NV 0x8828 +#define GL_DRAW_BUFFER4_NV 0x8829 +#define GL_DRAW_BUFFER5_NV 0x882A +#define GL_DRAW_BUFFER6_NV 0x882B +#define GL_DRAW_BUFFER7_NV 0x882C +#define GL_DRAW_BUFFER8_NV 0x882D +#define GL_DRAW_BUFFER9_NV 0x882E +#define GL_DRAW_BUFFER10_NV 0x882F +#define GL_DRAW_BUFFER11_NV 0x8830 +#define GL_DRAW_BUFFER12_NV 0x8831 +#define GL_DRAW_BUFFER13_NV 0x8832 +#define GL_DRAW_BUFFER14_NV 0x8833 +#define GL_DRAW_BUFFER15_NV 0x8834 +#define GL_COLOR_ATTACHMENT0_NV 0x8CE0 +#define GL_COLOR_ATTACHMENT1_NV 0x8CE1 +#define GL_COLOR_ATTACHMENT2_NV 0x8CE2 +#define GL_COLOR_ATTACHMENT3_NV 0x8CE3 +#define GL_COLOR_ATTACHMENT4_NV 0x8CE4 +#define GL_COLOR_ATTACHMENT5_NV 0x8CE5 +#define GL_COLOR_ATTACHMENT6_NV 0x8CE6 +#define GL_COLOR_ATTACHMENT7_NV 0x8CE7 +#define GL_COLOR_ATTACHMENT8_NV 0x8CE8 +#define GL_COLOR_ATTACHMENT9_NV 0x8CE9 +#define GL_COLOR_ATTACHMENT10_NV 0x8CEA +#define GL_COLOR_ATTACHMENT11_NV 0x8CEB +#define GL_COLOR_ATTACHMENT12_NV 0x8CEC +#define GL_COLOR_ATTACHMENT13_NV 0x8CED +#define GL_COLOR_ATTACHMENT14_NV 0x8CEE +#define GL_COLOR_ATTACHMENT15_NV 0x8CEF + +typedef void (GLAPIENTRY * PFNGLDRAWBUFFERSNVPROC) (GLsizei n, const GLenum* bufs); + +#define glDrawBuffersNV GLEW_GET_FUN(__glewDrawBuffersNV) + +#define GLEW_NV_draw_buffers GLEW_GET_VAR(__GLEW_NV_draw_buffers) + +#endif /* GL_NV_draw_buffers */ + +/* -------------------------- GL_NV_draw_instanced ------------------------- */ + +#ifndef GL_NV_draw_instanced +#define GL_NV_draw_instanced 1 + +typedef void (GLAPIENTRY * PFNGLDRAWARRAYSINSTANCEDNVPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount); +typedef void (GLAPIENTRY * PFNGLDRAWELEMENTSINSTANCEDNVPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); + +#define glDrawArraysInstancedNV GLEW_GET_FUN(__glewDrawArraysInstancedNV) +#define glDrawElementsInstancedNV GLEW_GET_FUN(__glewDrawElementsInstancedNV) + +#define GLEW_NV_draw_instanced GLEW_GET_VAR(__GLEW_NV_draw_instanced) + +#endif /* GL_NV_draw_instanced */ + /* --------------------------- GL_NV_draw_texture -------------------------- */ #ifndef GL_NV_draw_texture @@ -12686,6 +14626,29 @@ typedef void (GLAPIENTRY * PFNGLDRAWTEXTURENVPROC) (GLuint texture, GLuint sampl #endif /* GL_NV_draw_texture */ +/* ------------------------ GL_NV_draw_vulkan_image ------------------------ */ + +#ifndef GL_NV_draw_vulkan_image +#define GL_NV_draw_vulkan_image 1 + +typedef void (APIENTRY *GLVULKANPROCNV)(void); + +typedef void (GLAPIENTRY * PFNGLDRAWVKIMAGENVPROC) (GLuint64 vkImage, GLuint sampler, GLfloat x0, GLfloat y0, GLfloat x1, GLfloat y1, GLfloat z, GLfloat s0, GLfloat t0, GLfloat s1, GLfloat t1); +typedef GLVULKANPROCNV (GLAPIENTRY * PFNGLGETVKPROCADDRNVPROC) (const GLchar* name); +typedef void (GLAPIENTRY * PFNGLSIGNALVKFENCENVPROC) (GLuint64 vkFence); +typedef void (GLAPIENTRY * PFNGLSIGNALVKSEMAPHORENVPROC) (GLuint64 vkSemaphore); +typedef void (GLAPIENTRY * PFNGLWAITVKSEMAPHORENVPROC) (GLuint64 vkSemaphore); + +#define glDrawVkImageNV GLEW_GET_FUN(__glewDrawVkImageNV) +#define glGetVkProcAddrNV GLEW_GET_FUN(__glewGetVkProcAddrNV) +#define glSignalVkFenceNV GLEW_GET_FUN(__glewSignalVkFenceNV) +#define glSignalVkSemaphoreNV GLEW_GET_FUN(__glewSignalVkSemaphoreNV) +#define glWaitVkSemaphoreNV GLEW_GET_FUN(__glewWaitVkSemaphoreNV) + +#define GLEW_NV_draw_vulkan_image GLEW_GET_VAR(__GLEW_NV_draw_vulkan_image) + +#endif /* GL_NV_draw_vulkan_image */ + /* ---------------------------- GL_NV_evaluators --------------------------- */ #ifndef GL_NV_evaluators @@ -12740,6 +14703,15 @@ typedef void (GLAPIENTRY * PFNGLMAPPARAMETERIVNVPROC) (GLenum target, GLenum pna #endif /* GL_NV_evaluators */ +/* --------------------- GL_NV_explicit_attrib_location -------------------- */ + +#ifndef GL_NV_explicit_attrib_location +#define GL_NV_explicit_attrib_location 1 + +#define GLEW_NV_explicit_attrib_location GLEW_GET_VAR(__GLEW_NV_explicit_attrib_location) + +#endif /* GL_NV_explicit_attrib_location */ + /* ----------------------- GL_NV_explicit_multisample ---------------------- */ #ifndef GL_NV_explicit_multisample @@ -12768,6 +14740,33 @@ typedef void (GLAPIENTRY * PFNGLTEXRENDERBUFFERNVPROC) (GLenum target, GLuint re #endif /* GL_NV_explicit_multisample */ +/* ---------------------- GL_NV_fbo_color_attachments ---------------------- */ + +#ifndef GL_NV_fbo_color_attachments +#define GL_NV_fbo_color_attachments 1 + +#define GL_MAX_COLOR_ATTACHMENTS_NV 0x8CDF +#define GL_COLOR_ATTACHMENT0_NV 0x8CE0 +#define GL_COLOR_ATTACHMENT1_NV 0x8CE1 +#define GL_COLOR_ATTACHMENT2_NV 0x8CE2 +#define GL_COLOR_ATTACHMENT3_NV 0x8CE3 +#define GL_COLOR_ATTACHMENT4_NV 0x8CE4 +#define GL_COLOR_ATTACHMENT5_NV 0x8CE5 +#define GL_COLOR_ATTACHMENT6_NV 0x8CE6 +#define GL_COLOR_ATTACHMENT7_NV 0x8CE7 +#define GL_COLOR_ATTACHMENT8_NV 0x8CE8 +#define GL_COLOR_ATTACHMENT9_NV 0x8CE9 +#define GL_COLOR_ATTACHMENT10_NV 0x8CEA +#define GL_COLOR_ATTACHMENT11_NV 0x8CEB +#define GL_COLOR_ATTACHMENT12_NV 0x8CEC +#define GL_COLOR_ATTACHMENT13_NV 0x8CED +#define GL_COLOR_ATTACHMENT14_NV 0x8CEE +#define GL_COLOR_ATTACHMENT15_NV 0x8CEF + +#define GLEW_NV_fbo_color_attachments GLEW_GET_VAR(__GLEW_NV_fbo_color_attachments) + +#endif /* GL_NV_fbo_color_attachments */ + /* ------------------------------ GL_NV_fence ------------------------------ */ #ifndef GL_NV_fence @@ -12934,6 +14933,24 @@ typedef void (GLAPIENTRY * PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC) (GLuint id, GLsi #endif /* GL_NV_fragment_shader_interlock */ +/* ------------------------- GL_NV_framebuffer_blit ------------------------ */ + +#ifndef GL_NV_framebuffer_blit +#define GL_NV_framebuffer_blit 1 + +#define GL_DRAW_FRAMEBUFFER_BINDING_NV 0x8CA6 +#define GL_READ_FRAMEBUFFER_NV 0x8CA8 +#define GL_DRAW_FRAMEBUFFER_NV 0x8CA9 +#define GL_READ_FRAMEBUFFER_BINDING_NV 0x8CAA + +typedef void (GLAPIENTRY * PFNGLBLITFRAMEBUFFERNVPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); + +#define glBlitFramebufferNV GLEW_GET_FUN(__glewBlitFramebufferNV) + +#define GLEW_NV_framebuffer_blit GLEW_GET_VAR(__GLEW_NV_framebuffer_blit) + +#endif /* GL_NV_framebuffer_blit */ + /* -------------------- GL_NV_framebuffer_mixed_samples -------------------- */ #ifndef GL_NV_framebuffer_mixed_samples @@ -12958,6 +14975,23 @@ typedef void (GLAPIENTRY * PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC) (GLuint id, GLsi #endif /* GL_NV_framebuffer_mixed_samples */ +/* --------------------- GL_NV_framebuffer_multisample --------------------- */ + +#ifndef GL_NV_framebuffer_multisample +#define GL_NV_framebuffer_multisample 1 + +#define GL_RENDERBUFFER_SAMPLES_NV 0x8CAB +#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_NV 0x8D56 +#define GL_MAX_SAMPLES_NV 0x8D57 + +typedef void (GLAPIENTRY * PFNGLRENDERBUFFERSTORAGEMULTISAMPLENVPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); + +#define glRenderbufferStorageMultisampleNV GLEW_GET_FUN(__glewRenderbufferStorageMultisampleNV) + +#define GLEW_NV_framebuffer_multisample GLEW_GET_VAR(__GLEW_NV_framebuffer_multisample) + +#endif /* GL_NV_framebuffer_multisample */ + /* ----------------- GL_NV_framebuffer_multisample_coverage ---------------- */ #ifndef GL_NV_framebuffer_multisample_coverage @@ -12976,6 +15010,15 @@ typedef void (GLAPIENTRY * PFNGLRENDERBUFFERSTORAGEMULTISAMPLECOVERAGENVPROC) (G #endif /* GL_NV_framebuffer_multisample_coverage */ +/* ----------------------- GL_NV_generate_mipmap_sRGB ---------------------- */ + +#ifndef GL_NV_generate_mipmap_sRGB +#define GL_NV_generate_mipmap_sRGB 1 + +#define GLEW_NV_generate_mipmap_sRGB GLEW_GET_VAR(__GLEW_NV_generate_mipmap_sRGB) + +#endif /* GL_NV_generate_mipmap_sRGB */ + /* ------------------------ GL_NV_geometry_program4 ------------------------ */ #ifndef GL_NV_geometry_program4 @@ -13011,6 +15054,47 @@ typedef void (GLAPIENTRY * PFNGLPROGRAMVERTEXLIMITNVPROC) (GLenum target, GLint #endif /* GL_NV_geometry_shader_passthrough */ +/* -------------------------- GL_NV_gpu_multicast -------------------------- */ + +#ifndef GL_NV_gpu_multicast +#define GL_NV_gpu_multicast 1 + +#define GL_PER_GPU_STORAGE_BIT_NV 0x0800 +#define GL_MULTICAST_GPUS_NV 0x92BA +#define GL_PER_GPU_STORAGE_NV 0x9548 +#define GL_MULTICAST_PROGRAMMABLE_SAMPLE_LOCATION_NV 0x9549 +#define GL_RENDER_GPU_MASK_NV 0x9558 + +typedef void (GLAPIENTRY * PFNGLMULTICASTBARRIERNVPROC) (void); +typedef void (GLAPIENTRY * PFNGLMULTICASTBLITFRAMEBUFFERNVPROC) (GLuint srcGpu, GLuint dstGpu, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +typedef void (GLAPIENTRY * PFNGLMULTICASTBUFFERSUBDATANVPROC) (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +typedef void (GLAPIENTRY * PFNGLMULTICASTCOPYBUFFERSUBDATANVPROC) (GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +typedef void (GLAPIENTRY * PFNGLMULTICASTCOPYIMAGESUBDATANVPROC) (GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); +typedef void (GLAPIENTRY * PFNGLMULTICASTFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLuint gpu, GLuint framebuffer, GLuint start, GLsizei count, const GLfloat* v); +typedef void (GLAPIENTRY * PFNGLMULTICASTGETQUERYOBJECTI64VNVPROC) (GLuint gpu, GLuint id, GLenum pname, GLint64* params); +typedef void (GLAPIENTRY * PFNGLMULTICASTGETQUERYOBJECTIVNVPROC) (GLuint gpu, GLuint id, GLenum pname, GLint* params); +typedef void (GLAPIENTRY * PFNGLMULTICASTGETQUERYOBJECTUI64VNVPROC) (GLuint gpu, GLuint id, GLenum pname, GLuint64* params); +typedef void (GLAPIENTRY * PFNGLMULTICASTGETQUERYOBJECTUIVNVPROC) (GLuint gpu, GLuint id, GLenum pname, GLuint* params); +typedef void (GLAPIENTRY * PFNGLMULTICASTWAITSYNCNVPROC) (GLuint signalGpu, GLbitfield waitGpuMask); +typedef void (GLAPIENTRY * PFNGLRENDERGPUMASKNVPROC) (GLbitfield mask); + +#define glMulticastBarrierNV GLEW_GET_FUN(__glewMulticastBarrierNV) +#define glMulticastBlitFramebufferNV GLEW_GET_FUN(__glewMulticastBlitFramebufferNV) +#define glMulticastBufferSubDataNV GLEW_GET_FUN(__glewMulticastBufferSubDataNV) +#define glMulticastCopyBufferSubDataNV GLEW_GET_FUN(__glewMulticastCopyBufferSubDataNV) +#define glMulticastCopyImageSubDataNV GLEW_GET_FUN(__glewMulticastCopyImageSubDataNV) +#define glMulticastFramebufferSampleLocationsfvNV GLEW_GET_FUN(__glewMulticastFramebufferSampleLocationsfvNV) +#define glMulticastGetQueryObjecti64vNV GLEW_GET_FUN(__glewMulticastGetQueryObjecti64vNV) +#define glMulticastGetQueryObjectivNV GLEW_GET_FUN(__glewMulticastGetQueryObjectivNV) +#define glMulticastGetQueryObjectui64vNV GLEW_GET_FUN(__glewMulticastGetQueryObjectui64vNV) +#define glMulticastGetQueryObjectuivNV GLEW_GET_FUN(__glewMulticastGetQueryObjectuivNV) +#define glMulticastWaitSyncNV GLEW_GET_FUN(__glewMulticastWaitSyncNV) +#define glRenderGpuMaskNV GLEW_GET_FUN(__glewRenderGpuMaskNV) + +#define GLEW_NV_gpu_multicast GLEW_GET_VAR(__GLEW_NV_gpu_multicast) + +#endif /* GL_NV_gpu_multicast */ + /* --------------------------- GL_NV_gpu_program4 -------------------------- */ #ifndef GL_NV_gpu_program4 @@ -13304,6 +15388,30 @@ typedef void (GLAPIENTRY * PFNGLVERTEXWEIGHTHVNVPROC) (const GLhalf* weight); #endif /* GL_NV_half_float */ +/* -------------------------- GL_NV_image_formats -------------------------- */ + +#ifndef GL_NV_image_formats +#define GL_NV_image_formats 1 + +#define GLEW_NV_image_formats GLEW_GET_VAR(__GLEW_NV_image_formats) + +#endif /* GL_NV_image_formats */ + +/* ------------------------- GL_NV_instanced_arrays ------------------------ */ + +#ifndef GL_NV_instanced_arrays +#define GL_NV_instanced_arrays 1 + +#define GL_VERTEX_ATTRIB_ARRAY_DIVISOR_NV 0x88FE + +typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBDIVISORNVPROC) (GLuint index, GLuint divisor); + +#define glVertexAttribDivisorNV GLEW_GET_FUN(__glewVertexAttribDivisorNV) + +#define GLEW_NV_instanced_arrays GLEW_GET_VAR(__GLEW_NV_instanced_arrays) + +#endif /* GL_NV_instanced_arrays */ + /* ------------------- GL_NV_internalformat_sample_query ------------------- */ #ifndef GL_NV_internalformat_sample_query @@ -13356,6 +15464,36 @@ typedef void (GLAPIENTRY * PFNGLGETINTERNALFORMATSAMPLEIVNVPROC) (GLenum target, #endif /* GL_NV_multisample_filter_hint */ +/* ----------------------- GL_NV_non_square_matrices ----------------------- */ + +#ifndef GL_NV_non_square_matrices +#define GL_NV_non_square_matrices 1 + +#define GL_FLOAT_MAT2x3_NV 0x8B65 +#define GL_FLOAT_MAT2x4_NV 0x8B66 +#define GL_FLOAT_MAT3x2_NV 0x8B67 +#define GL_FLOAT_MAT3x4_NV 0x8B68 +#define GL_FLOAT_MAT4x2_NV 0x8B69 +#define GL_FLOAT_MAT4x3_NV 0x8B6A + +typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2X3FVNVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value); +typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2X4FVNVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value); +typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3X2FVNVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value); +typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3X4FVNVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value); +typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4X2FVNVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value); +typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4X3FVNVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value); + +#define glUniformMatrix2x3fvNV GLEW_GET_FUN(__glewUniformMatrix2x3fvNV) +#define glUniformMatrix2x4fvNV GLEW_GET_FUN(__glewUniformMatrix2x4fvNV) +#define glUniformMatrix3x2fvNV GLEW_GET_FUN(__glewUniformMatrix3x2fvNV) +#define glUniformMatrix3x4fvNV GLEW_GET_FUN(__glewUniformMatrix3x4fvNV) +#define glUniformMatrix4x2fvNV GLEW_GET_FUN(__glewUniformMatrix4x2fvNV) +#define glUniformMatrix4x3fvNV GLEW_GET_FUN(__glewUniformMatrix4x3fvNV) + +#define GLEW_NV_non_square_matrices GLEW_GET_VAR(__GLEW_NV_non_square_matrices) + +#endif /* GL_NV_non_square_matrices */ + /* ------------------------- GL_NV_occlusion_query ------------------------- */ #ifndef GL_NV_occlusion_query @@ -13386,6 +15524,19 @@ typedef GLboolean (GLAPIENTRY * PFNGLISOCCLUSIONQUERYNVPROC) (GLuint id); #endif /* GL_NV_occlusion_query */ +/* -------------------------- GL_NV_pack_subimage -------------------------- */ + +#ifndef GL_NV_pack_subimage +#define GL_NV_pack_subimage 1 + +#define GL_PACK_ROW_LENGTH_NV 0x0D02 +#define GL_PACK_SKIP_ROWS_NV 0x0D03 +#define GL_PACK_SKIP_PIXELS_NV 0x0D04 + +#define GLEW_NV_pack_subimage GLEW_GET_VAR(__GLEW_NV_pack_subimage) + +#endif /* GL_NV_pack_subimage */ + /* ----------------------- GL_NV_packed_depth_stencil ---------------------- */ #ifndef GL_NV_packed_depth_stencil @@ -13398,6 +15549,30 @@ typedef GLboolean (GLAPIENTRY * PFNGLISOCCLUSIONQUERYNVPROC) (GLuint id); #endif /* GL_NV_packed_depth_stencil */ +/* --------------------------- GL_NV_packed_float -------------------------- */ + +#ifndef GL_NV_packed_float +#define GL_NV_packed_float 1 + +#define GL_R11F_G11F_B10F_NV 0x8C3A +#define GL_UNSIGNED_INT_10F_11F_11F_REV_NV 0x8C3B + +#define GLEW_NV_packed_float GLEW_GET_VAR(__GLEW_NV_packed_float) + +#endif /* GL_NV_packed_float */ + +/* ----------------------- GL_NV_packed_float_linear ----------------------- */ + +#ifndef GL_NV_packed_float_linear +#define GL_NV_packed_float_linear 1 + +#define GL_R11F_G11F_B10F_NV 0x8C3A +#define GL_UNSIGNED_INT_10F_11F_11F_REV_NV 0x8C3B + +#define GLEW_NV_packed_float_linear GLEW_GET_VAR(__GLEW_NV_packed_float_linear) + +#endif /* GL_NV_packed_float_linear */ + /* --------------------- GL_NV_parameter_buffer_object --------------------- */ #ifndef GL_NV_parameter_buffer_object @@ -13730,6 +15905,20 @@ typedef void (GLAPIENTRY * PFNGLWEIGHTPATHSNVPROC) (GLuint resultPath, GLsizei n #endif /* GL_NV_path_rendering_shared_edge */ +/* ----------------------- GL_NV_pixel_buffer_object ----------------------- */ + +#ifndef GL_NV_pixel_buffer_object +#define GL_NV_pixel_buffer_object 1 + +#define GL_PIXEL_PACK_BUFFER_NV 0x88EB +#define GL_PIXEL_UNPACK_BUFFER_NV 0x88EC +#define GL_PIXEL_PACK_BUFFER_BINDING_NV 0x88ED +#define GL_PIXEL_UNPACK_BUFFER_BINDING_NV 0x88EF + +#define GLEW_NV_pixel_buffer_object GLEW_GET_VAR(__GLEW_NV_pixel_buffer_object) + +#endif /* GL_NV_pixel_buffer_object */ + /* ------------------------- GL_NV_pixel_data_range ------------------------ */ #ifndef GL_NV_pixel_data_range @@ -13752,6 +15941,17 @@ typedef void (GLAPIENTRY * PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei le #endif /* GL_NV_pixel_data_range */ +/* ------------------------- GL_NV_platform_binary ------------------------- */ + +#ifndef GL_NV_platform_binary +#define GL_NV_platform_binary 1 + +#define GL_NVIDIA_PLATFORM_BINARY_NV 0x890B + +#define GLEW_NV_platform_binary GLEW_GET_VAR(__GLEW_NV_platform_binary) + +#endif /* GL_NV_platform_binary */ + /* --------------------------- GL_NV_point_sprite -------------------------- */ #ifndef GL_NV_point_sprite @@ -13771,6 +15971,26 @@ typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERIVNVPROC) (GLenum pname, const GLi #endif /* GL_NV_point_sprite */ +/* --------------------------- GL_NV_polygon_mode -------------------------- */ + +#ifndef GL_NV_polygon_mode +#define GL_NV_polygon_mode 1 + +#define GL_POLYGON_MODE_NV 0x0B40 +#define GL_POINT_NV 0x1B00 +#define GL_LINE_NV 0x1B01 +#define GL_FILL_NV 0x1B02 +#define GL_POLYGON_OFFSET_POINT_NV 0x2A01 +#define GL_POLYGON_OFFSET_LINE_NV 0x2A02 + +typedef void (GLAPIENTRY * PFNGLPOLYGONMODENVPROC) (GLenum face, GLenum mode); + +#define glPolygonModeNV GLEW_GET_FUN(__glewPolygonModeNV) + +#define GLEW_NV_polygon_mode GLEW_GET_VAR(__GLEW_NV_polygon_mode) + +#endif /* GL_NV_polygon_mode */ + /* -------------------------- GL_NV_present_video -------------------------- */ #ifndef GL_NV_present_video @@ -13819,6 +16039,33 @@ typedef void (GLAPIENTRY * PFNGLPRIMITIVERESTARTNVPROC) (void); #endif /* GL_NV_primitive_restart */ +/* ---------------------------- GL_NV_read_depth --------------------------- */ + +#ifndef GL_NV_read_depth +#define GL_NV_read_depth 1 + +#define GLEW_NV_read_depth GLEW_GET_VAR(__GLEW_NV_read_depth) + +#endif /* GL_NV_read_depth */ + +/* ------------------------ GL_NV_read_depth_stencil ----------------------- */ + +#ifndef GL_NV_read_depth_stencil +#define GL_NV_read_depth_stencil 1 + +#define GLEW_NV_read_depth_stencil GLEW_GET_VAR(__GLEW_NV_read_depth_stencil) + +#endif /* GL_NV_read_depth_stencil */ + +/* --------------------------- GL_NV_read_stencil -------------------------- */ + +#ifndef GL_NV_read_stencil +#define GL_NV_read_stencil 1 + +#define GLEW_NV_read_stencil GLEW_GET_VAR(__GLEW_NV_read_stencil) + +#endif /* GL_NV_read_stencil */ + /* ------------------------ GL_NV_register_combiners ----------------------- */ #ifndef GL_NV_register_combiners @@ -13925,6 +16172,38 @@ typedef void (GLAPIENTRY * PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage #endif /* GL_NV_register_combiners2 */ +/* ------------------ GL_NV_robustness_video_memory_purge ------------------ */ + +#ifndef GL_NV_robustness_video_memory_purge +#define GL_NV_robustness_video_memory_purge 1 + +#define GL_EGL_GENERATE_RESET_ON_VIDEO_MEMORY_PURGE_NV 0x334C +#define GL_PURGED_CONTEXT_RESET_NV 0x92BB + +#define GLEW_NV_robustness_video_memory_purge GLEW_GET_VAR(__GLEW_NV_robustness_video_memory_purge) + +#endif /* GL_NV_robustness_video_memory_purge */ + +/* --------------------------- GL_NV_sRGB_formats -------------------------- */ + +#ifndef GL_NV_sRGB_formats +#define GL_NV_sRGB_formats 1 + +#define GL_ETC1_SRGB8_NV 0x88EE +#define GL_SRGB8_NV 0x8C41 +#define GL_SLUMINANCE_ALPHA_NV 0x8C44 +#define GL_SLUMINANCE8_ALPHA8_NV 0x8C45 +#define GL_SLUMINANCE_NV 0x8C46 +#define GL_SLUMINANCE8_NV 0x8C47 +#define GL_COMPRESSED_SRGB_S3TC_DXT1_NV 0x8C4C +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT1_NV 0x8C4D +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT3_NV 0x8C4E +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_NV 0x8C4F + +#define GLEW_NV_sRGB_formats GLEW_GET_VAR(__GLEW_NV_sRGB_formats) + +#endif /* GL_NV_sRGB_formats */ + /* ------------------------- GL_NV_sample_locations ------------------------ */ #ifndef GL_NV_sample_locations @@ -13976,6 +16255,15 @@ typedef void (GLAPIENTRY * PFNGLNAMEDFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLuint #endif /* GL_NV_shader_atomic_float */ +/* ---------------------- GL_NV_shader_atomic_float64 ---------------------- */ + +#ifndef GL_NV_shader_atomic_float64 +#define GL_NV_shader_atomic_float64 1 + +#define GLEW_NV_shader_atomic_float64 GLEW_GET_VAR(__GLEW_NV_shader_atomic_float64) + +#endif /* GL_NV_shader_atomic_float64 */ + /* -------------------- GL_NV_shader_atomic_fp16_vector -------------------- */ #ifndef GL_NV_shader_atomic_fp16_vector @@ -14035,6 +16323,15 @@ typedef void (GLAPIENTRY * PFNGLUNIFORMUI64VNVPROC) (GLint location, GLsizei cou #endif /* GL_NV_shader_buffer_load */ +/* ---------------- GL_NV_shader_noperspective_interpolation --------------- */ + +#ifndef GL_NV_shader_noperspective_interpolation +#define GL_NV_shader_noperspective_interpolation 1 + +#define GLEW_NV_shader_noperspective_interpolation GLEW_GET_VAR(__GLEW_NV_shader_noperspective_interpolation) + +#endif /* GL_NV_shader_noperspective_interpolation */ + /* ------------------- GL_NV_shader_storage_buffer_object ------------------ */ #ifndef GL_NV_shader_storage_buffer_object @@ -14066,6 +16363,37 @@ typedef void (GLAPIENTRY * PFNGLUNIFORMUI64VNVPROC) (GLint location, GLsizei cou #endif /* GL_NV_shader_thread_shuffle */ +/* ---------------------- GL_NV_shadow_samplers_array ---------------------- */ + +#ifndef GL_NV_shadow_samplers_array +#define GL_NV_shadow_samplers_array 1 + +#define GL_SAMPLER_2D_ARRAY_SHADOW_NV 0x8DC4 + +#define GLEW_NV_shadow_samplers_array GLEW_GET_VAR(__GLEW_NV_shadow_samplers_array) + +#endif /* GL_NV_shadow_samplers_array */ + +/* ----------------------- GL_NV_shadow_samplers_cube ---------------------- */ + +#ifndef GL_NV_shadow_samplers_cube +#define GL_NV_shadow_samplers_cube 1 + +#define GL_SAMPLER_CUBE_SHADOW_NV 0x8DC5 + +#define GLEW_NV_shadow_samplers_cube GLEW_GET_VAR(__GLEW_NV_shadow_samplers_cube) + +#endif /* GL_NV_shadow_samplers_cube */ + +/* ---------------------- GL_NV_stereo_view_rendering ---------------------- */ + +#ifndef GL_NV_stereo_view_rendering +#define GL_NV_stereo_view_rendering 1 + +#define GLEW_NV_stereo_view_rendering GLEW_GET_VAR(__GLEW_NV_stereo_view_rendering) + +#endif /* GL_NV_stereo_view_rendering */ + /* ---------------------- GL_NV_tessellation_program5 ---------------------- */ #ifndef GL_NV_tessellation_program5 @@ -14106,6 +16434,37 @@ typedef void (GLAPIENTRY * PFNGLUNIFORMUI64VNVPROC) (GLint location, GLsizei cou #endif /* GL_NV_texgen_reflection */ +/* -------------------------- GL_NV_texture_array -------------------------- */ + +#ifndef GL_NV_texture_array +#define GL_NV_texture_array 1 + +#define GL_UNPACK_SKIP_IMAGES_NV 0x806D +#define GL_UNPACK_IMAGE_HEIGHT_NV 0x806E +#define GL_MAX_ARRAY_TEXTURE_LAYERS_NV 0x88FF +#define GL_TEXTURE_2D_ARRAY_NV 0x8C1A +#define GL_TEXTURE_BINDING_2D_ARRAY_NV 0x8C1D +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER_NV 0x8CD4 +#define GL_SAMPLER_2D_ARRAY_NV 0x8DC1 + +typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE3DNVPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE3DNVPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +typedef void (GLAPIENTRY * PFNGLCOPYTEXSUBIMAGE3DNVPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURELAYERNVPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +typedef void (GLAPIENTRY * PFNGLTEXIMAGE3DNVPROC) (GLenum target, GLint level, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (GLAPIENTRY * PFNGLTEXSUBIMAGE3DNVPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); + +#define glCompressedTexImage3DNV GLEW_GET_FUN(__glewCompressedTexImage3DNV) +#define glCompressedTexSubImage3DNV GLEW_GET_FUN(__glewCompressedTexSubImage3DNV) +#define glCopyTexSubImage3DNV GLEW_GET_FUN(__glewCopyTexSubImage3DNV) +#define glFramebufferTextureLayerNV GLEW_GET_FUN(__glewFramebufferTextureLayerNV) +#define glTexImage3DNV GLEW_GET_FUN(__glewTexImage3DNV) +#define glTexSubImage3DNV GLEW_GET_FUN(__glewTexSubImage3DNV) + +#define GLEW_NV_texture_array GLEW_GET_VAR(__GLEW_NV_texture_array) + +#endif /* GL_NV_texture_array */ + /* ------------------------- GL_NV_texture_barrier ------------------------- */ #ifndef GL_NV_texture_barrier @@ -14119,6 +16478,55 @@ typedef void (GLAPIENTRY * PFNGLTEXTUREBARRIERNVPROC) (void); #endif /* GL_NV_texture_barrier */ +/* ----------------------- GL_NV_texture_border_clamp ---------------------- */ + +#ifndef GL_NV_texture_border_clamp +#define GL_NV_texture_border_clamp 1 + +#define GL_TEXTURE_BORDER_COLOR_NV 0x1004 +#define GL_CLAMP_TO_BORDER_NV 0x812D + +#define GLEW_NV_texture_border_clamp GLEW_GET_VAR(__GLEW_NV_texture_border_clamp) + +#endif /* GL_NV_texture_border_clamp */ + +/* --------------------- GL_NV_texture_compression_latc -------------------- */ + +#ifndef GL_NV_texture_compression_latc +#define GL_NV_texture_compression_latc 1 + +#define GL_COMPRESSED_LUMINANCE_LATC1_NV 0x8C70 +#define GL_COMPRESSED_SIGNED_LUMINANCE_LATC1_NV 0x8C71 +#define GL_COMPRESSED_LUMINANCE_ALPHA_LATC2_NV 0x8C72 +#define GL_COMPRESSED_SIGNED_LUMINANCE_ALPHA_LATC2_NV 0x8C73 + +#define GLEW_NV_texture_compression_latc GLEW_GET_VAR(__GLEW_NV_texture_compression_latc) + +#endif /* GL_NV_texture_compression_latc */ + +/* --------------------- GL_NV_texture_compression_s3tc -------------------- */ + +#ifndef GL_NV_texture_compression_s3tc +#define GL_NV_texture_compression_s3tc 1 + +#define GL_COMPRESSED_RGB_S3TC_DXT1_NV 0x83F0 +#define GL_COMPRESSED_RGBA_S3TC_DXT1_NV 0x83F1 +#define GL_COMPRESSED_RGBA_S3TC_DXT3_NV 0x83F2 +#define GL_COMPRESSED_RGBA_S3TC_DXT5_NV 0x83F3 + +#define GLEW_NV_texture_compression_s3tc GLEW_GET_VAR(__GLEW_NV_texture_compression_s3tc) + +#endif /* GL_NV_texture_compression_s3tc */ + +/* ----------------- GL_NV_texture_compression_s3tc_update ----------------- */ + +#ifndef GL_NV_texture_compression_s3tc_update +#define GL_NV_texture_compression_s3tc_update 1 + +#define GLEW_NV_texture_compression_s3tc_update GLEW_GET_VAR(__GLEW_NV_texture_compression_s3tc_update) + +#endif /* GL_NV_texture_compression_s3tc_update */ + /* --------------------- GL_NV_texture_compression_vtc --------------------- */ #ifndef GL_NV_texture_compression_vtc @@ -14180,6 +16588,15 @@ typedef void (GLAPIENTRY * PFNGLTEXTUREIMAGE3DMULTISAMPLENVPROC) (GLuint texture #endif /* GL_NV_texture_multisample */ +/* ---------------------- GL_NV_texture_npot_2D_mipmap --------------------- */ + +#ifndef GL_NV_texture_npot_2D_mipmap +#define GL_NV_texture_npot_2D_mipmap 1 + +#define GLEW_NV_texture_npot_2D_mipmap GLEW_GET_VAR(__GLEW_NV_texture_npot_2D_mipmap) + +#endif /* GL_NV_texture_npot_2D_mipmap */ + /* ------------------------ GL_NV_texture_rectangle ------------------------ */ #ifndef GL_NV_texture_rectangle @@ -14194,6 +16611,15 @@ typedef void (GLAPIENTRY * PFNGLTEXTUREIMAGE3DMULTISAMPLENVPROC) (GLuint texture #endif /* GL_NV_texture_rectangle */ +/* ------------------- GL_NV_texture_rectangle_compressed ------------------ */ + +#ifndef GL_NV_texture_rectangle_compressed +#define GL_NV_texture_rectangle_compressed 1 + +#define GLEW_NV_texture_rectangle_compressed GLEW_GET_VAR(__GLEW_NV_texture_rectangle_compressed) + +#endif /* GL_NV_texture_rectangle_compressed */ + /* -------------------------- GL_NV_texture_shader ------------------------- */ #ifndef GL_NV_texture_shader @@ -14967,6 +17393,50 @@ typedef void (GLAPIENTRY * PFNGLVIDEOCAPTURESTREAMPARAMETERIVNVPROC) (GLuint vid #endif /* GL_NV_video_capture */ +/* -------------------------- GL_NV_viewport_array ------------------------- */ + +#ifndef GL_NV_viewport_array +#define GL_NV_viewport_array 1 + +#define GL_DEPTH_RANGE 0x0B70 +#define GL_VIEWPORT 0x0BA2 +#define GL_SCISSOR_BOX 0x0C10 +#define GL_SCISSOR_TEST 0x0C11 +#define GL_MAX_VIEWPORTS_NV 0x825B +#define GL_VIEWPORT_SUBPIXEL_BITS_NV 0x825C +#define GL_VIEWPORT_BOUNDS_RANGE_NV 0x825D +#define GL_VIEWPORT_INDEX_PROVOKING_VERTEX_NV 0x825F + +typedef void (GLAPIENTRY * PFNGLDEPTHRANGEARRAYFVNVPROC) (GLuint first, GLsizei count, const GLfloat * v); +typedef void (GLAPIENTRY * PFNGLDEPTHRANGEINDEXEDFNVPROC) (GLuint index, GLfloat n, GLfloat f); +typedef void (GLAPIENTRY * PFNGLDISABLEINVPROC) (GLenum target, GLuint index); +typedef void (GLAPIENTRY * PFNGLENABLEINVPROC) (GLenum target, GLuint index); +typedef void (GLAPIENTRY * PFNGLGETFLOATI_VNVPROC) (GLenum target, GLuint index, GLfloat* data); +typedef GLboolean (GLAPIENTRY * PFNGLISENABLEDINVPROC) (GLenum target, GLuint index); +typedef void (GLAPIENTRY * PFNGLSCISSORARRAYVNVPROC) (GLuint first, GLsizei count, const GLint * v); +typedef void (GLAPIENTRY * PFNGLSCISSORINDEXEDNVPROC) (GLuint index, GLint left, GLint bottom, GLsizei width, GLsizei height); +typedef void (GLAPIENTRY * PFNGLSCISSORINDEXEDVNVPROC) (GLuint index, const GLint * v); +typedef void (GLAPIENTRY * PFNGLVIEWPORTARRAYVNVPROC) (GLuint first, GLsizei count, const GLfloat * v); +typedef void (GLAPIENTRY * PFNGLVIEWPORTINDEXEDFNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h); +typedef void (GLAPIENTRY * PFNGLVIEWPORTINDEXEDFVNVPROC) (GLuint index, const GLfloat * v); + +#define glDepthRangeArrayfvNV GLEW_GET_FUN(__glewDepthRangeArrayfvNV) +#define glDepthRangeIndexedfNV GLEW_GET_FUN(__glewDepthRangeIndexedfNV) +#define glDisableiNV GLEW_GET_FUN(__glewDisableiNV) +#define glEnableiNV GLEW_GET_FUN(__glewEnableiNV) +#define glGetFloati_vNV GLEW_GET_FUN(__glewGetFloati_vNV) +#define glIsEnablediNV GLEW_GET_FUN(__glewIsEnablediNV) +#define glScissorArrayvNV GLEW_GET_FUN(__glewScissorArrayvNV) +#define glScissorIndexedNV GLEW_GET_FUN(__glewScissorIndexedNV) +#define glScissorIndexedvNV GLEW_GET_FUN(__glewScissorIndexedvNV) +#define glViewportArrayvNV GLEW_GET_FUN(__glewViewportArrayvNV) +#define glViewportIndexedfNV GLEW_GET_FUN(__glewViewportIndexedfNV) +#define glViewportIndexedfvNV GLEW_GET_FUN(__glewViewportIndexedfvNV) + +#define GLEW_NV_viewport_array GLEW_GET_VAR(__GLEW_NV_viewport_array) + +#endif /* GL_NV_viewport_array */ + /* ------------------------- GL_NV_viewport_array2 ------------------------- */ #ifndef GL_NV_viewport_array2 @@ -14976,69 +17446,40 @@ typedef void (GLAPIENTRY * PFNGLVIDEOCAPTURESTREAMPARAMETERIVNVPROC) (GLuint vid #endif /* GL_NV_viewport_array2 */ -/* ------------------------ GL_OES_byte_coordinates ------------------------ */ - -#ifndef GL_OES_byte_coordinates -#define GL_OES_byte_coordinates 1 - -#define GLEW_OES_byte_coordinates GLEW_GET_VAR(__GLEW_OES_byte_coordinates) - -#endif /* GL_OES_byte_coordinates */ - -/* ------------------- GL_OES_compressed_paletted_texture ------------------ */ - -#ifndef GL_OES_compressed_paletted_texture -#define GL_OES_compressed_paletted_texture 1 - -#define GL_PALETTE4_RGB8_OES 0x8B90 -#define GL_PALETTE4_RGBA8_OES 0x8B91 -#define GL_PALETTE4_R5_G6_B5_OES 0x8B92 -#define GL_PALETTE4_RGBA4_OES 0x8B93 -#define GL_PALETTE4_RGB5_A1_OES 0x8B94 -#define GL_PALETTE8_RGB8_OES 0x8B95 -#define GL_PALETTE8_RGBA8_OES 0x8B96 -#define GL_PALETTE8_R5_G6_B5_OES 0x8B97 -#define GL_PALETTE8_RGBA4_OES 0x8B98 -#define GL_PALETTE8_RGB5_A1_OES 0x8B99 +/* ------------------------- GL_NV_viewport_swizzle ------------------------ */ -#define GLEW_OES_compressed_paletted_texture GLEW_GET_VAR(__GLEW_OES_compressed_paletted_texture) +#ifndef GL_NV_viewport_swizzle +#define GL_NV_viewport_swizzle 1 -#endif /* GL_OES_compressed_paletted_texture */ +#define GL_VIEWPORT_SWIZZLE_POSITIVE_X_NV 0x9350 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_X_NV 0x9351 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_Y_NV 0x9352 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_Y_NV 0x9353 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_Z_NV 0x9354 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_Z_NV 0x9355 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_W_NV 0x9356 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_W_NV 0x9357 +#define GL_VIEWPORT_SWIZZLE_X_NV 0x9358 +#define GL_VIEWPORT_SWIZZLE_Y_NV 0x9359 +#define GL_VIEWPORT_SWIZZLE_Z_NV 0x935A +#define GL_VIEWPORT_SWIZZLE_W_NV 0x935B -/* --------------------------- GL_OES_read_format -------------------------- */ +typedef void (GLAPIENTRY * PFNGLVIEWPORTSWIZZLENVPROC) (GLuint index, GLenum swizzlex, GLenum swizzley, GLenum swizzlez, GLenum swizzlew); -#ifndef GL_OES_read_format -#define GL_OES_read_format 1 +#define glViewportSwizzleNV GLEW_GET_FUN(__glewViewportSwizzleNV) -#define GL_IMPLEMENTATION_COLOR_READ_TYPE_OES 0x8B9A -#define GL_IMPLEMENTATION_COLOR_READ_FORMAT_OES 0x8B9B +#define GLEW_NV_viewport_swizzle GLEW_GET_VAR(__GLEW_NV_viewport_swizzle) -#define GLEW_OES_read_format GLEW_GET_VAR(__GLEW_OES_read_format) +#endif /* GL_NV_viewport_swizzle */ -#endif /* GL_OES_read_format */ - -/* ------------------------ GL_OES_single_precision ------------------------ */ - -#ifndef GL_OES_single_precision -#define GL_OES_single_precision 1 - -typedef void (GLAPIENTRY * PFNGLCLEARDEPTHFOESPROC) (GLclampf depth); -typedef void (GLAPIENTRY * PFNGLCLIPPLANEFOESPROC) (GLenum plane, const GLfloat* equation); -typedef void (GLAPIENTRY * PFNGLDEPTHRANGEFOESPROC) (GLclampf n, GLclampf f); -typedef void (GLAPIENTRY * PFNGLFRUSTUMFOESPROC) (GLfloat l, GLfloat r, GLfloat b, GLfloat t, GLfloat n, GLfloat f); -typedef void (GLAPIENTRY * PFNGLGETCLIPPLANEFOESPROC) (GLenum plane, GLfloat* equation); -typedef void (GLAPIENTRY * PFNGLORTHOFOESPROC) (GLfloat l, GLfloat r, GLfloat b, GLfloat t, GLfloat n, GLfloat f); +/* ------------------------ GL_OES_byte_coordinates ------------------------ */ -#define glClearDepthfOES GLEW_GET_FUN(__glewClearDepthfOES) -#define glClipPlanefOES GLEW_GET_FUN(__glewClipPlanefOES) -#define glDepthRangefOES GLEW_GET_FUN(__glewDepthRangefOES) -#define glFrustumfOES GLEW_GET_FUN(__glewFrustumfOES) -#define glGetClipPlanefOES GLEW_GET_FUN(__glewGetClipPlanefOES) -#define glOrthofOES GLEW_GET_FUN(__glewOrthofOES) +#ifndef GL_OES_byte_coordinates +#define GL_OES_byte_coordinates 1 -#define GLEW_OES_single_precision GLEW_GET_VAR(__GLEW_OES_single_precision) +#define GLEW_OES_byte_coordinates GLEW_GET_VAR(__GLEW_OES_byte_coordinates) -#endif /* GL_OES_single_precision */ +#endif /* GL_OES_byte_coordinates */ /* ---------------------------- GL_OML_interlace --------------------------- */ @@ -15107,6 +17548,19 @@ typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTUREMULTIVIEWOVRPROC) (GLenum targ #endif /* GL_OVR_multiview2 */ +/* ------------ GL_OVR_multiview_multisampled_render_to_texture ------------ */ + +#ifndef GL_OVR_multiview_multisampled_render_to_texture +#define GL_OVR_multiview_multisampled_render_to_texture 1 + +typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTUREMULTISAMPLEMULTIVIEWOVRPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLsizei samples, GLint baseViewIndex, GLsizei numViews); + +#define glFramebufferTextureMultisampleMultiviewOVR GLEW_GET_FUN(__glewFramebufferTextureMultisampleMultiviewOVR) + +#define GLEW_OVR_multiview_multisampled_render_to_texture GLEW_GET_VAR(__GLEW_OVR_multiview_multisampled_render_to_texture) + +#endif /* GL_OVR_multiview_multisampled_render_to_texture */ + /* --------------------------- GL_PGI_misc_hints --------------------------- */ #ifndef GL_PGI_misc_hints @@ -15169,6 +17623,218 @@ typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTUREMULTIVIEWOVRPROC) (GLenum targ #endif /* GL_PGI_vertex_hints */ +/* --------------------------- GL_QCOM_alpha_test -------------------------- */ + +#ifndef GL_QCOM_alpha_test +#define GL_QCOM_alpha_test 1 + +#define GL_ALPHA_TEST_QCOM 0x0BC0 +#define GL_ALPHA_TEST_FUNC_QCOM 0x0BC1 +#define GL_ALPHA_TEST_REF_QCOM 0x0BC2 + +typedef void (GLAPIENTRY * PFNGLALPHAFUNCQCOMPROC) (GLenum func, GLclampf ref); + +#define glAlphaFuncQCOM GLEW_GET_FUN(__glewAlphaFuncQCOM) + +#define GLEW_QCOM_alpha_test GLEW_GET_VAR(__GLEW_QCOM_alpha_test) + +#endif /* GL_QCOM_alpha_test */ + +/* ------------------------ GL_QCOM_binning_control ------------------------ */ + +#ifndef GL_QCOM_binning_control +#define GL_QCOM_binning_control 1 + +#define GL_DONT_CARE 0x1100 +#define GL_BINNING_CONTROL_HINT_QCOM 0x8FB0 +#define GL_CPU_OPTIMIZED_QCOM 0x8FB1 +#define GL_GPU_OPTIMIZED_QCOM 0x8FB2 +#define GL_RENDER_DIRECT_TO_FRAMEBUFFER_QCOM 0x8FB3 + +#define GLEW_QCOM_binning_control GLEW_GET_VAR(__GLEW_QCOM_binning_control) + +#endif /* GL_QCOM_binning_control */ + +/* ------------------------- GL_QCOM_driver_control ------------------------ */ + +#ifndef GL_QCOM_driver_control +#define GL_QCOM_driver_control 1 + +typedef void (GLAPIENTRY * PFNGLDISABLEDRIVERCONTROLQCOMPROC) (GLuint driverControl); +typedef void (GLAPIENTRY * PFNGLENABLEDRIVERCONTROLQCOMPROC) (GLuint driverControl); +typedef void (GLAPIENTRY * PFNGLGETDRIVERCONTROLSTRINGQCOMPROC) (GLuint driverControl, GLsizei bufSize, GLsizei* length, GLchar *driverControlString); +typedef void (GLAPIENTRY * PFNGLGETDRIVERCONTROLSQCOMPROC) (GLint* num, GLsizei size, GLuint *driverControls); + +#define glDisableDriverControlQCOM GLEW_GET_FUN(__glewDisableDriverControlQCOM) +#define glEnableDriverControlQCOM GLEW_GET_FUN(__glewEnableDriverControlQCOM) +#define glGetDriverControlStringQCOM GLEW_GET_FUN(__glewGetDriverControlStringQCOM) +#define glGetDriverControlsQCOM GLEW_GET_FUN(__glewGetDriverControlsQCOM) + +#define GLEW_QCOM_driver_control GLEW_GET_VAR(__GLEW_QCOM_driver_control) + +#endif /* GL_QCOM_driver_control */ + +/* -------------------------- GL_QCOM_extended_get ------------------------- */ + +#ifndef GL_QCOM_extended_get +#define GL_QCOM_extended_get 1 + +#define GL_TEXTURE_WIDTH_QCOM 0x8BD2 +#define GL_TEXTURE_HEIGHT_QCOM 0x8BD3 +#define GL_TEXTURE_DEPTH_QCOM 0x8BD4 +#define GL_TEXTURE_INTERNAL_FORMAT_QCOM 0x8BD5 +#define GL_TEXTURE_FORMAT_QCOM 0x8BD6 +#define GL_TEXTURE_TYPE_QCOM 0x8BD7 +#define GL_TEXTURE_IMAGE_VALID_QCOM 0x8BD8 +#define GL_TEXTURE_NUM_LEVELS_QCOM 0x8BD9 +#define GL_TEXTURE_TARGET_QCOM 0x8BDA +#define GL_TEXTURE_OBJECT_VALID_QCOM 0x8BDB +#define GL_STATE_RESTORE 0x8BDC + +typedef void (GLAPIENTRY * PFNGLEXTGETBUFFERPOINTERVQCOMPROC) (GLenum target, void** params); +typedef void (GLAPIENTRY * PFNGLEXTGETBUFFERSQCOMPROC) (GLuint* buffers, GLint maxBuffers, GLint* numBuffers); +typedef void (GLAPIENTRY * PFNGLEXTGETFRAMEBUFFERSQCOMPROC) (GLuint* framebuffers, GLint maxFramebuffers, GLint* numFramebuffers); +typedef void (GLAPIENTRY * PFNGLEXTGETRENDERBUFFERSQCOMPROC) (GLuint* renderbuffers, GLint maxRenderbuffers, GLint* numRenderbuffers); +typedef void (GLAPIENTRY * PFNGLEXTGETTEXLEVELPARAMETERIVQCOMPROC) (GLuint texture, GLenum face, GLint level, GLenum pname, GLint* params); +typedef void (GLAPIENTRY * PFNGLEXTGETTEXSUBIMAGEQCOMPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, void *texels); +typedef void (GLAPIENTRY * PFNGLEXTGETTEXTURESQCOMPROC) (GLuint* textures, GLint maxTextures, GLint* numTextures); +typedef void (GLAPIENTRY * PFNGLEXTTEXOBJECTSTATEOVERRIDEIQCOMPROC) (GLenum target, GLenum pname, GLint param); + +#define glExtGetBufferPointervQCOM GLEW_GET_FUN(__glewExtGetBufferPointervQCOM) +#define glExtGetBuffersQCOM GLEW_GET_FUN(__glewExtGetBuffersQCOM) +#define glExtGetFramebuffersQCOM GLEW_GET_FUN(__glewExtGetFramebuffersQCOM) +#define glExtGetRenderbuffersQCOM GLEW_GET_FUN(__glewExtGetRenderbuffersQCOM) +#define glExtGetTexLevelParameterivQCOM GLEW_GET_FUN(__glewExtGetTexLevelParameterivQCOM) +#define glExtGetTexSubImageQCOM GLEW_GET_FUN(__glewExtGetTexSubImageQCOM) +#define glExtGetTexturesQCOM GLEW_GET_FUN(__glewExtGetTexturesQCOM) +#define glExtTexObjectStateOverrideiQCOM GLEW_GET_FUN(__glewExtTexObjectStateOverrideiQCOM) + +#define GLEW_QCOM_extended_get GLEW_GET_VAR(__GLEW_QCOM_extended_get) + +#endif /* GL_QCOM_extended_get */ + +/* ------------------------- GL_QCOM_extended_get2 ------------------------- */ + +#ifndef GL_QCOM_extended_get2 +#define GL_QCOM_extended_get2 1 + +typedef void (GLAPIENTRY * PFNGLEXTGETPROGRAMBINARYSOURCEQCOMPROC) (GLuint program, GLenum shadertype, GLchar* source, GLint* length); +typedef void (GLAPIENTRY * PFNGLEXTGETPROGRAMSQCOMPROC) (GLuint* programs, GLint maxPrograms, GLint* numPrograms); +typedef void (GLAPIENTRY * PFNGLEXTGETSHADERSQCOMPROC) (GLuint* shaders, GLint maxShaders, GLint* numShaders); +typedef GLboolean (GLAPIENTRY * PFNGLEXTISPROGRAMBINARYQCOMPROC) (GLuint program); + +#define glExtGetProgramBinarySourceQCOM GLEW_GET_FUN(__glewExtGetProgramBinarySourceQCOM) +#define glExtGetProgramsQCOM GLEW_GET_FUN(__glewExtGetProgramsQCOM) +#define glExtGetShadersQCOM GLEW_GET_FUN(__glewExtGetShadersQCOM) +#define glExtIsProgramBinaryQCOM GLEW_GET_FUN(__glewExtIsProgramBinaryQCOM) + +#define GLEW_QCOM_extended_get2 GLEW_GET_VAR(__GLEW_QCOM_extended_get2) + +#endif /* GL_QCOM_extended_get2 */ + +/* ---------------------- GL_QCOM_framebuffer_foveated --------------------- */ + +#ifndef GL_QCOM_framebuffer_foveated +#define GL_QCOM_framebuffer_foveated 1 + +#define GL_FOVEATION_ENABLE_BIT_QCOM 0x1 +#define GL_FOVEATION_SCALED_BIN_METHOD_BIT_QCOM 0x2 + +typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERFOVEATIONCONFIGQCOMPROC) (GLuint fbo, GLuint numLayers, GLuint focalPointsPerLayer, GLuint requestedFeatures, GLuint* providedFeatures); +typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERFOVEATIONPARAMETERSQCOMPROC) (GLuint fbo, GLuint layer, GLuint focalPoint, GLfloat focalX, GLfloat focalY, GLfloat gainX, GLfloat gainY, GLfloat foveaArea); + +#define glFramebufferFoveationConfigQCOM GLEW_GET_FUN(__glewFramebufferFoveationConfigQCOM) +#define glFramebufferFoveationParametersQCOM GLEW_GET_FUN(__glewFramebufferFoveationParametersQCOM) + +#define GLEW_QCOM_framebuffer_foveated GLEW_GET_VAR(__GLEW_QCOM_framebuffer_foveated) + +#endif /* GL_QCOM_framebuffer_foveated */ + +/* ---------------------- GL_QCOM_perfmon_global_mode ---------------------- */ + +#ifndef GL_QCOM_perfmon_global_mode +#define GL_QCOM_perfmon_global_mode 1 + +#define GL_PERFMON_GLOBAL_MODE_QCOM 0x8FA0 + +#define GLEW_QCOM_perfmon_global_mode GLEW_GET_VAR(__GLEW_QCOM_perfmon_global_mode) + +#endif /* GL_QCOM_perfmon_global_mode */ + +/* -------------- GL_QCOM_shader_framebuffer_fetch_noncoherent ------------- */ + +#ifndef GL_QCOM_shader_framebuffer_fetch_noncoherent +#define GL_QCOM_shader_framebuffer_fetch_noncoherent 1 + +#define GL_FRAMEBUFFER_FETCH_NONCOHERENT_QCOM 0x96A2 + +typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERFETCHBARRIERQCOMPROC) (void); + +#define glFramebufferFetchBarrierQCOM GLEW_GET_FUN(__glewFramebufferFetchBarrierQCOM) + +#define GLEW_QCOM_shader_framebuffer_fetch_noncoherent GLEW_GET_VAR(__GLEW_QCOM_shader_framebuffer_fetch_noncoherent) + +#endif /* GL_QCOM_shader_framebuffer_fetch_noncoherent */ + +/* ------------------------ GL_QCOM_tiled_rendering ------------------------ */ + +#ifndef GL_QCOM_tiled_rendering +#define GL_QCOM_tiled_rendering 1 + +#define GL_COLOR_BUFFER_BIT0_QCOM 0x00000001 +#define GL_COLOR_BUFFER_BIT1_QCOM 0x00000002 +#define GL_COLOR_BUFFER_BIT2_QCOM 0x00000004 +#define GL_COLOR_BUFFER_BIT3_QCOM 0x00000008 +#define GL_COLOR_BUFFER_BIT4_QCOM 0x00000010 +#define GL_COLOR_BUFFER_BIT5_QCOM 0x00000020 +#define GL_COLOR_BUFFER_BIT6_QCOM 0x00000040 +#define GL_COLOR_BUFFER_BIT7_QCOM 0x00000080 +#define GL_DEPTH_BUFFER_BIT0_QCOM 0x00000100 +#define GL_DEPTH_BUFFER_BIT1_QCOM 0x00000200 +#define GL_DEPTH_BUFFER_BIT2_QCOM 0x00000400 +#define GL_DEPTH_BUFFER_BIT3_QCOM 0x00000800 +#define GL_DEPTH_BUFFER_BIT4_QCOM 0x00001000 +#define GL_DEPTH_BUFFER_BIT5_QCOM 0x00002000 +#define GL_DEPTH_BUFFER_BIT6_QCOM 0x00004000 +#define GL_DEPTH_BUFFER_BIT7_QCOM 0x00008000 +#define GL_STENCIL_BUFFER_BIT0_QCOM 0x00010000 +#define GL_STENCIL_BUFFER_BIT1_QCOM 0x00020000 +#define GL_STENCIL_BUFFER_BIT2_QCOM 0x00040000 +#define GL_STENCIL_BUFFER_BIT3_QCOM 0x00080000 +#define GL_STENCIL_BUFFER_BIT4_QCOM 0x00100000 +#define GL_STENCIL_BUFFER_BIT5_QCOM 0x00200000 +#define GL_STENCIL_BUFFER_BIT6_QCOM 0x00400000 +#define GL_STENCIL_BUFFER_BIT7_QCOM 0x00800000 +#define GL_MULTISAMPLE_BUFFER_BIT0_QCOM 0x01000000 +#define GL_MULTISAMPLE_BUFFER_BIT1_QCOM 0x02000000 +#define GL_MULTISAMPLE_BUFFER_BIT2_QCOM 0x04000000 +#define GL_MULTISAMPLE_BUFFER_BIT3_QCOM 0x08000000 +#define GL_MULTISAMPLE_BUFFER_BIT4_QCOM 0x10000000 +#define GL_MULTISAMPLE_BUFFER_BIT5_QCOM 0x20000000 +#define GL_MULTISAMPLE_BUFFER_BIT6_QCOM 0x40000000 +#define GL_MULTISAMPLE_BUFFER_BIT7_QCOM 0x80000000 + +typedef void (GLAPIENTRY * PFNGLENDTILINGQCOMPROC) (GLbitfield preserveMask); +typedef void (GLAPIENTRY * PFNGLSTARTTILINGQCOMPROC) (GLuint x, GLuint y, GLuint width, GLuint height, GLbitfield preserveMask); + +#define glEndTilingQCOM GLEW_GET_FUN(__glewEndTilingQCOM) +#define glStartTilingQCOM GLEW_GET_FUN(__glewStartTilingQCOM) + +#define GLEW_QCOM_tiled_rendering GLEW_GET_VAR(__GLEW_QCOM_tiled_rendering) + +#endif /* GL_QCOM_tiled_rendering */ + +/* ---------------------- GL_QCOM_writeonly_rendering ---------------------- */ + +#ifndef GL_QCOM_writeonly_rendering +#define GL_QCOM_writeonly_rendering 1 + +#define GL_WRITEONLY_RENDERING_QCOM 0x8823 + +#define GLEW_QCOM_writeonly_rendering GLEW_GET_VAR(__GLEW_QCOM_writeonly_rendering) + +#endif /* GL_QCOM_writeonly_rendering */ + /* ---------------------- GL_REGAL_ES1_0_compatibility --------------------- */ #ifndef GL_REGAL_ES1_0_compatibility @@ -15395,6 +18061,15 @@ typedef void * (GLAPIENTRY * PFNGLGETPROCADDRESSREGALPROC) (const GLchar *name); #endif /* GL_S3_s3tc */ +/* ------------------------- GL_SGIS_clip_band_hint ------------------------ */ + +#ifndef GL_SGIS_clip_band_hint +#define GL_SGIS_clip_band_hint 1 + +#define GLEW_SGIS_clip_band_hint GLEW_GET_VAR(__GLEW_SGIS_clip_band_hint) + +#endif /* GL_SGIS_clip_band_hint */ + /* -------------------------- GL_SGIS_color_range -------------------------- */ #ifndef GL_SGIS_color_range @@ -15456,6 +18131,15 @@ typedef void (GLAPIENTRY * PFNGLGETFOGFUNCSGISPROC) (GLfloat* points); #endif /* GL_SGIS_generate_mipmap */ +/* -------------------------- GL_SGIS_line_texgen -------------------------- */ + +#ifndef GL_SGIS_line_texgen +#define GL_SGIS_line_texgen 1 + +#define GLEW_SGIS_line_texgen GLEW_GET_VAR(__GLEW_SGIS_line_texgen) + +#endif /* GL_SGIS_line_texgen */ + /* -------------------------- GL_SGIS_multisample -------------------------- */ #ifndef GL_SGIS_multisample @@ -15488,6 +18172,37 @@ typedef void (GLAPIENTRY * PFNGLSAMPLEPATTERNSGISPROC) (GLenum pattern); #endif /* GL_SGIS_multisample */ +/* -------------------------- GL_SGIS_multitexture ------------------------- */ + +#ifndef GL_SGIS_multitexture +#define GL_SGIS_multitexture 1 + +#define GL_SELECTED_TEXTURE_SGIS 0x83C0 +#define GL_SELECTED_TEXTURE_COORD_SET_SGIS 0x83C1 +#define GL_SELECTED_TEXTURE_TRANSFORM_SGIS 0x83C2 +#define GL_MAX_TEXTURES_SGIS 0x83C3 +#define GL_MAX_TEXTURE_COORD_SETS_SGIS 0x83C4 +#define GL_TEXTURE_COORD_SET_INTERLEAVE_FACTOR_SGIS 0x83C5 +#define GL_TEXTURE_ENV_COORD_SET_SGIS 0x83C6 +#define GL_TEXTURE0_SGIS 0x83C7 +#define GL_TEXTURE1_SGIS 0x83C8 +#define GL_TEXTURE2_SGIS 0x83C9 +#define GL_TEXTURE3_SGIS 0x83CA + +typedef void (GLAPIENTRY * PFNGLINTERLEAVEDTEXTURECOORDSETSSGISPROC) (GLint factor); +typedef void (GLAPIENTRY * PFNGLSELECTTEXTURECOORDSETSGISPROC) (GLenum target); +typedef void (GLAPIENTRY * PFNGLSELECTTEXTURESGISPROC) (GLenum target); +typedef void (GLAPIENTRY * PFNGLSELECTTEXTURETRANSFORMSGISPROC) (GLenum target); + +#define glInterleavedTextureCoordSetsSGIS GLEW_GET_FUN(__glewInterleavedTextureCoordSetsSGIS) +#define glSelectTextureCoordSetSGIS GLEW_GET_FUN(__glewSelectTextureCoordSetSGIS) +#define glSelectTextureSGIS GLEW_GET_FUN(__glewSelectTextureSGIS) +#define glSelectTextureTransformSGIS GLEW_GET_FUN(__glewSelectTextureTransformSGIS) + +#define GLEW_SGIS_multitexture GLEW_GET_VAR(__GLEW_SGIS_multitexture) + +#endif /* GL_SGIS_multitexture */ + /* ------------------------- GL_SGIS_pixel_texture ------------------------- */ #ifndef GL_SGIS_pixel_texture @@ -15515,6 +18230,19 @@ typedef void (GLAPIENTRY * PFNGLSAMPLEPATTERNSGISPROC) (GLenum pattern); #endif /* GL_SGIS_point_line_texgen */ +/* ----------------------- GL_SGIS_shared_multisample ---------------------- */ + +#ifndef GL_SGIS_shared_multisample +#define GL_SGIS_shared_multisample 1 + +typedef void (GLAPIENTRY * PFNGLMULTISAMPLESUBRECTPOSSGISPROC) (GLint x, GLint y); + +#define glMultisampleSubRectPosSGIS GLEW_GET_FUN(__glewMultisampleSubRectPosSGIS) + +#define GLEW_SGIS_shared_multisample GLEW_GET_VAR(__GLEW_SGIS_shared_multisample) + +#endif /* GL_SGIS_shared_multisample */ + /* ------------------------ GL_SGIS_sharpen_texture ------------------------ */ #ifndef GL_SGIS_sharpen_texture @@ -15658,6 +18386,42 @@ typedef GLint (GLAPIENTRY * PFNGLPOLLASYNCSGIXPROC) (GLuint* markerp); #endif /* GL_SGIX_async_pixel */ +/* ----------------------- GL_SGIX_bali_g_instruments ---------------------- */ + +#ifndef GL_SGIX_bali_g_instruments +#define GL_SGIX_bali_g_instruments 1 + +#define GL_BALI_NUM_TRIS_CULLED_INSTRUMENT 0x6080 +#define GL_BALI_NUM_PRIMS_CLIPPED_INSTRUMENT 0x6081 +#define GL_BALI_NUM_PRIMS_REJECT_INSTRUMENT 0x6082 +#define GL_BALI_NUM_PRIMS_CLIP_RESULT_INSTRUMENT 0x6083 + +#define GLEW_SGIX_bali_g_instruments GLEW_GET_VAR(__GLEW_SGIX_bali_g_instruments) + +#endif /* GL_SGIX_bali_g_instruments */ + +/* ----------------------- GL_SGIX_bali_r_instruments ---------------------- */ + +#ifndef GL_SGIX_bali_r_instruments +#define GL_SGIX_bali_r_instruments 1 + +#define GL_BALI_FRAGMENTS_GENERATED_INSTRUMENT 0x6090 +#define GL_BALI_DEPTH_PASS_INSTRUMENT 0x6091 +#define GL_BALI_R_CHIP_COUNT 0x6092 + +#define GLEW_SGIX_bali_r_instruments GLEW_GET_VAR(__GLEW_SGIX_bali_r_instruments) + +#endif /* GL_SGIX_bali_r_instruments */ + +/* --------------------- GL_SGIX_bali_timer_instruments -------------------- */ + +#ifndef GL_SGIX_bali_timer_instruments +#define GL_SGIX_bali_timer_instruments 1 + +#define GLEW_SGIX_bali_timer_instruments GLEW_GET_VAR(__GLEW_SGIX_bali_timer_instruments) + +#endif /* GL_SGIX_bali_timer_instruments */ + /* ----------------------- GL_SGIX_blend_alpha_minmax ---------------------- */ #ifndef GL_SGIX_blend_alpha_minmax @@ -15670,6 +18434,37 @@ typedef GLint (GLAPIENTRY * PFNGLPOLLASYNCSGIXPROC) (GLuint* markerp); #endif /* GL_SGIX_blend_alpha_minmax */ +/* --------------------------- GL_SGIX_blend_cadd -------------------------- */ + +#ifndef GL_SGIX_blend_cadd +#define GL_SGIX_blend_cadd 1 + +#define GL_FUNC_COMPLEX_ADD_EXT 0x601C + +#define GLEW_SGIX_blend_cadd GLEW_GET_VAR(__GLEW_SGIX_blend_cadd) + +#endif /* GL_SGIX_blend_cadd */ + +/* ------------------------ GL_SGIX_blend_cmultiply ------------------------ */ + +#ifndef GL_SGIX_blend_cmultiply +#define GL_SGIX_blend_cmultiply 1 + +#define GL_FUNC_COMPLEX_MULTIPLY_EXT 0x601B + +#define GLEW_SGIX_blend_cmultiply GLEW_GET_VAR(__GLEW_SGIX_blend_cmultiply) + +#endif /* GL_SGIX_blend_cmultiply */ + +/* --------------------- GL_SGIX_calligraphic_fragment --------------------- */ + +#ifndef GL_SGIX_calligraphic_fragment +#define GL_SGIX_calligraphic_fragment 1 + +#define GLEW_SGIX_calligraphic_fragment GLEW_GET_VAR(__GLEW_SGIX_calligraphic_fragment) + +#endif /* GL_SGIX_calligraphic_fragment */ + /* ---------------------------- GL_SGIX_clipmap ---------------------------- */ #ifndef GL_SGIX_clipmap @@ -15679,6 +18474,35 @@ typedef GLint (GLAPIENTRY * PFNGLPOLLASYNCSGIXPROC) (GLuint* markerp); #endif /* GL_SGIX_clipmap */ +/* --------------------- GL_SGIX_color_matrix_accuracy --------------------- */ + +#ifndef GL_SGIX_color_matrix_accuracy +#define GL_SGIX_color_matrix_accuracy 1 + +#define GL_COLOR_MATRIX_HINT 0x8317 + +#define GLEW_SGIX_color_matrix_accuracy GLEW_GET_VAR(__GLEW_SGIX_color_matrix_accuracy) + +#endif /* GL_SGIX_color_matrix_accuracy */ + +/* --------------------- GL_SGIX_color_table_index_mode -------------------- */ + +#ifndef GL_SGIX_color_table_index_mode +#define GL_SGIX_color_table_index_mode 1 + +#define GLEW_SGIX_color_table_index_mode GLEW_GET_VAR(__GLEW_SGIX_color_table_index_mode) + +#endif /* GL_SGIX_color_table_index_mode */ + +/* ------------------------- GL_SGIX_complex_polar ------------------------- */ + +#ifndef GL_SGIX_complex_polar +#define GL_SGIX_complex_polar 1 + +#define GLEW_SGIX_complex_polar GLEW_GET_VAR(__GLEW_SGIX_complex_polar) + +#endif /* GL_SGIX_complex_polar */ + /* ---------------------- GL_SGIX_convolution_accuracy --------------------- */ #ifndef GL_SGIX_convolution_accuracy @@ -15690,6 +18514,74 @@ typedef GLint (GLAPIENTRY * PFNGLPOLLASYNCSGIXPROC) (GLuint* markerp); #endif /* GL_SGIX_convolution_accuracy */ +/* ---------------------------- GL_SGIX_cube_map --------------------------- */ + +#ifndef GL_SGIX_cube_map +#define GL_SGIX_cube_map 1 + +#define GL_ENV_MAP_SGIX 0x8340 +#define GL_CUBE_MAP_SGIX 0x8341 +#define GL_CUBE_MAP_ZP_SGIX 0x8342 +#define GL_CUBE_MAP_ZN_SGIX 0x8343 +#define GL_CUBE_MAP_XN_SGIX 0x8344 +#define GL_CUBE_MAP_XP_SGIX 0x8345 +#define GL_CUBE_MAP_YN_SGIX 0x8346 +#define GL_CUBE_MAP_YP_SGIX 0x8347 +#define GL_CUBE_MAP_BINDING_SGIX 0x8348 + +#define GLEW_SGIX_cube_map GLEW_GET_VAR(__GLEW_SGIX_cube_map) + +#endif /* GL_SGIX_cube_map */ + +/* ------------------------ GL_SGIX_cylinder_texgen ------------------------ */ + +#ifndef GL_SGIX_cylinder_texgen +#define GL_SGIX_cylinder_texgen 1 + +#define GLEW_SGIX_cylinder_texgen GLEW_GET_VAR(__GLEW_SGIX_cylinder_texgen) + +#endif /* GL_SGIX_cylinder_texgen */ + +/* ---------------------------- GL_SGIX_datapipe --------------------------- */ + +#ifndef GL_SGIX_datapipe +#define GL_SGIX_datapipe 1 + +#define GL_GEOMETRY_BIT 0x1 +#define GL_IMAGE_BIT 0x2 + +typedef void (GLAPIENTRY * PFNGLADDRESSSPACEPROC) (GLenum space, GLbitfield mask); +typedef GLint (GLAPIENTRY * PFNGLDATAPIPEPROC) (GLenum space); + +#define glAddressSpace GLEW_GET_FUN(__glewAddressSpace) +#define glDataPipe GLEW_GET_FUN(__glewDataPipe) + +#define GLEW_SGIX_datapipe GLEW_GET_VAR(__GLEW_SGIX_datapipe) + +#endif /* GL_SGIX_datapipe */ + +/* --------------------------- GL_SGIX_decimation -------------------------- */ + +#ifndef GL_SGIX_decimation +#define GL_SGIX_decimation 1 + +#define GLEW_SGIX_decimation GLEW_GET_VAR(__GLEW_SGIX_decimation) + +#endif /* GL_SGIX_decimation */ + +/* --------------------- GL_SGIX_depth_pass_instrument --------------------- */ + +#ifndef GL_SGIX_depth_pass_instrument +#define GL_SGIX_depth_pass_instrument 1 + +#define GL_DEPTH_PASS_INSTRUMENT_SGIX 0x8310 +#define GL_DEPTH_PASS_INSTRUMENT_COUNTERS_SGIX 0x8311 +#define GL_DEPTH_PASS_INSTRUMENT_MAX_SGIX 0x8312 + +#define GLEW_SGIX_depth_pass_instrument GLEW_GET_VAR(__GLEW_SGIX_depth_pass_instrument) + +#endif /* GL_SGIX_depth_pass_instrument */ + /* ------------------------- GL_SGIX_depth_texture ------------------------- */ #ifndef GL_SGIX_depth_texture @@ -15703,6 +18595,15 @@ typedef GLint (GLAPIENTRY * PFNGLPOLLASYNCSGIXPROC) (GLuint* markerp); #endif /* GL_SGIX_depth_texture */ +/* ------------------------------ GL_SGIX_dvc ------------------------------ */ + +#ifndef GL_SGIX_dvc +#define GL_SGIX_dvc 1 + +#define GLEW_SGIX_dvc GLEW_GET_VAR(__GLEW_SGIX_dvc) + +#endif /* GL_SGIX_dvc */ + /* -------------------------- GL_SGIX_flush_raster ------------------------- */ #ifndef GL_SGIX_flush_raster @@ -15716,6 +18617,49 @@ typedef void (GLAPIENTRY * PFNGLFLUSHRASTERSGIXPROC) (void); #endif /* GL_SGIX_flush_raster */ +/* --------------------------- GL_SGIX_fog_blend --------------------------- */ + +#ifndef GL_SGIX_fog_blend +#define GL_SGIX_fog_blend 1 + +#define GL_FOG_BLEND_ALPHA_SGIX 0x81FE +#define GL_FOG_BLEND_COLOR_SGIX 0x81FF + +#define GLEW_SGIX_fog_blend GLEW_GET_VAR(__GLEW_SGIX_fog_blend) + +#endif /* GL_SGIX_fog_blend */ + +/* ---------------------- GL_SGIX_fog_factor_to_alpha ---------------------- */ + +#ifndef GL_SGIX_fog_factor_to_alpha +#define GL_SGIX_fog_factor_to_alpha 1 + +#define GLEW_SGIX_fog_factor_to_alpha GLEW_GET_VAR(__GLEW_SGIX_fog_factor_to_alpha) + +#endif /* GL_SGIX_fog_factor_to_alpha */ + +/* --------------------------- GL_SGIX_fog_layers -------------------------- */ + +#ifndef GL_SGIX_fog_layers +#define GL_SGIX_fog_layers 1 + +#define GL_FOG_TYPE_SGIX 0x8323 +#define GL_UNIFORM_SGIX 0x8324 +#define GL_LAYERED_SGIX 0x8325 +#define GL_FOG_GROUND_PLANE_SGIX 0x8326 +#define GL_FOG_LAYERS_POINTS_SGIX 0x8327 +#define GL_MAX_FOG_LAYERS_POINTS_SGIX 0x8328 + +typedef void (GLAPIENTRY * PFNGLFOGLAYERSSGIXPROC) (GLsizei n, const GLfloat* points); +typedef void (GLAPIENTRY * PFNGLGETFOGLAYERSSGIXPROC) (GLfloat* points); + +#define glFogLayersSGIX GLEW_GET_FUN(__glewFogLayersSGIX) +#define glGetFogLayersSGIX GLEW_GET_FUN(__glewGetFogLayersSGIX) + +#define GLEW_SGIX_fog_layers GLEW_GET_VAR(__GLEW_SGIX_fog_layers) + +#endif /* GL_SGIX_fog_layers */ + /* --------------------------- GL_SGIX_fog_offset -------------------------- */ #ifndef GL_SGIX_fog_offset @@ -15728,15 +18672,32 @@ typedef void (GLAPIENTRY * PFNGLFLUSHRASTERSGIXPROC) (void); #endif /* GL_SGIX_fog_offset */ +/* --------------------------- GL_SGIX_fog_patchy -------------------------- */ + +#ifndef GL_SGIX_fog_patchy +#define GL_SGIX_fog_patchy 1 + +#define GLEW_SGIX_fog_patchy GLEW_GET_VAR(__GLEW_SGIX_fog_patchy) + +#endif /* GL_SGIX_fog_patchy */ + +/* --------------------------- GL_SGIX_fog_scale --------------------------- */ + +#ifndef GL_SGIX_fog_scale +#define GL_SGIX_fog_scale 1 + +#define GL_FOG_SCALE_SGIX 0x81FC +#define GL_FOG_SCALE_VALUE_SGIX 0x81FD + +#define GLEW_SGIX_fog_scale GLEW_GET_VAR(__GLEW_SGIX_fog_scale) + +#endif /* GL_SGIX_fog_scale */ + /* -------------------------- GL_SGIX_fog_texture -------------------------- */ #ifndef GL_SGIX_fog_texture #define GL_SGIX_fog_texture 1 -#define GL_FOG_PATCHY_FACTOR_SGIX 0 -#define GL_FRAGMENT_FOG_SGIX 0 -#define GL_TEXTURE_FOG_SGIX 0 - typedef void (GLAPIENTRY * PFNGLTEXTUREFOGSGIXPROC) (GLenum pname); #define glTextureFogSGIX GLEW_GET_FUN(__glewTextureFogSGIX) @@ -15745,6 +18706,20 @@ typedef void (GLAPIENTRY * PFNGLTEXTUREFOGSGIXPROC) (GLenum pname); #endif /* GL_SGIX_fog_texture */ +/* -------------------- GL_SGIX_fragment_lighting_space -------------------- */ + +#ifndef GL_SGIX_fragment_lighting_space +#define GL_SGIX_fragment_lighting_space 1 + +#define GL_EYE_SPACE_SGIX 0x8436 +#define GL_TANGENT_SPACE_SGIX 0x8437 +#define GL_OBJECT_SPACE_SGIX 0x8438 +#define GL_FRAGMENT_LIGHT_SPACE_SGIX 0x843D + +#define GLEW_SGIX_fragment_lighting_space GLEW_GET_VAR(__GLEW_SGIX_fragment_lighting_space) + +#endif /* GL_SGIX_fragment_lighting_space */ + /* ------------------- GL_SGIX_fragment_specular_lighting ------------------ */ #ifndef GL_SGIX_fragment_specular_lighting @@ -15790,6 +18765,19 @@ typedef void (GLAPIENTRY * PFNGLGETFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLe #endif /* GL_SGIX_fragment_specular_lighting */ +/* ---------------------- GL_SGIX_fragments_instrument --------------------- */ + +#ifndef GL_SGIX_fragments_instrument +#define GL_SGIX_fragments_instrument 1 + +#define GL_FRAGMENTS_INSTRUMENT_SGIX 0x8313 +#define GL_FRAGMENTS_INSTRUMENT_COUNTERS_SGIX 0x8314 +#define GL_FRAGMENTS_INSTRUMENT_MAX_SGIX 0x8315 + +#define GLEW_SGIX_fragments_instrument GLEW_GET_VAR(__GLEW_SGIX_fragments_instrument) + +#endif /* GL_SGIX_fragments_instrument */ + /* --------------------------- GL_SGIX_framezoom --------------------------- */ #ifndef GL_SGIX_framezoom @@ -15803,6 +18791,77 @@ typedef void (GLAPIENTRY * PFNGLFRAMEZOOMSGIXPROC) (GLint factor); #endif /* GL_SGIX_framezoom */ +/* -------------------------- GL_SGIX_icc_texture -------------------------- */ + +#ifndef GL_SGIX_icc_texture +#define GL_SGIX_icc_texture 1 + +#define GL_RGB_ICC_SGIX 0x8460 +#define GL_RGBA_ICC_SGIX 0x8461 +#define GL_ALPHA_ICC_SGIX 0x8462 +#define GL_LUMINANCE_ICC_SGIX 0x8463 +#define GL_INTENSITY_ICC_SGIX 0x8464 +#define GL_LUMINANCE_ALPHA_ICC_SGIX 0x8465 +#define GL_R5_G6_B5_ICC_SGIX 0x8466 +#define GL_R5_G6_B5_A8_ICC_SGIX 0x8467 +#define GL_ALPHA16_ICC_SGIX 0x8468 +#define GL_LUMINANCE16_ICC_SGIX 0x8469 +#define GL_INTENSITY16_ICC_SGIX 0x846A +#define GL_LUMINANCE16_ALPHA8_ICC_SGIX 0x846B + +#define GLEW_SGIX_icc_texture GLEW_GET_VAR(__GLEW_SGIX_icc_texture) + +#endif /* GL_SGIX_icc_texture */ + +/* ------------------------ GL_SGIX_igloo_interface ------------------------ */ + +#ifndef GL_SGIX_igloo_interface +#define GL_SGIX_igloo_interface 1 + +#define GL_IGLOO_FULLSCREEN_SGIX 0x819E +#define GL_IGLOO_VIEWPORT_OFFSET_SGIX 0x819F +#define GL_IGLOO_SWAPTMESH_SGIX 0x81A0 +#define GL_IGLOO_COLORNORMAL_SGIX 0x81A1 +#define GL_IGLOO_IRISGL_MODE_SGIX 0x81A2 +#define GL_IGLOO_LMC_COLOR_SGIX 0x81A3 +#define GL_IGLOO_TMESHMODE_SGIX 0x81A4 +#define GL_LIGHT31 0xBEAD + +typedef void (GLAPIENTRY * PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, void *param); + +#define glIglooInterfaceSGIX GLEW_GET_FUN(__glewIglooInterfaceSGIX) + +#define GLEW_SGIX_igloo_interface GLEW_GET_VAR(__GLEW_SGIX_igloo_interface) + +#endif /* GL_SGIX_igloo_interface */ + +/* ----------------------- GL_SGIX_image_compression ----------------------- */ + +#ifndef GL_SGIX_image_compression +#define GL_SGIX_image_compression 1 + +#define GLEW_SGIX_image_compression GLEW_GET_VAR(__GLEW_SGIX_image_compression) + +#endif /* GL_SGIX_image_compression */ + +/* ---------------------- GL_SGIX_impact_pixel_texture --------------------- */ + +#ifndef GL_SGIX_impact_pixel_texture +#define GL_SGIX_impact_pixel_texture 1 + +#define GLEW_SGIX_impact_pixel_texture GLEW_GET_VAR(__GLEW_SGIX_impact_pixel_texture) + +#endif /* GL_SGIX_impact_pixel_texture */ + +/* ------------------------ GL_SGIX_instrument_error ----------------------- */ + +#ifndef GL_SGIX_instrument_error +#define GL_SGIX_instrument_error 1 + +#define GLEW_SGIX_instrument_error GLEW_GET_VAR(__GLEW_SGIX_instrument_error) + +#endif /* GL_SGIX_instrument_error */ + /* --------------------------- GL_SGIX_interlace --------------------------- */ #ifndef GL_SGIX_interlace @@ -15823,6 +18882,17 @@ typedef void (GLAPIENTRY * PFNGLFRAMEZOOMSGIXPROC) (GLint factor); #endif /* GL_SGIX_ir_instrument1 */ +/* ----------------------- GL_SGIX_line_quality_hint ----------------------- */ + +#ifndef GL_SGIX_line_quality_hint +#define GL_SGIX_line_quality_hint 1 + +#define GL_LINE_QUALITY_HINT_SGIX 0x835B + +#define GLEW_SGIX_line_quality_hint GLEW_GET_VAR(__GLEW_SGIX_line_quality_hint) + +#endif /* GL_SGIX_line_quality_hint */ + /* ------------------------- GL_SGIX_list_priority ------------------------- */ #ifndef GL_SGIX_list_priority @@ -15832,6 +18902,117 @@ typedef void (GLAPIENTRY * PFNGLFRAMEZOOMSGIXPROC) (GLint factor); #endif /* GL_SGIX_list_priority */ +/* ----------------------------- GL_SGIX_mpeg1 ----------------------------- */ + +#ifndef GL_SGIX_mpeg1 +#define GL_SGIX_mpeg1 1 + +typedef void (GLAPIENTRY * PFNGLALLOCMPEGPREDICTORSSGIXPROC) (GLsizei width, GLsizei height, GLsizei n, GLuint* predictors); +typedef void (GLAPIENTRY * PFNGLDELETEMPEGPREDICTORSSGIXPROC) (GLsizei n, GLuint* predictors); +typedef void (GLAPIENTRY * PFNGLGENMPEGPREDICTORSSGIXPROC) (GLsizei n, GLuint* predictors); +typedef void (GLAPIENTRY * PFNGLGETMPEGPARAMETERFVSGIXPROC) (GLenum target, GLenum pname, GLfloat* params); +typedef void (GLAPIENTRY * PFNGLGETMPEGPARAMETERIVSGIXPROC) (GLenum target, GLenum pname, GLint* params); +typedef void (GLAPIENTRY * PFNGLGETMPEGPREDICTORSGIXPROC) (GLenum target, GLenum format, GLenum type, void *pixels); +typedef void (GLAPIENTRY * PFNGLGETMPEGQUANTTABLEUBVPROC) (GLenum target, GLubyte* values); +typedef GLboolean (GLAPIENTRY * PFNGLISMPEGPREDICTORSGIXPROC) (GLuint predictor); +typedef void (GLAPIENTRY * PFNGLMPEGPREDICTORSGIXPROC) (GLenum target, GLenum format, GLenum type, void *pixels); +typedef void (GLAPIENTRY * PFNGLMPEGQUANTTABLEUBVPROC) (GLenum target, GLubyte* values); +typedef void (GLAPIENTRY * PFNGLSWAPMPEGPREDICTORSSGIXPROC) (GLenum target0, GLenum target1); + +#define glAllocMPEGPredictorsSGIX GLEW_GET_FUN(__glewAllocMPEGPredictorsSGIX) +#define glDeleteMPEGPredictorsSGIX GLEW_GET_FUN(__glewDeleteMPEGPredictorsSGIX) +#define glGenMPEGPredictorsSGIX GLEW_GET_FUN(__glewGenMPEGPredictorsSGIX) +#define glGetMPEGParameterfvSGIX GLEW_GET_FUN(__glewGetMPEGParameterfvSGIX) +#define glGetMPEGParameterivSGIX GLEW_GET_FUN(__glewGetMPEGParameterivSGIX) +#define glGetMPEGPredictorSGIX GLEW_GET_FUN(__glewGetMPEGPredictorSGIX) +#define glGetMPEGQuantTableubv GLEW_GET_FUN(__glewGetMPEGQuantTableubv) +#define glIsMPEGPredictorSGIX GLEW_GET_FUN(__glewIsMPEGPredictorSGIX) +#define glMPEGPredictorSGIX GLEW_GET_FUN(__glewMPEGPredictorSGIX) +#define glMPEGQuantTableubv GLEW_GET_FUN(__glewMPEGQuantTableubv) +#define glSwapMPEGPredictorsSGIX GLEW_GET_FUN(__glewSwapMPEGPredictorsSGIX) + +#define GLEW_SGIX_mpeg1 GLEW_GET_VAR(__GLEW_SGIX_mpeg1) + +#endif /* GL_SGIX_mpeg1 */ + +/* ----------------------------- GL_SGIX_mpeg2 ----------------------------- */ + +#ifndef GL_SGIX_mpeg2 +#define GL_SGIX_mpeg2 1 + +#define GLEW_SGIX_mpeg2 GLEW_GET_VAR(__GLEW_SGIX_mpeg2) + +#endif /* GL_SGIX_mpeg2 */ + +/* ------------------ GL_SGIX_nonlinear_lighting_pervertex ----------------- */ + +#ifndef GL_SGIX_nonlinear_lighting_pervertex +#define GL_SGIX_nonlinear_lighting_pervertex 1 + +typedef void (GLAPIENTRY * PFNGLGETNONLINLIGHTFVSGIXPROC) (GLenum light, GLenum pname, GLint* terms, GLfloat *data); +typedef void (GLAPIENTRY * PFNGLGETNONLINMATERIALFVSGIXPROC) (GLenum face, GLenum pname, GLint* terms, const GLfloat *data); +typedef void (GLAPIENTRY * PFNGLNONLINLIGHTFVSGIXPROC) (GLenum light, GLenum pname, GLint terms, GLfloat* params); +typedef void (GLAPIENTRY * PFNGLNONLINMATERIALFVSGIXPROC) (GLenum face, GLenum pname, GLint terms, const GLfloat* params); + +#define glGetNonlinLightfvSGIX GLEW_GET_FUN(__glewGetNonlinLightfvSGIX) +#define glGetNonlinMaterialfvSGIX GLEW_GET_FUN(__glewGetNonlinMaterialfvSGIX) +#define glNonlinLightfvSGIX GLEW_GET_FUN(__glewNonlinLightfvSGIX) +#define glNonlinMaterialfvSGIX GLEW_GET_FUN(__glewNonlinMaterialfvSGIX) + +#define GLEW_SGIX_nonlinear_lighting_pervertex GLEW_GET_VAR(__GLEW_SGIX_nonlinear_lighting_pervertex) + +#endif /* GL_SGIX_nonlinear_lighting_pervertex */ + +/* --------------------------- GL_SGIX_nurbs_eval -------------------------- */ + +#ifndef GL_SGIX_nurbs_eval +#define GL_SGIX_nurbs_eval 1 + +#define GL_MAP1_VERTEX_3_NURBS_SGIX 0x81CB +#define GL_MAP1_VERTEX_4_NURBS_SGIX 0x81CC +#define GL_MAP1_INDEX_NURBS_SGIX 0x81CD +#define GL_MAP1_COLOR_4_NURBS_SGIX 0x81CE +#define GL_MAP1_NORMAL_NURBS_SGIX 0x81CF +#define GL_MAP1_TEXTURE_COORD_1_NURBS_SGIX 0x81E0 +#define GL_MAP1_TEXTURE_COORD_2_NURBS_SGIX 0x81E1 +#define GL_MAP1_TEXTURE_COORD_3_NURBS_SGIX 0x81E2 +#define GL_MAP1_TEXTURE_COORD_4_NURBS_SGIX 0x81E3 +#define GL_MAP2_VERTEX_3_NURBS_SGIX 0x81E4 +#define GL_MAP2_VERTEX_4_NURBS_SGIX 0x81E5 +#define GL_MAP2_INDEX_NURBS_SGIX 0x81E6 +#define GL_MAP2_COLOR_4_NURBS_SGIX 0x81E7 +#define GL_MAP2_NORMAL_NURBS_SGIX 0x81E8 +#define GL_MAP2_TEXTURE_COORD_1_NURBS_SGIX 0x81E9 +#define GL_MAP2_TEXTURE_COORD_2_NURBS_SGIX 0x81EA +#define GL_MAP2_TEXTURE_COORD_3_NURBS_SGIX 0x81EB +#define GL_MAP2_TEXTURE_COORD_4_NURBS_SGIX 0x81EC +#define GL_NURBS_KNOT_COUNT_SGIX 0x81ED +#define GL_NURBS_KNOT_VECTOR_SGIX 0x81EE + +#define GLEW_SGIX_nurbs_eval GLEW_GET_VAR(__GLEW_SGIX_nurbs_eval) + +#endif /* GL_SGIX_nurbs_eval */ + +/* ---------------------- GL_SGIX_occlusion_instrument --------------------- */ + +#ifndef GL_SGIX_occlusion_instrument +#define GL_SGIX_occlusion_instrument 1 + +#define GL_OCCLUSION_INSTRUMENT_SGIX 0x6060 + +#define GLEW_SGIX_occlusion_instrument GLEW_GET_VAR(__GLEW_SGIX_occlusion_instrument) + +#endif /* GL_SGIX_occlusion_instrument */ + +/* ------------------------- GL_SGIX_packed_6bytes ------------------------- */ + +#ifndef GL_SGIX_packed_6bytes +#define GL_SGIX_packed_6bytes 1 + +#define GLEW_SGIX_packed_6bytes GLEW_GET_VAR(__GLEW_SGIX_packed_6bytes) + +#endif /* GL_SGIX_packed_6bytes */ + /* ------------------------- GL_SGIX_pixel_texture ------------------------- */ #ifndef GL_SGIX_pixel_texture @@ -15854,6 +19035,57 @@ typedef void (GLAPIENTRY * PFNGLPIXELTEXGENSGIXPROC) (GLenum mode); #endif /* GL_SGIX_pixel_texture_bits */ +/* ----------------------- GL_SGIX_pixel_texture_lod ----------------------- */ + +#ifndef GL_SGIX_pixel_texture_lod +#define GL_SGIX_pixel_texture_lod 1 + +#define GLEW_SGIX_pixel_texture_lod GLEW_GET_VAR(__GLEW_SGIX_pixel_texture_lod) + +#endif /* GL_SGIX_pixel_texture_lod */ + +/* -------------------------- GL_SGIX_pixel_tiles -------------------------- */ + +#ifndef GL_SGIX_pixel_tiles +#define GL_SGIX_pixel_tiles 1 + +#define GLEW_SGIX_pixel_tiles GLEW_GET_VAR(__GLEW_SGIX_pixel_tiles) + +#endif /* GL_SGIX_pixel_tiles */ + +/* ------------------------- GL_SGIX_polynomial_ffd ------------------------ */ + +#ifndef GL_SGIX_polynomial_ffd +#define GL_SGIX_polynomial_ffd 1 + +#define GL_TEXTURE_DEFORMATION_BIT_SGIX 0x1 +#define GL_GEOMETRY_DEFORMATION_BIT_SGIX 0x2 + +typedef void (GLAPIENTRY * PFNGLDEFORMSGIXPROC) (GLbitfield mask); +typedef void (GLAPIENTRY * PFNGLLOADIDENTITYDEFORMATIONMAPSGIXPROC) (GLbitfield mask); + +#define glDeformSGIX GLEW_GET_FUN(__glewDeformSGIX) +#define glLoadIdentityDeformationMapSGIX GLEW_GET_FUN(__glewLoadIdentityDeformationMapSGIX) + +#define GLEW_SGIX_polynomial_ffd GLEW_GET_VAR(__GLEW_SGIX_polynomial_ffd) + +#endif /* GL_SGIX_polynomial_ffd */ + +/* --------------------------- GL_SGIX_quad_mesh --------------------------- */ + +#ifndef GL_SGIX_quad_mesh +#define GL_SGIX_quad_mesh 1 + +typedef void (GLAPIENTRY * PFNGLMESHBREADTHSGIXPROC) (GLint breadth); +typedef void (GLAPIENTRY * PFNGLMESHSTRIDESGIXPROC) (GLint stride); + +#define glMeshBreadthSGIX GLEW_GET_FUN(__glewMeshBreadthSGIX) +#define glMeshStrideSGIX GLEW_GET_FUN(__glewMeshStrideSGIX) + +#define GLEW_SGIX_quad_mesh GLEW_GET_VAR(__GLEW_SGIX_quad_mesh) + +#endif /* GL_SGIX_quad_mesh */ + /* ------------------------ GL_SGIX_reference_plane ------------------------ */ #ifndef GL_SGIX_reference_plane @@ -15882,6 +19114,17 @@ typedef void (GLAPIENTRY * PFNGLREFERENCEPLANESGIXPROC) (const GLdouble* equatio #endif /* GL_SGIX_resample */ +/* ------------------------- GL_SGIX_scalebias_hint ------------------------ */ + +#ifndef GL_SGIX_scalebias_hint +#define GL_SGIX_scalebias_hint 1 + +#define GL_SCALEBIAS_HINT_SGIX 0x8322 + +#define GLEW_SGIX_scalebias_hint GLEW_GET_VAR(__GLEW_SGIX_scalebias_hint) + +#endif /* GL_SGIX_scalebias_hint */ + /* ----------------------------- GL_SGIX_shadow ---------------------------- */ #ifndef GL_SGIX_shadow @@ -15907,6 +19150,31 @@ typedef void (GLAPIENTRY * PFNGLREFERENCEPLANESGIXPROC) (const GLdouble* equatio #endif /* GL_SGIX_shadow_ambient */ +/* ------------------------------ GL_SGIX_slim ----------------------------- */ + +#ifndef GL_SGIX_slim +#define GL_SGIX_slim 1 + +#define GL_PACK_MAX_COMPRESSED_SIZE_SGIX 0x831B +#define GL_SLIM8U_SGIX 0x831D +#define GL_SLIM10U_SGIX 0x831E +#define GL_SLIM12S_SGIX 0x831F + +#define GLEW_SGIX_slim GLEW_GET_VAR(__GLEW_SGIX_slim) + +#endif /* GL_SGIX_slim */ + +/* ------------------------ GL_SGIX_spotlight_cutoff ----------------------- */ + +#ifndef GL_SGIX_spotlight_cutoff +#define GL_SGIX_spotlight_cutoff 1 + +#define GL_SPOT_CUTOFF_DELTA_SGIX 0x8193 + +#define GLEW_SGIX_spotlight_cutoff GLEW_GET_VAR(__GLEW_SGIX_spotlight_cutoff) + +#endif /* GL_SGIX_spotlight_cutoff */ + /* ----------------------------- GL_SGIX_sprite ---------------------------- */ #ifndef GL_SGIX_sprite @@ -15926,6 +19194,30 @@ typedef void (GLAPIENTRY * PFNGLSPRITEPARAMETERIVSGIXPROC) (GLenum pname, GLint* #endif /* GL_SGIX_sprite */ +/* -------------------------- GL_SGIX_subdiv_patch ------------------------- */ + +#ifndef GL_SGIX_subdiv_patch +#define GL_SGIX_subdiv_patch 1 + +#define GLEW_SGIX_subdiv_patch GLEW_GET_VAR(__GLEW_SGIX_subdiv_patch) + +#endif /* GL_SGIX_subdiv_patch */ + +/* --------------------------- GL_SGIX_subsample --------------------------- */ + +#ifndef GL_SGIX_subsample +#define GL_SGIX_subsample 1 + +#define GL_PACK_SUBSAMPLE_RATE_SGIX 0x85A0 +#define GL_UNPACK_SUBSAMPLE_RATE_SGIX 0x85A1 +#define GL_PIXEL_SUBSAMPLE_4444_SGIX 0x85A2 +#define GL_PIXEL_SUBSAMPLE_2424_SGIX 0x85A3 +#define GL_PIXEL_SUBSAMPLE_4242_SGIX 0x85A4 + +#define GLEW_SGIX_subsample GLEW_GET_VAR(__GLEW_SGIX_subsample) + +#endif /* GL_SGIX_subsample */ + /* ----------------------- GL_SGIX_tag_sample_buffer ----------------------- */ #ifndef GL_SGIX_tag_sample_buffer @@ -15970,6 +19262,18 @@ typedef void (GLAPIENTRY * PFNGLTAGSAMPLEBUFFERSGIXPROC) (void); #endif /* GL_SGIX_texture_lod_bias */ +/* ------------------- GL_SGIX_texture_mipmap_anisotropic ------------------ */ + +#ifndef GL_SGIX_texture_mipmap_anisotropic +#define GL_SGIX_texture_mipmap_anisotropic 1 + +#define GL_TEXTURE_MIPMAP_ANISOTROPY_SGIX 0x832E +#define GL_MAX_MIPMAP_ANISOTROPY_SGIX 0x832F + +#define GLEW_SGIX_texture_mipmap_anisotropic GLEW_GET_VAR(__GLEW_SGIX_texture_mipmap_anisotropic) + +#endif /* GL_SGIX_texture_mipmap_anisotropic */ + /* ---------------------- GL_SGIX_texture_multi_buffer --------------------- */ #ifndef GL_SGIX_texture_multi_buffer @@ -15981,6 +19285,17 @@ typedef void (GLAPIENTRY * PFNGLTAGSAMPLEBUFFERSGIXPROC) (void); #endif /* GL_SGIX_texture_multi_buffer */ +/* ------------------------- GL_SGIX_texture_phase ------------------------- */ + +#ifndef GL_SGIX_texture_phase +#define GL_SGIX_texture_phase 1 + +#define GL_PHASE_SGIX 0x832A + +#define GLEW_SGIX_texture_phase GLEW_GET_VAR(__GLEW_SGIX_texture_phase) + +#endif /* GL_SGIX_texture_phase */ + /* ------------------------- GL_SGIX_texture_range ------------------------- */ #ifndef GL_SGIX_texture_range @@ -16033,6 +19348,53 @@ typedef void (GLAPIENTRY * PFNGLTAGSAMPLEBUFFERSGIXPROC) (void); #endif /* GL_SGIX_texture_scale_bias */ +/* ---------------------- GL_SGIX_texture_supersample ---------------------- */ + +#ifndef GL_SGIX_texture_supersample +#define GL_SGIX_texture_supersample 1 + +#define GLEW_SGIX_texture_supersample GLEW_GET_VAR(__GLEW_SGIX_texture_supersample) + +#endif /* GL_SGIX_texture_supersample */ + +/* --------------------------- GL_SGIX_vector_ops -------------------------- */ + +#ifndef GL_SGIX_vector_ops +#define GL_SGIX_vector_ops 1 + +typedef void (GLAPIENTRY * PFNGLGETVECTOROPERATIONSGIXPROC) (GLenum operation); +typedef void (GLAPIENTRY * PFNGLVECTOROPERATIONSGIXPROC) (GLenum operation); + +#define glGetVectorOperationSGIX GLEW_GET_FUN(__glewGetVectorOperationSGIX) +#define glVectorOperationSGIX GLEW_GET_FUN(__glewVectorOperationSGIX) + +#define GLEW_SGIX_vector_ops GLEW_GET_VAR(__GLEW_SGIX_vector_ops) + +#endif /* GL_SGIX_vector_ops */ + +/* ---------------------- GL_SGIX_vertex_array_object ---------------------- */ + +#ifndef GL_SGIX_vertex_array_object +#define GL_SGIX_vertex_array_object 1 + +typedef GLboolean (GLAPIENTRY * PFNGLAREVERTEXARRAYSRESIDENTSGIXPROC) (GLsizei n, const GLuint* arrays, GLboolean* residences); +typedef void (GLAPIENTRY * PFNGLBINDVERTEXARRAYSGIXPROC) (GLuint array); +typedef void (GLAPIENTRY * PFNGLDELETEVERTEXARRAYSSGIXPROC) (GLsizei n, const GLuint* arrays); +typedef void (GLAPIENTRY * PFNGLGENVERTEXARRAYSSGIXPROC) (GLsizei n, GLuint* arrays); +typedef GLboolean (GLAPIENTRY * PFNGLISVERTEXARRAYSGIXPROC) (GLuint array); +typedef void (GLAPIENTRY * PFNGLPRIORITIZEVERTEXARRAYSSGIXPROC) (GLsizei n, const GLuint* arrays, const GLclampf* priorities); + +#define glAreVertexArraysResidentSGIX GLEW_GET_FUN(__glewAreVertexArraysResidentSGIX) +#define glBindVertexArraySGIX GLEW_GET_FUN(__glewBindVertexArraySGIX) +#define glDeleteVertexArraysSGIX GLEW_GET_FUN(__glewDeleteVertexArraysSGIX) +#define glGenVertexArraysSGIX GLEW_GET_FUN(__glewGenVertexArraysSGIX) +#define glIsVertexArraySGIX GLEW_GET_FUN(__glewIsVertexArraySGIX) +#define glPrioritizeVertexArraysSGIX GLEW_GET_FUN(__glewPrioritizeVertexArraysSGIX) + +#define GLEW_SGIX_vertex_array_object GLEW_GET_VAR(__GLEW_SGIX_vertex_array_object) + +#endif /* GL_SGIX_vertex_array_object */ + /* ------------------------- GL_SGIX_vertex_preclip ------------------------ */ #ifndef GL_SGIX_vertex_preclip @@ -16066,6 +19428,27 @@ typedef void (GLAPIENTRY * PFNGLTAGSAMPLEBUFFERSGIXPROC) (void); #endif /* GL_SGIX_ycrcb */ +/* ------------------------ GL_SGIX_ycrcb_subsample ------------------------ */ + +#ifndef GL_SGIX_ycrcb_subsample +#define GL_SGIX_ycrcb_subsample 1 + +#define GLEW_SGIX_ycrcb_subsample GLEW_GET_VAR(__GLEW_SGIX_ycrcb_subsample) + +#endif /* GL_SGIX_ycrcb_subsample */ + +/* ----------------------------- GL_SGIX_ycrcba ---------------------------- */ + +#ifndef GL_SGIX_ycrcba +#define GL_SGIX_ycrcba 1 + +#define GL_YCRCB_SGIX 0x8318 +#define GL_YCRCBA_SGIX 0x8319 + +#define GLEW_SGIX_ycrcba GLEW_GET_VAR(__GLEW_SGIX_ycrcba) + +#endif /* GL_SGIX_ycrcba */ + /* -------------------------- GL_SGI_color_matrix -------------------------- */ #ifndef GL_SGI_color_matrix @@ -16129,6 +19512,63 @@ typedef void (GLAPIENTRY * PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum for #endif /* GL_SGI_color_table */ +/* ----------------------------- GL_SGI_complex ---------------------------- */ + +#ifndef GL_SGI_complex +#define GL_SGI_complex 1 + +#define GLEW_SGI_complex GLEW_GET_VAR(__GLEW_SGI_complex) + +#endif /* GL_SGI_complex */ + +/* -------------------------- GL_SGI_complex_type -------------------------- */ + +#ifndef GL_SGI_complex_type +#define GL_SGI_complex_type 1 + +#define GL_COMPLEX_UNSIGNED_BYTE_SGI 0x81BD +#define GL_COMPLEX_BYTE_SGI 0x81BE +#define GL_COMPLEX_UNSIGNED_SHORT_SGI 0x81BF +#define GL_COMPLEX_SHORT_SGI 0x81C0 +#define GL_COMPLEX_UNSIGNED_INT_SGI 0x81C1 +#define GL_COMPLEX_INT_SGI 0x81C2 +#define GL_COMPLEX_FLOAT_SGI 0x81C3 + +#define GLEW_SGI_complex_type GLEW_GET_VAR(__GLEW_SGI_complex_type) + +#endif /* GL_SGI_complex_type */ + +/* ------------------------------- GL_SGI_fft ------------------------------ */ + +#ifndef GL_SGI_fft +#define GL_SGI_fft 1 + +#define GL_PIXEL_TRANSFORM_OPERATOR_SGI 0x81C4 +#define GL_CONVOLUTION_SGI 0x81C5 +#define GL_FFT_1D_SGI 0x81C6 +#define GL_PIXEL_TRANSFORM_SGI 0x81C7 +#define GL_MAX_FFT_WIDTH_SGI 0x81C8 + +typedef void (GLAPIENTRY * PFNGLGETPIXELTRANSFORMPARAMETERFVSGIPROC) (GLenum target, GLenum pname, GLfloat* params); +typedef void (GLAPIENTRY * PFNGLGETPIXELTRANSFORMPARAMETERIVSGIPROC) (GLenum target, GLenum pname, GLint* params); +typedef void (GLAPIENTRY * PFNGLPIXELTRANSFORMPARAMETERFSGIPROC) (GLenum target, GLenum pname, GLfloat param); +typedef void (GLAPIENTRY * PFNGLPIXELTRANSFORMPARAMETERFVSGIPROC) (GLenum target, GLenum pname, const GLfloat* params); +typedef void (GLAPIENTRY * PFNGLPIXELTRANSFORMPARAMETERISGIPROC) (GLenum target, GLenum pname, GLint param); +typedef void (GLAPIENTRY * PFNGLPIXELTRANSFORMPARAMETERIVSGIPROC) (GLenum target, GLenum pname, const GLint* params); +typedef void (GLAPIENTRY * PFNGLPIXELTRANSFORMSGIPROC) (GLenum target); + +#define glGetPixelTransformParameterfvSGI GLEW_GET_FUN(__glewGetPixelTransformParameterfvSGI) +#define glGetPixelTransformParameterivSGI GLEW_GET_FUN(__glewGetPixelTransformParameterivSGI) +#define glPixelTransformParameterfSGI GLEW_GET_FUN(__glewPixelTransformParameterfSGI) +#define glPixelTransformParameterfvSGI GLEW_GET_FUN(__glewPixelTransformParameterfvSGI) +#define glPixelTransformParameteriSGI GLEW_GET_FUN(__glewPixelTransformParameteriSGI) +#define glPixelTransformParameterivSGI GLEW_GET_FUN(__glewPixelTransformParameterivSGI) +#define glPixelTransformSGI GLEW_GET_FUN(__glewPixelTransformSGI) + +#define GLEW_SGI_fft GLEW_GET_VAR(__GLEW_SGI_fft) + +#endif /* GL_SGI_fft */ + /* ----------------------- GL_SGI_texture_color_table ---------------------- */ #ifndef GL_SGI_texture_color_table @@ -16380,6 +19820,15 @@ typedef void (GLAPIENTRY * PFNGLTEXCOORD4FVERTEX4FVSUNPROC) (const GLfloat* tc, #endif /* GL_WIN_phong_shading */ +/* ------------------------- GL_WIN_scene_markerXXX ------------------------ */ + +#ifndef GL_WIN_scene_markerXXX +#define GL_WIN_scene_markerXXX 1 + +#define GLEW_WIN_scene_markerXXX GLEW_GET_VAR(__GLEW_WIN_scene_markerXXX) + +#endif /* GL_WIN_scene_markerXXX */ + /* -------------------------- GL_WIN_specular_fog -------------------------- */ #ifndef GL_WIN_specular_fog @@ -16406,22 +19855,7 @@ typedef void (GLAPIENTRY * PFNGLADDSWAPHINTRECTWINPROC) (GLint x, GLint y, GLsiz /* ------------------------------------------------------------------------- */ -#if defined(GLEW_MX) && defined(_WIN32) -#define GLEW_FUN_EXPORT -#else -#define GLEW_FUN_EXPORT GLEWAPI -#endif /* GLEW_MX */ - -#if defined(GLEW_MX) -#define GLEW_VAR_EXPORT -#else -#define GLEW_VAR_EXPORT GLEWAPI -#endif /* GLEW_MX */ -#if defined(GLEW_MX) && defined(_WIN32) -struct GLEWContextStruct -{ -#endif /* GLEW_MX */ GLEW_FUN_EXPORT PFNGLCOPYTEXSUBIMAGE3DPROC __glewCopyTexSubImage3D; GLEW_FUN_EXPORT PFNGLDRAWRANGEELEMENTSPROC __glewDrawRangeElements; @@ -16722,6 +20156,10 @@ GLEW_FUN_EXPORT PFNGLGETNCOMPRESSEDTEXIMAGEPROC __glewGetnCompressedTexImage; GLEW_FUN_EXPORT PFNGLGETNTEXIMAGEPROC __glewGetnTexImage; GLEW_FUN_EXPORT PFNGLGETNUNIFORMDVPROC __glewGetnUniformdv; +GLEW_FUN_EXPORT PFNGLMULTIDRAWARRAYSINDIRECTCOUNTPROC __glewMultiDrawArraysIndirectCount; +GLEW_FUN_EXPORT PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTPROC __glewMultiDrawElementsIndirectCount; +GLEW_FUN_EXPORT PFNGLSPECIALIZESHADERPROC __glewSpecializeShader; + GLEW_FUN_EXPORT PFNGLTBUFFERMASK3DFXPROC __glewTbufferMask3DFX; GLEW_FUN_EXPORT PFNGLDEBUGMESSAGECALLBACKAMDPROC __glewDebugMessageCallbackAMD; @@ -16734,6 +20172,11 @@ GLEW_FUN_EXPORT PFNGLBLENDEQUATIONSEPARATEINDEXEDAMDPROC __glewBlendEquationSepa GLEW_FUN_EXPORT PFNGLBLENDFUNCINDEXEDAMDPROC __glewBlendFuncIndexedAMD; GLEW_FUN_EXPORT PFNGLBLENDFUNCSEPARATEINDEXEDAMDPROC __glewBlendFuncSeparateIndexedAMD; +GLEW_FUN_EXPORT PFNGLFRAMEBUFFERSAMPLEPOSITIONSFVAMDPROC __glewFramebufferSamplePositionsfvAMD; +GLEW_FUN_EXPORT PFNGLGETFRAMEBUFFERPARAMETERFVAMDPROC __glewGetFramebufferParameterfvAMD; +GLEW_FUN_EXPORT PFNGLGETNAMEDFRAMEBUFFERPARAMETERFVAMDPROC __glewGetNamedFramebufferParameterfvAMD; +GLEW_FUN_EXPORT PFNGLNAMEDFRAMEBUFFERSAMPLEPOSITIONSFVAMDPROC __glewNamedFramebufferSamplePositionsfvAMD; + GLEW_FUN_EXPORT PFNGLVERTEXATTRIBPARAMETERIAMDPROC __glewVertexAttribParameteriAMD; GLEW_FUN_EXPORT PFNGLMULTIDRAWARRAYSINDIRECTAMDPROC __glewMultiDrawArraysIndirectAMD; @@ -16789,6 +20232,8 @@ GLEW_FUN_EXPORT PFNGLQUERYCOUNTERANGLEPROC __glewQueryCounterANGLE; GLEW_FUN_EXPORT PFNGLGETTRANSLATEDSHADERSOURCEANGLEPROC __glewGetTranslatedShaderSourceANGLE; +GLEW_FUN_EXPORT PFNGLCOPYTEXTURELEVELSAPPLEPROC __glewCopyTextureLevelsAPPLE; + GLEW_FUN_EXPORT PFNGLDRAWELEMENTARRAYAPPLEPROC __glewDrawElementArrayAPPLE; GLEW_FUN_EXPORT PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC __glewDrawRangeElementArrayAPPLE; GLEW_FUN_EXPORT PFNGLELEMENTPOINTERAPPLEPROC __glewElementPointerAPPLE; @@ -16807,10 +20252,21 @@ GLEW_FUN_EXPORT PFNGLTESTOBJECTAPPLEPROC __glewTestObjectAPPLE; GLEW_FUN_EXPORT PFNGLBUFFERPARAMETERIAPPLEPROC __glewBufferParameteriAPPLE; GLEW_FUN_EXPORT PFNGLFLUSHMAPPEDBUFFERRANGEAPPLEPROC __glewFlushMappedBufferRangeAPPLE; +GLEW_FUN_EXPORT PFNGLRENDERBUFFERSTORAGEMULTISAMPLEAPPLEPROC __glewRenderbufferStorageMultisampleAPPLE; +GLEW_FUN_EXPORT PFNGLRESOLVEMULTISAMPLEFRAMEBUFFERAPPLEPROC __glewResolveMultisampleFramebufferAPPLE; + GLEW_FUN_EXPORT PFNGLGETOBJECTPARAMETERIVAPPLEPROC __glewGetObjectParameterivAPPLE; GLEW_FUN_EXPORT PFNGLOBJECTPURGEABLEAPPLEPROC __glewObjectPurgeableAPPLE; GLEW_FUN_EXPORT PFNGLOBJECTUNPURGEABLEAPPLEPROC __glewObjectUnpurgeableAPPLE; +GLEW_FUN_EXPORT PFNGLCLIENTWAITSYNCAPPLEPROC __glewClientWaitSyncAPPLE; +GLEW_FUN_EXPORT PFNGLDELETESYNCAPPLEPROC __glewDeleteSyncAPPLE; +GLEW_FUN_EXPORT PFNGLFENCESYNCAPPLEPROC __glewFenceSyncAPPLE; +GLEW_FUN_EXPORT PFNGLGETINTEGER64VAPPLEPROC __glewGetInteger64vAPPLE; +GLEW_FUN_EXPORT PFNGLGETSYNCIVAPPLEPROC __glewGetSyncivAPPLE; +GLEW_FUN_EXPORT PFNGLISSYNCAPPLEPROC __glewIsSyncAPPLE; +GLEW_FUN_EXPORT PFNGLWAITSYNCAPPLEPROC __glewWaitSyncAPPLE; + GLEW_FUN_EXPORT PFNGLGETTEXPARAMETERPOINTERVAPPLEPROC __glewGetTexParameterPointervAPPLE; GLEW_FUN_EXPORT PFNGLTEXTURERANGEAPPLEPROC __glewTextureRangeAPPLE; @@ -16866,7 +20322,6 @@ GLEW_FUN_EXPORT PFNGLBINDFRAGDATALOCATIONINDEXEDPROC __glewBindFragDataLocationI GLEW_FUN_EXPORT PFNGLGETFRAGDATAINDEXPROC __glewGetFragDataIndex; GLEW_FUN_EXPORT PFNGLBUFFERSTORAGEPROC __glewBufferStorage; -GLEW_FUN_EXPORT PFNGLNAMEDBUFFERSTORAGEEXTPROC __glewNamedBufferStorageEXT; GLEW_FUN_EXPORT PFNGLCREATESYNCFROMCLEVENTARBPROC __glewCreateSyncFromCLeventARB; @@ -17047,6 +20502,8 @@ GLEW_FUN_EXPORT PFNGLPROGRAMPARAMETERIPROC __glewProgramParameteri; GLEW_FUN_EXPORT PFNGLGETCOMPRESSEDTEXTURESUBIMAGEPROC __glewGetCompressedTextureSubImage; GLEW_FUN_EXPORT PFNGLGETTEXTURESUBIMAGEPROC __glewGetTextureSubImage; +GLEW_FUN_EXPORT PFNGLSPECIALIZESHADERARBPROC __glewSpecializeShaderARB; + GLEW_FUN_EXPORT PFNGLGETUNIFORMDVPROC __glewGetUniformdv; GLEW_FUN_EXPORT PFNGLUNIFORM1DPROC __glewUniform1d; GLEW_FUN_EXPORT PFNGLUNIFORM1DVPROC __glewUniform1dv; @@ -17224,6 +20681,8 @@ GLEW_FUN_EXPORT PFNGLMAXSHADERCOMPILERTHREADSARBPROC __glewMaxShaderCompilerThre GLEW_FUN_EXPORT PFNGLPOINTPARAMETERFARBPROC __glewPointParameterfARB; GLEW_FUN_EXPORT PFNGLPOINTPARAMETERFVARBPROC __glewPointParameterfvARB; +GLEW_FUN_EXPORT PFNGLPOLYGONOFFSETCLAMPPROC __glewPolygonOffsetClamp; + GLEW_FUN_EXPORT PFNGLGETPROGRAMINTERFACEIVPROC __glewGetProgramInterfaceiv; GLEW_FUN_EXPORT PFNGLGETPROGRAMRESOURCEINDEXPROC __glewGetProgramResourceIndex; GLEW_FUN_EXPORT PFNGLGETPROGRAMRESOURCELOCATIONPROC __glewGetProgramResourceLocation; @@ -17401,7 +20860,6 @@ GLEW_FUN_EXPORT PFNGLNAMEDSTRINGARBPROC __glewNamedStringARB; GLEW_FUN_EXPORT PFNGLBUFFERPAGECOMMITMENTARBPROC __glewBufferPageCommitmentARB; GLEW_FUN_EXPORT PFNGLTEXPAGECOMMITMENTARBPROC __glewTexPageCommitmentARB; -GLEW_FUN_EXPORT PFNGLTEXTUREPAGECOMMITMENTEXTPROC __glewTexturePageCommitmentEXT; GLEW_FUN_EXPORT PFNGLCLIENTWAITSYNCPROC __glewClientWaitSync; GLEW_FUN_EXPORT PFNGLDELETESYNCPROC __glewDeleteSync; @@ -17437,9 +20895,6 @@ GLEW_FUN_EXPORT PFNGLTEXIMAGE3DMULTISAMPLEPROC __glewTexImage3DMultisample; GLEW_FUN_EXPORT PFNGLTEXSTORAGE1DPROC __glewTexStorage1D; GLEW_FUN_EXPORT PFNGLTEXSTORAGE2DPROC __glewTexStorage2D; GLEW_FUN_EXPORT PFNGLTEXSTORAGE3DPROC __glewTexStorage3D; -GLEW_FUN_EXPORT PFNGLTEXTURESTORAGE1DEXTPROC __glewTextureStorage1DEXT; -GLEW_FUN_EXPORT PFNGLTEXTURESTORAGE2DEXTPROC __glewTextureStorage2DEXT; -GLEW_FUN_EXPORT PFNGLTEXTURESTORAGE3DEXTPROC __glewTextureStorage3DEXT; GLEW_FUN_EXPORT PFNGLTEXSTORAGE2DMULTISAMPLEPROC __glewTexStorage2DMultisample; GLEW_FUN_EXPORT PFNGLTEXSTORAGE3DMULTISAMPLEPROC __glewTexStorage3DMultisample; @@ -17768,6 +21223,10 @@ GLEW_FUN_EXPORT PFNGLVERTEXSTREAM4IVATIPROC __glewVertexStream4ivATI; GLEW_FUN_EXPORT PFNGLVERTEXSTREAM4SATIPROC __glewVertexStream4sATI; GLEW_FUN_EXPORT PFNGLVERTEXSTREAM4SVATIPROC __glewVertexStream4svATI; +GLEW_FUN_EXPORT PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEEXTPROC __glewDrawArraysInstancedBaseInstanceEXT; +GLEW_FUN_EXPORT PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEEXTPROC __glewDrawElementsInstancedBaseInstanceEXT; +GLEW_FUN_EXPORT PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEEXTPROC __glewDrawElementsInstancedBaseVertexBaseInstanceEXT; + GLEW_FUN_EXPORT PFNGLGETUNIFORMBUFFERSIZEEXTPROC __glewGetUniformBufferSizeEXT; GLEW_FUN_EXPORT PFNGLGETUNIFORMOFFSETEXTPROC __glewGetUniformOffsetEXT; GLEW_FUN_EXPORT PFNGLUNIFORMBUFFEREXTPROC __glewUniformBufferEXT; @@ -17776,10 +21235,20 @@ GLEW_FUN_EXPORT PFNGLBLENDCOLOREXTPROC __glewBlendColorEXT; GLEW_FUN_EXPORT PFNGLBLENDEQUATIONSEPARATEEXTPROC __glewBlendEquationSeparateEXT; +GLEW_FUN_EXPORT PFNGLBINDFRAGDATALOCATIONINDEXEDEXTPROC __glewBindFragDataLocationIndexedEXT; +GLEW_FUN_EXPORT PFNGLGETFRAGDATAINDEXEXTPROC __glewGetFragDataIndexEXT; +GLEW_FUN_EXPORT PFNGLGETPROGRAMRESOURCELOCATIONINDEXEXTPROC __glewGetProgramResourceLocationIndexEXT; + GLEW_FUN_EXPORT PFNGLBLENDFUNCSEPARATEEXTPROC __glewBlendFuncSeparateEXT; GLEW_FUN_EXPORT PFNGLBLENDEQUATIONEXTPROC __glewBlendEquationEXT; +GLEW_FUN_EXPORT PFNGLBUFFERSTORAGEEXTPROC __glewBufferStorageEXT; +GLEW_FUN_EXPORT PFNGLNAMEDBUFFERSTORAGEEXTPROC __glewNamedBufferStorageEXT; + +GLEW_FUN_EXPORT PFNGLCLEARTEXIMAGEEXTPROC __glewClearTexImageEXT; +GLEW_FUN_EXPORT PFNGLCLEARTEXSUBIMAGEEXTPROC __glewClearTexSubImageEXT; + GLEW_FUN_EXPORT PFNGLCOLORSUBTABLEEXTPROC __glewColorSubTableEXT; GLEW_FUN_EXPORT PFNGLCOPYCOLORSUBTABLEEXTPROC __glewCopyColorSubTableEXT; @@ -17803,6 +21272,8 @@ GLEW_FUN_EXPORT PFNGLSEPARABLEFILTER2DEXTPROC __glewSeparableFilter2DEXT; GLEW_FUN_EXPORT PFNGLBINORMALPOINTEREXTPROC __glewBinormalPointerEXT; GLEW_FUN_EXPORT PFNGLTANGENTPOINTEREXTPROC __glewTangentPointerEXT; +GLEW_FUN_EXPORT PFNGLCOPYIMAGESUBDATAEXTPROC __glewCopyImageSubDataEXT; + GLEW_FUN_EXPORT PFNGLCOPYTEXIMAGE1DEXTPROC __glewCopyTexImage1DEXT; GLEW_FUN_EXPORT PFNGLCOPYTEXIMAGE2DEXTPROC __glewCopyTexImage2DEXT; GLEW_FUN_EXPORT PFNGLCOPYTEXSUBIMAGE1DEXTPROC __glewCopyTexSubImage1DEXT; @@ -18036,6 +21507,10 @@ GLEW_FUN_EXPORT PFNGLVERTEXARRAYVERTEXATTRIBIOFFSETEXTPROC __glewVertexArrayVert GLEW_FUN_EXPORT PFNGLVERTEXARRAYVERTEXATTRIBOFFSETEXTPROC __glewVertexArrayVertexAttribOffsetEXT; GLEW_FUN_EXPORT PFNGLVERTEXARRAYVERTEXOFFSETEXTPROC __glewVertexArrayVertexOffsetEXT; +GLEW_FUN_EXPORT PFNGLDISCARDFRAMEBUFFEREXTPROC __glewDiscardFramebufferEXT; + +GLEW_FUN_EXPORT PFNGLDRAWBUFFERSEXTPROC __glewDrawBuffersEXT; + GLEW_FUN_EXPORT PFNGLCOLORMASKINDEXEDEXTPROC __glewColorMaskIndexedEXT; GLEW_FUN_EXPORT PFNGLDISABLEINDEXEDEXTPROC __glewDisableIndexedEXT; GLEW_FUN_EXPORT PFNGLENABLEINDEXEDEXTPROC __glewEnableIndexedEXT; @@ -18043,11 +21518,28 @@ GLEW_FUN_EXPORT PFNGLGETBOOLEANINDEXEDVEXTPROC __glewGetBooleanIndexedvEXT; GLEW_FUN_EXPORT PFNGLGETINTEGERINDEXEDVEXTPROC __glewGetIntegerIndexedvEXT; GLEW_FUN_EXPORT PFNGLISENABLEDINDEXEDEXTPROC __glewIsEnabledIndexedEXT; +GLEW_FUN_EXPORT PFNGLBLENDEQUATIONSEPARATEIEXTPROC __glewBlendEquationSeparateiEXT; +GLEW_FUN_EXPORT PFNGLBLENDEQUATIONIEXTPROC __glewBlendEquationiEXT; +GLEW_FUN_EXPORT PFNGLBLENDFUNCSEPARATEIEXTPROC __glewBlendFuncSeparateiEXT; +GLEW_FUN_EXPORT PFNGLBLENDFUNCIEXTPROC __glewBlendFunciEXT; +GLEW_FUN_EXPORT PFNGLCOLORMASKIEXTPROC __glewColorMaskiEXT; +GLEW_FUN_EXPORT PFNGLDISABLEIEXTPROC __glewDisableiEXT; +GLEW_FUN_EXPORT PFNGLENABLEIEXTPROC __glewEnableiEXT; +GLEW_FUN_EXPORT PFNGLISENABLEDIEXTPROC __glewIsEnablediEXT; + +GLEW_FUN_EXPORT PFNGLDRAWELEMENTSBASEVERTEXEXTPROC __glewDrawElementsBaseVertexEXT; +GLEW_FUN_EXPORT PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXEXTPROC __glewDrawElementsInstancedBaseVertexEXT; +GLEW_FUN_EXPORT PFNGLDRAWRANGEELEMENTSBASEVERTEXEXTPROC __glewDrawRangeElementsBaseVertexEXT; +GLEW_FUN_EXPORT PFNGLMULTIDRAWELEMENTSBASEVERTEXEXTPROC __glewMultiDrawElementsBaseVertexEXT; + GLEW_FUN_EXPORT PFNGLDRAWARRAYSINSTANCEDEXTPROC __glewDrawArraysInstancedEXT; GLEW_FUN_EXPORT PFNGLDRAWELEMENTSINSTANCEDEXTPROC __glewDrawElementsInstancedEXT; GLEW_FUN_EXPORT PFNGLDRAWRANGEELEMENTSEXTPROC __glewDrawRangeElementsEXT; +GLEW_FUN_EXPORT PFNGLBUFFERSTORAGEEXTERNALEXTPROC __glewBufferStorageExternalEXT; +GLEW_FUN_EXPORT PFNGLNAMEDBUFFERSTORAGEEXTERNALEXTPROC __glewNamedBufferStorageExternalEXT; + GLEW_FUN_EXPORT PFNGLFOGCOORDPOINTEREXTPROC __glewFogCoordPointerEXT; GLEW_FUN_EXPORT PFNGLFOGCOORDDEXTPROC __glewFogCoorddEXT; GLEW_FUN_EXPORT PFNGLFOGCOORDDVEXTPROC __glewFogCoorddvEXT; @@ -18152,16 +21644,55 @@ GLEW_FUN_EXPORT PFNGLINDEXFUNCEXTPROC __glewIndexFuncEXT; GLEW_FUN_EXPORT PFNGLINDEXMATERIALEXTPROC __glewIndexMaterialEXT; +GLEW_FUN_EXPORT PFNGLVERTEXATTRIBDIVISOREXTPROC __glewVertexAttribDivisorEXT; + GLEW_FUN_EXPORT PFNGLAPPLYTEXTUREEXTPROC __glewApplyTextureEXT; GLEW_FUN_EXPORT PFNGLTEXTURELIGHTEXTPROC __glewTextureLightEXT; GLEW_FUN_EXPORT PFNGLTEXTUREMATERIALEXTPROC __glewTextureMaterialEXT; +GLEW_FUN_EXPORT PFNGLFLUSHMAPPEDBUFFERRANGEEXTPROC __glewFlushMappedBufferRangeEXT; +GLEW_FUN_EXPORT PFNGLMAPBUFFERRANGEEXTPROC __glewMapBufferRangeEXT; + +GLEW_FUN_EXPORT PFNGLBUFFERSTORAGEMEMEXTPROC __glewBufferStorageMemEXT; +GLEW_FUN_EXPORT PFNGLCREATEMEMORYOBJECTSEXTPROC __glewCreateMemoryObjectsEXT; +GLEW_FUN_EXPORT PFNGLDELETEMEMORYOBJECTSEXTPROC __glewDeleteMemoryObjectsEXT; +GLEW_FUN_EXPORT PFNGLGETMEMORYOBJECTPARAMETERIVEXTPROC __glewGetMemoryObjectParameterivEXT; +GLEW_FUN_EXPORT PFNGLGETUNSIGNEDBYTEI_VEXTPROC __glewGetUnsignedBytei_vEXT; +GLEW_FUN_EXPORT PFNGLGETUNSIGNEDBYTEVEXTPROC __glewGetUnsignedBytevEXT; +GLEW_FUN_EXPORT PFNGLISMEMORYOBJECTEXTPROC __glewIsMemoryObjectEXT; +GLEW_FUN_EXPORT PFNGLMEMORYOBJECTPARAMETERIVEXTPROC __glewMemoryObjectParameterivEXT; +GLEW_FUN_EXPORT PFNGLNAMEDBUFFERSTORAGEMEMEXTPROC __glewNamedBufferStorageMemEXT; +GLEW_FUN_EXPORT PFNGLTEXSTORAGEMEM1DEXTPROC __glewTexStorageMem1DEXT; +GLEW_FUN_EXPORT PFNGLTEXSTORAGEMEM2DEXTPROC __glewTexStorageMem2DEXT; +GLEW_FUN_EXPORT PFNGLTEXSTORAGEMEM2DMULTISAMPLEEXTPROC __glewTexStorageMem2DMultisampleEXT; +GLEW_FUN_EXPORT PFNGLTEXSTORAGEMEM3DEXTPROC __glewTexStorageMem3DEXT; +GLEW_FUN_EXPORT PFNGLTEXSTORAGEMEM3DMULTISAMPLEEXTPROC __glewTexStorageMem3DMultisampleEXT; +GLEW_FUN_EXPORT PFNGLTEXTURESTORAGEMEM1DEXTPROC __glewTextureStorageMem1DEXT; +GLEW_FUN_EXPORT PFNGLTEXTURESTORAGEMEM2DEXTPROC __glewTextureStorageMem2DEXT; +GLEW_FUN_EXPORT PFNGLTEXTURESTORAGEMEM2DMULTISAMPLEEXTPROC __glewTextureStorageMem2DMultisampleEXT; +GLEW_FUN_EXPORT PFNGLTEXTURESTORAGEMEM3DEXTPROC __glewTextureStorageMem3DEXT; +GLEW_FUN_EXPORT PFNGLTEXTURESTORAGEMEM3DMULTISAMPLEEXTPROC __glewTextureStorageMem3DMultisampleEXT; + +GLEW_FUN_EXPORT PFNGLIMPORTMEMORYFDEXTPROC __glewImportMemoryFdEXT; + +GLEW_FUN_EXPORT PFNGLIMPORTMEMORYWIN32HANDLEEXTPROC __glewImportMemoryWin32HandleEXT; +GLEW_FUN_EXPORT PFNGLIMPORTMEMORYWIN32NAMEEXTPROC __glewImportMemoryWin32NameEXT; + GLEW_FUN_EXPORT PFNGLMULTIDRAWARRAYSEXTPROC __glewMultiDrawArraysEXT; GLEW_FUN_EXPORT PFNGLMULTIDRAWELEMENTSEXTPROC __glewMultiDrawElementsEXT; +GLEW_FUN_EXPORT PFNGLMULTIDRAWARRAYSINDIRECTEXTPROC __glewMultiDrawArraysIndirectEXT; +GLEW_FUN_EXPORT PFNGLMULTIDRAWELEMENTSINDIRECTEXTPROC __glewMultiDrawElementsIndirectEXT; + GLEW_FUN_EXPORT PFNGLSAMPLEMASKEXTPROC __glewSampleMaskEXT; GLEW_FUN_EXPORT PFNGLSAMPLEPATTERNEXTPROC __glewSamplePatternEXT; +GLEW_FUN_EXPORT PFNGLFRAMEBUFFERTEXTURE2DMULTISAMPLEEXTPROC __glewFramebufferTexture2DMultisampleEXT; + +GLEW_FUN_EXPORT PFNGLDRAWBUFFERSINDEXEDEXTPROC __glewDrawBuffersIndexedEXT; +GLEW_FUN_EXPORT PFNGLGETINTEGERI_VEXTPROC __glewGetIntegeri_vEXT; +GLEW_FUN_EXPORT PFNGLREADBUFFERINDEXEDEXTPROC __glewReadBufferIndexedEXT; + GLEW_FUN_EXPORT PFNGLCOLORTABLEEXTPROC __glewColorTableEXT; GLEW_FUN_EXPORT PFNGLGETCOLORTABLEEXTPROC __glewGetColorTableEXT; GLEW_FUN_EXPORT PFNGLGETCOLORTABLEPARAMETERFVEXTPROC __glewGetColorTableParameterfvEXT; @@ -18209,6 +21740,19 @@ GLEW_FUN_EXPORT PFNGLSECONDARYCOLOR3USEXTPROC __glewSecondaryColor3usEXT; GLEW_FUN_EXPORT PFNGLSECONDARYCOLOR3USVEXTPROC __glewSecondaryColor3usvEXT; GLEW_FUN_EXPORT PFNGLSECONDARYCOLORPOINTEREXTPROC __glewSecondaryColorPointerEXT; +GLEW_FUN_EXPORT PFNGLDELETESEMAPHORESEXTPROC __glewDeleteSemaphoresEXT; +GLEW_FUN_EXPORT PFNGLGENSEMAPHORESEXTPROC __glewGenSemaphoresEXT; +GLEW_FUN_EXPORT PFNGLGETSEMAPHOREPARAMETERUI64VEXTPROC __glewGetSemaphoreParameterui64vEXT; +GLEW_FUN_EXPORT PFNGLISSEMAPHOREEXTPROC __glewIsSemaphoreEXT; +GLEW_FUN_EXPORT PFNGLSEMAPHOREPARAMETERUI64VEXTPROC __glewSemaphoreParameterui64vEXT; +GLEW_FUN_EXPORT PFNGLSIGNALSEMAPHOREEXTPROC __glewSignalSemaphoreEXT; +GLEW_FUN_EXPORT PFNGLWAITSEMAPHOREEXTPROC __glewWaitSemaphoreEXT; + +GLEW_FUN_EXPORT PFNGLIMPORTSEMAPHOREFDEXTPROC __glewImportSemaphoreFdEXT; + +GLEW_FUN_EXPORT PFNGLIMPORTSEMAPHOREWIN32HANDLEEXTPROC __glewImportSemaphoreWin32HandleEXT; +GLEW_FUN_EXPORT PFNGLIMPORTSEMAPHOREWIN32NAMEEXTPROC __glewImportSemaphoreWin32NameEXT; + GLEW_FUN_EXPORT PFNGLACTIVEPROGRAMEXTPROC __glewActiveProgramEXT; GLEW_FUN_EXPORT PFNGLCREATESHADERPROGRAMEXTPROC __glewCreateShaderProgramEXT; GLEW_FUN_EXPORT PFNGLUSESHADERPROGRAMEXTPROC __glewUseShaderProgramEXT; @@ -18216,6 +21760,13 @@ GLEW_FUN_EXPORT PFNGLUSESHADERPROGRAMEXTPROC __glewUseShaderProgramEXT; GLEW_FUN_EXPORT PFNGLBINDIMAGETEXTUREEXTPROC __glewBindImageTextureEXT; GLEW_FUN_EXPORT PFNGLMEMORYBARRIEREXTPROC __glewMemoryBarrierEXT; +GLEW_FUN_EXPORT PFNGLCLEARPIXELLOCALSTORAGEUIEXTPROC __glewClearPixelLocalStorageuiEXT; +GLEW_FUN_EXPORT PFNGLFRAMEBUFFERPIXELLOCALSTORAGESIZEEXTPROC __glewFramebufferPixelLocalStorageSizeEXT; +GLEW_FUN_EXPORT PFNGLGETFRAMEBUFFERPIXELLOCALSTORAGESIZEEXTPROC __glewGetFramebufferPixelLocalStorageSizeEXT; + +GLEW_FUN_EXPORT PFNGLTEXPAGECOMMITMENTEXTPROC __glewTexPageCommitmentEXT; +GLEW_FUN_EXPORT PFNGLTEXTUREPAGECOMMITMENTEXTPROC __glewTexturePageCommitmentEXT; + GLEW_FUN_EXPORT PFNGLACTIVESTENCILFACEEXTPROC __glewActiveStencilFaceEXT; GLEW_FUN_EXPORT PFNGLTEXSUBIMAGE1DEXTPROC __glewTexSubImage1DEXT; @@ -18244,6 +21795,15 @@ GLEW_FUN_EXPORT PFNGLPRIORITIZETEXTURESEXTPROC __glewPrioritizeTexturesEXT; GLEW_FUN_EXPORT PFNGLTEXTURENORMALEXTPROC __glewTextureNormalEXT; +GLEW_FUN_EXPORT PFNGLTEXSTORAGE1DEXTPROC __glewTexStorage1DEXT; +GLEW_FUN_EXPORT PFNGLTEXSTORAGE2DEXTPROC __glewTexStorage2DEXT; +GLEW_FUN_EXPORT PFNGLTEXSTORAGE3DEXTPROC __glewTexStorage3DEXT; +GLEW_FUN_EXPORT PFNGLTEXTURESTORAGE1DEXTPROC __glewTextureStorage1DEXT; +GLEW_FUN_EXPORT PFNGLTEXTURESTORAGE2DEXTPROC __glewTextureStorage2DEXT; +GLEW_FUN_EXPORT PFNGLTEXTURESTORAGE3DEXTPROC __glewTextureStorage3DEXT; + +GLEW_FUN_EXPORT PFNGLTEXTUREVIEWEXTPROC __glewTextureViewEXT; + GLEW_FUN_EXPORT PFNGLGETQUERYOBJECTI64VEXTPROC __glewGetQueryObjecti64vEXT; GLEW_FUN_EXPORT PFNGLGETQUERYOBJECTUI64VEXTPROC __glewGetQueryObjectui64vEXT; @@ -18264,6 +21824,10 @@ GLEW_FUN_EXPORT PFNGLNORMALPOINTEREXTPROC __glewNormalPointerEXT; GLEW_FUN_EXPORT PFNGLTEXCOORDPOINTEREXTPROC __glewTexCoordPointerEXT; GLEW_FUN_EXPORT PFNGLVERTEXPOINTEREXTPROC __glewVertexPointerEXT; +GLEW_FUN_EXPORT PFNGLBINDARRAYSETEXTPROC __glewBindArraySetEXT; +GLEW_FUN_EXPORT PFNGLCREATEARRAYSETEXTPROC __glewCreateArraySetExt; +GLEW_FUN_EXPORT PFNGLDELETEARRAYSETSEXTPROC __glewDeleteArraySetsEXT; + GLEW_FUN_EXPORT PFNGLGETVERTEXATTRIBLDVEXTPROC __glewGetVertexAttribLdvEXT; GLEW_FUN_EXPORT PFNGLVERTEXARRAYVERTEXATTRIBLOFFSETEXTPROC __glewVertexArrayVertexAttribLOffsetEXT; GLEW_FUN_EXPORT PFNGLVERTEXATTRIBL1DEXTPROC __glewVertexAttribL1dEXT; @@ -18323,6 +21887,11 @@ GLEW_FUN_EXPORT PFNGLVERTEXWEIGHTPOINTEREXTPROC __glewVertexWeightPointerEXT; GLEW_FUN_EXPORT PFNGLVERTEXWEIGHTFEXTPROC __glewVertexWeightfEXT; GLEW_FUN_EXPORT PFNGLVERTEXWEIGHTFVEXTPROC __glewVertexWeightfvEXT; +GLEW_FUN_EXPORT PFNGLACQUIREKEYEDMUTEXWIN32EXTPROC __glewAcquireKeyedMutexWin32EXT; +GLEW_FUN_EXPORT PFNGLRELEASEKEYEDMUTEXWIN32EXTPROC __glewReleaseKeyedMutexWin32EXT; + +GLEW_FUN_EXPORT PFNGLWINDOWRECTANGLESEXTPROC __glewWindowRectanglesEXT; + GLEW_FUN_EXPORT PFNGLIMPORTSYNCEXTPROC __glewImportSyncEXT; GLEW_FUN_EXPORT PFNGLFRAMETERMINATORGREMEDYPROC __glewFrameTerminatorGREMEDY; @@ -18384,6 +21953,8 @@ GLEW_FUN_EXPORT PFNGLOBJECTPTRLABELPROC __glewObjectPtrLabel; GLEW_FUN_EXPORT PFNGLPOPDEBUGGROUPPROC __glewPopDebugGroup; GLEW_FUN_EXPORT PFNGLPUSHDEBUGGROUPPROC __glewPushDebugGroup; +GLEW_FUN_EXPORT PFNGLMAXSHADERCOMPILERTHREADSKHRPROC __glewMaxShaderCompilerThreadsKHR; + GLEW_FUN_EXPORT PFNGLGETNUNIFORMFVPROC __glewGetnUniformfv; GLEW_FUN_EXPORT PFNGLGETNUNIFORMIVPROC __glewGetnUniformiv; GLEW_FUN_EXPORT PFNGLGETNUNIFORMUIVPROC __glewGetnUniformuiv; @@ -18425,6 +21996,13 @@ GLEW_FUN_EXPORT PFNGLWINDOWPOS4SVMESAPROC __glewWindowPos4svMESA; GLEW_FUN_EXPORT PFNGLBEGINCONDITIONALRENDERNVXPROC __glewBeginConditionalRenderNVX; GLEW_FUN_EXPORT PFNGLENDCONDITIONALRENDERNVXPROC __glewEndConditionalRenderNVX; +GLEW_FUN_EXPORT PFNGLLGPUCOPYIMAGESUBDATANVXPROC __glewLGPUCopyImageSubDataNVX; +GLEW_FUN_EXPORT PFNGLLGPUINTERLOCKNVXPROC __glewLGPUInterlockNVX; +GLEW_FUN_EXPORT PFNGLLGPUNAMEDBUFFERSUBDATANVXPROC __glewLGPUNamedBufferSubDataNVX; + +GLEW_FUN_EXPORT PFNGLSTEREOPARAMETERFNVPROC __glewStereoParameterfNV; +GLEW_FUN_EXPORT PFNGLSTEREOPARAMETERINVPROC __glewStereoParameteriNV; + GLEW_FUN_EXPORT PFNGLMULTIDRAWARRAYSINDIRECTBINDLESSNVPROC __glewMultiDrawArraysIndirectBindlessNV; GLEW_FUN_EXPORT PFNGLMULTIDRAWELEMENTSINDIRECTBINDLESSNVPROC __glewMultiDrawElementsIndirectBindlessNV; @@ -18448,6 +22026,26 @@ GLEW_FUN_EXPORT PFNGLUNIFORMHANDLEUI64VNVPROC __glewUniformHandleui64vNV; GLEW_FUN_EXPORT PFNGLBLENDBARRIERNVPROC __glewBlendBarrierNV; GLEW_FUN_EXPORT PFNGLBLENDPARAMETERINVPROC __glewBlendParameteriNV; +GLEW_FUN_EXPORT PFNGLVIEWPORTPOSITIONWSCALENVPROC __glewViewportPositionWScaleNV; + +GLEW_FUN_EXPORT PFNGLCALLCOMMANDLISTNVPROC __glewCallCommandListNV; +GLEW_FUN_EXPORT PFNGLCOMMANDLISTSEGMENTSNVPROC __glewCommandListSegmentsNV; +GLEW_FUN_EXPORT PFNGLCOMPILECOMMANDLISTNVPROC __glewCompileCommandListNV; +GLEW_FUN_EXPORT PFNGLCREATECOMMANDLISTSNVPROC __glewCreateCommandListsNV; +GLEW_FUN_EXPORT PFNGLCREATESTATESNVPROC __glewCreateStatesNV; +GLEW_FUN_EXPORT PFNGLDELETECOMMANDLISTSNVPROC __glewDeleteCommandListsNV; +GLEW_FUN_EXPORT PFNGLDELETESTATESNVPROC __glewDeleteStatesNV; +GLEW_FUN_EXPORT PFNGLDRAWCOMMANDSADDRESSNVPROC __glewDrawCommandsAddressNV; +GLEW_FUN_EXPORT PFNGLDRAWCOMMANDSNVPROC __glewDrawCommandsNV; +GLEW_FUN_EXPORT PFNGLDRAWCOMMANDSSTATESADDRESSNVPROC __glewDrawCommandsStatesAddressNV; +GLEW_FUN_EXPORT PFNGLDRAWCOMMANDSSTATESNVPROC __glewDrawCommandsStatesNV; +GLEW_FUN_EXPORT PFNGLGETCOMMANDHEADERNVPROC __glewGetCommandHeaderNV; +GLEW_FUN_EXPORT PFNGLGETSTAGEINDEXNVPROC __glewGetStageIndexNV; +GLEW_FUN_EXPORT PFNGLISCOMMANDLISTNVPROC __glewIsCommandListNV; +GLEW_FUN_EXPORT PFNGLISSTATENVPROC __glewIsStateNV; +GLEW_FUN_EXPORT PFNGLLISTDRAWCOMMANDSSTATESCLIENTNVPROC __glewListDrawCommandsStatesClientNV; +GLEW_FUN_EXPORT PFNGLSTATECAPTURENVPROC __glewStateCaptureNV; + GLEW_FUN_EXPORT PFNGLBEGINCONDITIONALRENDERNVPROC __glewBeginConditionalRenderNV; GLEW_FUN_EXPORT PFNGLENDCONDITIONALRENDERNVPROC __glewEndConditionalRenderNV; @@ -18455,14 +22053,29 @@ GLEW_FUN_EXPORT PFNGLSUBPIXELPRECISIONBIASNVPROC __glewSubpixelPrecisionBiasNV; GLEW_FUN_EXPORT PFNGLCONSERVATIVERASTERPARAMETERFNVPROC __glewConservativeRasterParameterfNV; +GLEW_FUN_EXPORT PFNGLCONSERVATIVERASTERPARAMETERINVPROC __glewConservativeRasterParameteriNV; + +GLEW_FUN_EXPORT PFNGLCOPYBUFFERSUBDATANVPROC __glewCopyBufferSubDataNV; + GLEW_FUN_EXPORT PFNGLCOPYIMAGESUBDATANVPROC __glewCopyImageSubDataNV; GLEW_FUN_EXPORT PFNGLCLEARDEPTHDNVPROC __glewClearDepthdNV; GLEW_FUN_EXPORT PFNGLDEPTHBOUNDSDNVPROC __glewDepthBoundsdNV; GLEW_FUN_EXPORT PFNGLDEPTHRANGEDNVPROC __glewDepthRangedNV; +GLEW_FUN_EXPORT PFNGLDRAWBUFFERSNVPROC __glewDrawBuffersNV; + +GLEW_FUN_EXPORT PFNGLDRAWARRAYSINSTANCEDNVPROC __glewDrawArraysInstancedNV; +GLEW_FUN_EXPORT PFNGLDRAWELEMENTSINSTANCEDNVPROC __glewDrawElementsInstancedNV; + GLEW_FUN_EXPORT PFNGLDRAWTEXTURENVPROC __glewDrawTextureNV; +GLEW_FUN_EXPORT PFNGLDRAWVKIMAGENVPROC __glewDrawVkImageNV; +GLEW_FUN_EXPORT PFNGLGETVKPROCADDRNVPROC __glewGetVkProcAddrNV; +GLEW_FUN_EXPORT PFNGLSIGNALVKFENCENVPROC __glewSignalVkFenceNV; +GLEW_FUN_EXPORT PFNGLSIGNALVKSEMAPHORENVPROC __glewSignalVkSemaphoreNV; +GLEW_FUN_EXPORT PFNGLWAITVKSEMAPHORENVPROC __glewWaitVkSemaphoreNV; + GLEW_FUN_EXPORT PFNGLEVALMAPSNVPROC __glewEvalMapsNV; GLEW_FUN_EXPORT PFNGLGETMAPATTRIBPARAMETERFVNVPROC __glewGetMapAttribParameterfvNV; GLEW_FUN_EXPORT PFNGLGETMAPATTRIBPARAMETERIVNVPROC __glewGetMapAttribParameterivNV; @@ -18494,10 +22107,27 @@ GLEW_FUN_EXPORT PFNGLPROGRAMNAMEDPARAMETER4DVNVPROC __glewProgramNamedParameter4 GLEW_FUN_EXPORT PFNGLPROGRAMNAMEDPARAMETER4FNVPROC __glewProgramNamedParameter4fNV; GLEW_FUN_EXPORT PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC __glewProgramNamedParameter4fvNV; +GLEW_FUN_EXPORT PFNGLBLITFRAMEBUFFERNVPROC __glewBlitFramebufferNV; + +GLEW_FUN_EXPORT PFNGLRENDERBUFFERSTORAGEMULTISAMPLENVPROC __glewRenderbufferStorageMultisampleNV; + GLEW_FUN_EXPORT PFNGLRENDERBUFFERSTORAGEMULTISAMPLECOVERAGENVPROC __glewRenderbufferStorageMultisampleCoverageNV; GLEW_FUN_EXPORT PFNGLPROGRAMVERTEXLIMITNVPROC __glewProgramVertexLimitNV; +GLEW_FUN_EXPORT PFNGLMULTICASTBARRIERNVPROC __glewMulticastBarrierNV; +GLEW_FUN_EXPORT PFNGLMULTICASTBLITFRAMEBUFFERNVPROC __glewMulticastBlitFramebufferNV; +GLEW_FUN_EXPORT PFNGLMULTICASTBUFFERSUBDATANVPROC __glewMulticastBufferSubDataNV; +GLEW_FUN_EXPORT PFNGLMULTICASTCOPYBUFFERSUBDATANVPROC __glewMulticastCopyBufferSubDataNV; +GLEW_FUN_EXPORT PFNGLMULTICASTCOPYIMAGESUBDATANVPROC __glewMulticastCopyImageSubDataNV; +GLEW_FUN_EXPORT PFNGLMULTICASTFRAMEBUFFERSAMPLELOCATIONSFVNVPROC __glewMulticastFramebufferSampleLocationsfvNV; +GLEW_FUN_EXPORT PFNGLMULTICASTGETQUERYOBJECTI64VNVPROC __glewMulticastGetQueryObjecti64vNV; +GLEW_FUN_EXPORT PFNGLMULTICASTGETQUERYOBJECTIVNVPROC __glewMulticastGetQueryObjectivNV; +GLEW_FUN_EXPORT PFNGLMULTICASTGETQUERYOBJECTUI64VNVPROC __glewMulticastGetQueryObjectui64vNV; +GLEW_FUN_EXPORT PFNGLMULTICASTGETQUERYOBJECTUIVNVPROC __glewMulticastGetQueryObjectuivNV; +GLEW_FUN_EXPORT PFNGLMULTICASTWAITSYNCNVPROC __glewMulticastWaitSyncNV; +GLEW_FUN_EXPORT PFNGLRENDERGPUMASKNVPROC __glewRenderGpuMaskNV; + GLEW_FUN_EXPORT PFNGLPROGRAMENVPARAMETERI4INVPROC __glewProgramEnvParameterI4iNV; GLEW_FUN_EXPORT PFNGLPROGRAMENVPARAMETERI4IVNVPROC __glewProgramEnvParameterI4ivNV; GLEW_FUN_EXPORT PFNGLPROGRAMENVPARAMETERI4UINVPROC __glewProgramEnvParameterI4uiNV; @@ -18593,8 +22223,17 @@ GLEW_FUN_EXPORT PFNGLVERTEXATTRIBS4HVNVPROC __glewVertexAttribs4hvNV; GLEW_FUN_EXPORT PFNGLVERTEXWEIGHTHNVPROC __glewVertexWeighthNV; GLEW_FUN_EXPORT PFNGLVERTEXWEIGHTHVNVPROC __glewVertexWeighthvNV; +GLEW_FUN_EXPORT PFNGLVERTEXATTRIBDIVISORNVPROC __glewVertexAttribDivisorNV; + GLEW_FUN_EXPORT PFNGLGETINTERNALFORMATSAMPLEIVNVPROC __glewGetInternalformatSampleivNV; +GLEW_FUN_EXPORT PFNGLUNIFORMMATRIX2X3FVNVPROC __glewUniformMatrix2x3fvNV; +GLEW_FUN_EXPORT PFNGLUNIFORMMATRIX2X4FVNVPROC __glewUniformMatrix2x4fvNV; +GLEW_FUN_EXPORT PFNGLUNIFORMMATRIX3X2FVNVPROC __glewUniformMatrix3x2fvNV; +GLEW_FUN_EXPORT PFNGLUNIFORMMATRIX3X4FVNVPROC __glewUniformMatrix3x4fvNV; +GLEW_FUN_EXPORT PFNGLUNIFORMMATRIX4X2FVNVPROC __glewUniformMatrix4x2fvNV; +GLEW_FUN_EXPORT PFNGLUNIFORMMATRIX4X3FVNVPROC __glewUniformMatrix4x3fvNV; + GLEW_FUN_EXPORT PFNGLBEGINOCCLUSIONQUERYNVPROC __glewBeginOcclusionQueryNV; GLEW_FUN_EXPORT PFNGLDELETEOCCLUSIONQUERIESNVPROC __glewDeleteOcclusionQueriesNV; GLEW_FUN_EXPORT PFNGLENDOCCLUSIONQUERYNVPROC __glewEndOcclusionQueryNV; @@ -18678,6 +22317,8 @@ GLEW_FUN_EXPORT PFNGLPIXELDATARANGENVPROC __glewPixelDataRangeNV; GLEW_FUN_EXPORT PFNGLPOINTPARAMETERINVPROC __glewPointParameteriNV; GLEW_FUN_EXPORT PFNGLPOINTPARAMETERIVNVPROC __glewPointParameterivNV; +GLEW_FUN_EXPORT PFNGLPOLYGONMODENVPROC __glewPolygonModeNV; + GLEW_FUN_EXPORT PFNGLGETVIDEOI64VNVPROC __glewGetVideoi64vNV; GLEW_FUN_EXPORT PFNGLGETVIDEOIVNVPROC __glewGetVideoivNV; GLEW_FUN_EXPORT PFNGLGETVIDEOUI64VNVPROC __glewGetVideoui64vNV; @@ -18722,6 +22363,13 @@ GLEW_FUN_EXPORT PFNGLPROGRAMUNIFORMUI64VNVPROC __glewProgramUniformui64vNV; GLEW_FUN_EXPORT PFNGLUNIFORMUI64NVPROC __glewUniformui64NV; GLEW_FUN_EXPORT PFNGLUNIFORMUI64VNVPROC __glewUniformui64vNV; +GLEW_FUN_EXPORT PFNGLCOMPRESSEDTEXIMAGE3DNVPROC __glewCompressedTexImage3DNV; +GLEW_FUN_EXPORT PFNGLCOMPRESSEDTEXSUBIMAGE3DNVPROC __glewCompressedTexSubImage3DNV; +GLEW_FUN_EXPORT PFNGLCOPYTEXSUBIMAGE3DNVPROC __glewCopyTexSubImage3DNV; +GLEW_FUN_EXPORT PFNGLFRAMEBUFFERTEXTURELAYERNVPROC __glewFramebufferTextureLayerNV; +GLEW_FUN_EXPORT PFNGLTEXIMAGE3DNVPROC __glewTexImage3DNV; +GLEW_FUN_EXPORT PFNGLTEXSUBIMAGE3DNVPROC __glewTexSubImage3DNV; + GLEW_FUN_EXPORT PFNGLTEXTUREBARRIERNVPROC __glewTextureBarrierNV; GLEW_FUN_EXPORT PFNGLTEXIMAGE2DMULTISAMPLECOVERAGENVPROC __glewTexImage2DMultisampleCoverageNV; @@ -18876,15 +22524,54 @@ GLEW_FUN_EXPORT PFNGLVIDEOCAPTURESTREAMPARAMETERDVNVPROC __glewVideoCaptureStrea GLEW_FUN_EXPORT PFNGLVIDEOCAPTURESTREAMPARAMETERFVNVPROC __glewVideoCaptureStreamParameterfvNV; GLEW_FUN_EXPORT PFNGLVIDEOCAPTURESTREAMPARAMETERIVNVPROC __glewVideoCaptureStreamParameterivNV; -GLEW_FUN_EXPORT PFNGLCLEARDEPTHFOESPROC __glewClearDepthfOES; -GLEW_FUN_EXPORT PFNGLCLIPPLANEFOESPROC __glewClipPlanefOES; -GLEW_FUN_EXPORT PFNGLDEPTHRANGEFOESPROC __glewDepthRangefOES; -GLEW_FUN_EXPORT PFNGLFRUSTUMFOESPROC __glewFrustumfOES; -GLEW_FUN_EXPORT PFNGLGETCLIPPLANEFOESPROC __glewGetClipPlanefOES; -GLEW_FUN_EXPORT PFNGLORTHOFOESPROC __glewOrthofOES; +GLEW_FUN_EXPORT PFNGLDEPTHRANGEARRAYFVNVPROC __glewDepthRangeArrayfvNV; +GLEW_FUN_EXPORT PFNGLDEPTHRANGEINDEXEDFNVPROC __glewDepthRangeIndexedfNV; +GLEW_FUN_EXPORT PFNGLDISABLEINVPROC __glewDisableiNV; +GLEW_FUN_EXPORT PFNGLENABLEINVPROC __glewEnableiNV; +GLEW_FUN_EXPORT PFNGLGETFLOATI_VNVPROC __glewGetFloati_vNV; +GLEW_FUN_EXPORT PFNGLISENABLEDINVPROC __glewIsEnablediNV; +GLEW_FUN_EXPORT PFNGLSCISSORARRAYVNVPROC __glewScissorArrayvNV; +GLEW_FUN_EXPORT PFNGLSCISSORINDEXEDNVPROC __glewScissorIndexedNV; +GLEW_FUN_EXPORT PFNGLSCISSORINDEXEDVNVPROC __glewScissorIndexedvNV; +GLEW_FUN_EXPORT PFNGLVIEWPORTARRAYVNVPROC __glewViewportArrayvNV; +GLEW_FUN_EXPORT PFNGLVIEWPORTINDEXEDFNVPROC __glewViewportIndexedfNV; +GLEW_FUN_EXPORT PFNGLVIEWPORTINDEXEDFVNVPROC __glewViewportIndexedfvNV; + +GLEW_FUN_EXPORT PFNGLVIEWPORTSWIZZLENVPROC __glewViewportSwizzleNV; GLEW_FUN_EXPORT PFNGLFRAMEBUFFERTEXTUREMULTIVIEWOVRPROC __glewFramebufferTextureMultiviewOVR; +GLEW_FUN_EXPORT PFNGLFRAMEBUFFERTEXTUREMULTISAMPLEMULTIVIEWOVRPROC __glewFramebufferTextureMultisampleMultiviewOVR; + +GLEW_FUN_EXPORT PFNGLALPHAFUNCQCOMPROC __glewAlphaFuncQCOM; + +GLEW_FUN_EXPORT PFNGLDISABLEDRIVERCONTROLQCOMPROC __glewDisableDriverControlQCOM; +GLEW_FUN_EXPORT PFNGLENABLEDRIVERCONTROLQCOMPROC __glewEnableDriverControlQCOM; +GLEW_FUN_EXPORT PFNGLGETDRIVERCONTROLSTRINGQCOMPROC __glewGetDriverControlStringQCOM; +GLEW_FUN_EXPORT PFNGLGETDRIVERCONTROLSQCOMPROC __glewGetDriverControlsQCOM; + +GLEW_FUN_EXPORT PFNGLEXTGETBUFFERPOINTERVQCOMPROC __glewExtGetBufferPointervQCOM; +GLEW_FUN_EXPORT PFNGLEXTGETBUFFERSQCOMPROC __glewExtGetBuffersQCOM; +GLEW_FUN_EXPORT PFNGLEXTGETFRAMEBUFFERSQCOMPROC __glewExtGetFramebuffersQCOM; +GLEW_FUN_EXPORT PFNGLEXTGETRENDERBUFFERSQCOMPROC __glewExtGetRenderbuffersQCOM; +GLEW_FUN_EXPORT PFNGLEXTGETTEXLEVELPARAMETERIVQCOMPROC __glewExtGetTexLevelParameterivQCOM; +GLEW_FUN_EXPORT PFNGLEXTGETTEXSUBIMAGEQCOMPROC __glewExtGetTexSubImageQCOM; +GLEW_FUN_EXPORT PFNGLEXTGETTEXTURESQCOMPROC __glewExtGetTexturesQCOM; +GLEW_FUN_EXPORT PFNGLEXTTEXOBJECTSTATEOVERRIDEIQCOMPROC __glewExtTexObjectStateOverrideiQCOM; + +GLEW_FUN_EXPORT PFNGLEXTGETPROGRAMBINARYSOURCEQCOMPROC __glewExtGetProgramBinarySourceQCOM; +GLEW_FUN_EXPORT PFNGLEXTGETPROGRAMSQCOMPROC __glewExtGetProgramsQCOM; +GLEW_FUN_EXPORT PFNGLEXTGETSHADERSQCOMPROC __glewExtGetShadersQCOM; +GLEW_FUN_EXPORT PFNGLEXTISPROGRAMBINARYQCOMPROC __glewExtIsProgramBinaryQCOM; + +GLEW_FUN_EXPORT PFNGLFRAMEBUFFERFOVEATIONCONFIGQCOMPROC __glewFramebufferFoveationConfigQCOM; +GLEW_FUN_EXPORT PFNGLFRAMEBUFFERFOVEATIONPARAMETERSQCOMPROC __glewFramebufferFoveationParametersQCOM; + +GLEW_FUN_EXPORT PFNGLFRAMEBUFFERFETCHBARRIERQCOMPROC __glewFramebufferFetchBarrierQCOM; + +GLEW_FUN_EXPORT PFNGLENDTILINGQCOMPROC __glewEndTilingQCOM; +GLEW_FUN_EXPORT PFNGLSTARTTILINGQCOMPROC __glewStartTilingQCOM; + GLEW_FUN_EXPORT PFNGLALPHAFUNCXPROC __glewAlphaFuncx; GLEW_FUN_EXPORT PFNGLCLEARCOLORXPROC __glewClearColorx; GLEW_FUN_EXPORT PFNGLCLEARDEPTHXPROC __glewClearDepthx; @@ -18949,6 +22636,13 @@ GLEW_FUN_EXPORT PFNGLGETFOGFUNCSGISPROC __glewGetFogFuncSGIS; GLEW_FUN_EXPORT PFNGLSAMPLEMASKSGISPROC __glewSampleMaskSGIS; GLEW_FUN_EXPORT PFNGLSAMPLEPATTERNSGISPROC __glewSamplePatternSGIS; +GLEW_FUN_EXPORT PFNGLINTERLEAVEDTEXTURECOORDSETSSGISPROC __glewInterleavedTextureCoordSetsSGIS; +GLEW_FUN_EXPORT PFNGLSELECTTEXTURECOORDSETSGISPROC __glewSelectTextureCoordSetSGIS; +GLEW_FUN_EXPORT PFNGLSELECTTEXTURESGISPROC __glewSelectTextureSGIS; +GLEW_FUN_EXPORT PFNGLSELECTTEXTURETRANSFORMSGISPROC __glewSelectTextureTransformSGIS; + +GLEW_FUN_EXPORT PFNGLMULTISAMPLESUBRECTPOSSGISPROC __glewMultisampleSubRectPosSGIS; + GLEW_FUN_EXPORT PFNGLGETSHARPENTEXFUNCSGISPROC __glewGetSharpenTexFuncSGIS; GLEW_FUN_EXPORT PFNGLSHARPENTEXFUNCSGISPROC __glewSharpenTexFuncSGIS; @@ -18965,8 +22659,14 @@ GLEW_FUN_EXPORT PFNGLGENASYNCMARKERSSGIXPROC __glewGenAsyncMarkersSGIX; GLEW_FUN_EXPORT PFNGLISASYNCMARKERSGIXPROC __glewIsAsyncMarkerSGIX; GLEW_FUN_EXPORT PFNGLPOLLASYNCSGIXPROC __glewPollAsyncSGIX; +GLEW_FUN_EXPORT PFNGLADDRESSSPACEPROC __glewAddressSpace; +GLEW_FUN_EXPORT PFNGLDATAPIPEPROC __glewDataPipe; + GLEW_FUN_EXPORT PFNGLFLUSHRASTERSGIXPROC __glewFlushRasterSGIX; +GLEW_FUN_EXPORT PFNGLFOGLAYERSSGIXPROC __glewFogLayersSGIX; +GLEW_FUN_EXPORT PFNGLGETFOGLAYERSSGIXPROC __glewGetFogLayersSGIX; + GLEW_FUN_EXPORT PFNGLTEXTUREFOGSGIXPROC __glewTextureFogSGIX; GLEW_FUN_EXPORT PFNGLFRAGMENTCOLORMATERIALSGIXPROC __glewFragmentColorMaterialSGIX; @@ -18989,8 +22689,33 @@ GLEW_FUN_EXPORT PFNGLGETFRAGMENTMATERIALIVSGIXPROC __glewGetFragmentMaterialivSG GLEW_FUN_EXPORT PFNGLFRAMEZOOMSGIXPROC __glewFrameZoomSGIX; +GLEW_FUN_EXPORT PFNGLIGLOOINTERFACESGIXPROC __glewIglooInterfaceSGIX; + +GLEW_FUN_EXPORT PFNGLALLOCMPEGPREDICTORSSGIXPROC __glewAllocMPEGPredictorsSGIX; +GLEW_FUN_EXPORT PFNGLDELETEMPEGPREDICTORSSGIXPROC __glewDeleteMPEGPredictorsSGIX; +GLEW_FUN_EXPORT PFNGLGENMPEGPREDICTORSSGIXPROC __glewGenMPEGPredictorsSGIX; +GLEW_FUN_EXPORT PFNGLGETMPEGPARAMETERFVSGIXPROC __glewGetMPEGParameterfvSGIX; +GLEW_FUN_EXPORT PFNGLGETMPEGPARAMETERIVSGIXPROC __glewGetMPEGParameterivSGIX; +GLEW_FUN_EXPORT PFNGLGETMPEGPREDICTORSGIXPROC __glewGetMPEGPredictorSGIX; +GLEW_FUN_EXPORT PFNGLGETMPEGQUANTTABLEUBVPROC __glewGetMPEGQuantTableubv; +GLEW_FUN_EXPORT PFNGLISMPEGPREDICTORSGIXPROC __glewIsMPEGPredictorSGIX; +GLEW_FUN_EXPORT PFNGLMPEGPREDICTORSGIXPROC __glewMPEGPredictorSGIX; +GLEW_FUN_EXPORT PFNGLMPEGQUANTTABLEUBVPROC __glewMPEGQuantTableubv; +GLEW_FUN_EXPORT PFNGLSWAPMPEGPREDICTORSSGIXPROC __glewSwapMPEGPredictorsSGIX; + +GLEW_FUN_EXPORT PFNGLGETNONLINLIGHTFVSGIXPROC __glewGetNonlinLightfvSGIX; +GLEW_FUN_EXPORT PFNGLGETNONLINMATERIALFVSGIXPROC __glewGetNonlinMaterialfvSGIX; +GLEW_FUN_EXPORT PFNGLNONLINLIGHTFVSGIXPROC __glewNonlinLightfvSGIX; +GLEW_FUN_EXPORT PFNGLNONLINMATERIALFVSGIXPROC __glewNonlinMaterialfvSGIX; + GLEW_FUN_EXPORT PFNGLPIXELTEXGENSGIXPROC __glewPixelTexGenSGIX; +GLEW_FUN_EXPORT PFNGLDEFORMSGIXPROC __glewDeformSGIX; +GLEW_FUN_EXPORT PFNGLLOADIDENTITYDEFORMATIONMAPSGIXPROC __glewLoadIdentityDeformationMapSGIX; + +GLEW_FUN_EXPORT PFNGLMESHBREADTHSGIXPROC __glewMeshBreadthSGIX; +GLEW_FUN_EXPORT PFNGLMESHSTRIDESGIXPROC __glewMeshStrideSGIX; + GLEW_FUN_EXPORT PFNGLREFERENCEPLANESGIXPROC __glewReferencePlaneSGIX; GLEW_FUN_EXPORT PFNGLSPRITEPARAMETERFSGIXPROC __glewSpriteParameterfSGIX; @@ -19000,6 +22725,16 @@ GLEW_FUN_EXPORT PFNGLSPRITEPARAMETERIVSGIXPROC __glewSpriteParameterivSGIX; GLEW_FUN_EXPORT PFNGLTAGSAMPLEBUFFERSGIXPROC __glewTagSampleBufferSGIX; +GLEW_FUN_EXPORT PFNGLGETVECTOROPERATIONSGIXPROC __glewGetVectorOperationSGIX; +GLEW_FUN_EXPORT PFNGLVECTOROPERATIONSGIXPROC __glewVectorOperationSGIX; + +GLEW_FUN_EXPORT PFNGLAREVERTEXARRAYSRESIDENTSGIXPROC __glewAreVertexArraysResidentSGIX; +GLEW_FUN_EXPORT PFNGLBINDVERTEXARRAYSGIXPROC __glewBindVertexArraySGIX; +GLEW_FUN_EXPORT PFNGLDELETEVERTEXARRAYSSGIXPROC __glewDeleteVertexArraysSGIX; +GLEW_FUN_EXPORT PFNGLGENVERTEXARRAYSSGIXPROC __glewGenVertexArraysSGIX; +GLEW_FUN_EXPORT PFNGLISVERTEXARRAYSGIXPROC __glewIsVertexArraySGIX; +GLEW_FUN_EXPORT PFNGLPRIORITIZEVERTEXARRAYSSGIXPROC __glewPrioritizeVertexArraysSGIX; + GLEW_FUN_EXPORT PFNGLCOLORTABLEPARAMETERFVSGIPROC __glewColorTableParameterfvSGI; GLEW_FUN_EXPORT PFNGLCOLORTABLEPARAMETERIVSGIPROC __glewColorTableParameterivSGI; GLEW_FUN_EXPORT PFNGLCOLORTABLESGIPROC __glewColorTableSGI; @@ -19008,6 +22743,14 @@ GLEW_FUN_EXPORT PFNGLGETCOLORTABLEPARAMETERFVSGIPROC __glewGetColorTableParamete GLEW_FUN_EXPORT PFNGLGETCOLORTABLEPARAMETERIVSGIPROC __glewGetColorTableParameterivSGI; GLEW_FUN_EXPORT PFNGLGETCOLORTABLESGIPROC __glewGetColorTableSGI; +GLEW_FUN_EXPORT PFNGLGETPIXELTRANSFORMPARAMETERFVSGIPROC __glewGetPixelTransformParameterfvSGI; +GLEW_FUN_EXPORT PFNGLGETPIXELTRANSFORMPARAMETERIVSGIPROC __glewGetPixelTransformParameterivSGI; +GLEW_FUN_EXPORT PFNGLPIXELTRANSFORMPARAMETERFSGIPROC __glewPixelTransformParameterfSGI; +GLEW_FUN_EXPORT PFNGLPIXELTRANSFORMPARAMETERFVSGIPROC __glewPixelTransformParameterfvSGI; +GLEW_FUN_EXPORT PFNGLPIXELTRANSFORMPARAMETERISGIPROC __glewPixelTransformParameteriSGI; +GLEW_FUN_EXPORT PFNGLPIXELTRANSFORMPARAMETERIVSGIPROC __glewPixelTransformParameterivSGI; +GLEW_FUN_EXPORT PFNGLPIXELTRANSFORMSGIPROC __glewPixelTransformSGI; + GLEW_FUN_EXPORT PFNGLFINISHTEXTURESUNXPROC __glewFinishTextureSUNX; GLEW_FUN_EXPORT PFNGLGLOBALALPHAFACTORBSUNPROC __glewGlobalAlphaFactorbSUN; @@ -19071,12 +22814,6 @@ GLEW_FUN_EXPORT PFNGLTEXCOORD4FVERTEX4FSUNPROC __glewTexCoord4fVertex4fSUN; GLEW_FUN_EXPORT PFNGLTEXCOORD4FVERTEX4FVSUNPROC __glewTexCoord4fVertex4fvSUN; GLEW_FUN_EXPORT PFNGLADDSWAPHINTRECTWINPROC __glewAddSwapHintRectWIN; - -#if defined(GLEW_MX) && !defined(_WIN32) -struct GLEWContextStruct -{ -#endif /* GLEW_MX */ - GLEW_VAR_EXPORT GLboolean __GLEW_VERSION_1_1; GLEW_VAR_EXPORT GLboolean __GLEW_VERSION_1_2; GLEW_VAR_EXPORT GLboolean __GLEW_VERSION_1_2_1; @@ -19095,15 +22832,21 @@ GLEW_VAR_EXPORT GLboolean __GLEW_VERSION_4_2; GLEW_VAR_EXPORT GLboolean __GLEW_VERSION_4_3; GLEW_VAR_EXPORT GLboolean __GLEW_VERSION_4_4; GLEW_VAR_EXPORT GLboolean __GLEW_VERSION_4_5; +GLEW_VAR_EXPORT GLboolean __GLEW_VERSION_4_6; GLEW_VAR_EXPORT GLboolean __GLEW_3DFX_multisample; GLEW_VAR_EXPORT GLboolean __GLEW_3DFX_tbuffer; GLEW_VAR_EXPORT GLboolean __GLEW_3DFX_texture_compression_FXT1; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_blend_minmax_factor; +GLEW_VAR_EXPORT GLboolean __GLEW_AMD_compressed_3DC_texture; +GLEW_VAR_EXPORT GLboolean __GLEW_AMD_compressed_ATC_texture; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_conservative_depth; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_debug_output; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_depth_clamp_separate; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_draw_buffers_blend; +GLEW_VAR_EXPORT GLboolean __GLEW_AMD_framebuffer_sample_positions; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_gcn_shader; +GLEW_VAR_EXPORT GLboolean __GLEW_AMD_gpu_shader_half_float; +GLEW_VAR_EXPORT GLboolean __GLEW_AMD_gpu_shader_int16; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_gpu_shader_int64; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_interleaved_elements; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_multi_draw_indirect; @@ -19111,21 +22854,26 @@ GLEW_VAR_EXPORT GLboolean __GLEW_AMD_name_gen_delete; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_occlusion_query_event; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_performance_monitor; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_pinned_memory; +GLEW_VAR_EXPORT GLboolean __GLEW_AMD_program_binary_Z400; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_query_buffer_object; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_sample_positions; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_seamless_cubemap_per_texture; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_shader_atomic_counter_ops; +GLEW_VAR_EXPORT GLboolean __GLEW_AMD_shader_ballot; +GLEW_VAR_EXPORT GLboolean __GLEW_AMD_shader_explicit_vertex_parameter; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_shader_stencil_export; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_shader_stencil_value_export; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_shader_trinary_minmax; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_sparse_texture; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_stencil_operation_extended; +GLEW_VAR_EXPORT GLboolean __GLEW_AMD_texture_gather_bias_lod; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_texture_texture4; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_transform_feedback3_lines_triangles; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_transform_feedback4; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_vertex_shader_layer; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_vertex_shader_tessellator; GLEW_VAR_EXPORT GLboolean __GLEW_AMD_vertex_shader_viewport_index; +GLEW_VAR_EXPORT GLboolean __GLEW_ANDROID_extension_pack_es31a; GLEW_VAR_EXPORT GLboolean __GLEW_ANGLE_depth_texture; GLEW_VAR_EXPORT GLboolean __GLEW_ANGLE_framebuffer_blit; GLEW_VAR_EXPORT GLboolean __GLEW_ANGLE_framebuffer_multisample; @@ -19140,15 +22888,24 @@ GLEW_VAR_EXPORT GLboolean __GLEW_ANGLE_timer_query; GLEW_VAR_EXPORT GLboolean __GLEW_ANGLE_translated_shader_source; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_aux_depth_stencil; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_client_storage; +GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_clip_distance; +GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_color_buffer_packed_float; +GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_copy_texture_levels; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_element_array; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_fence; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_float_pixels; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_flush_buffer_range; +GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_framebuffer_multisample; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_object_purgeable; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_pixel_buffer; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_rgb_422; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_row_bytes; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_specular_vector; +GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_sync; +GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_texture_2D_limited_npot; +GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_texture_format_BGRA8888; +GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_texture_max_level; +GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_texture_packed_float; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_texture_range; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_transform_hint; GLEW_VAR_EXPORT GLboolean __GLEW_APPLE_vertex_array_object; @@ -19204,6 +22961,7 @@ GLEW_VAR_EXPORT GLboolean __GLEW_ARB_framebuffer_sRGB; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_geometry_shader4; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_get_program_binary; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_get_texture_sub_image; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_gl_spirv; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_gpu_shader5; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_gpu_shader_fp64; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_gpu_shader_int64; @@ -19229,6 +22987,7 @@ GLEW_VAR_EXPORT GLboolean __GLEW_ARB_pipeline_statistics_query; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_pixel_buffer_object; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_point_parameters; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_point_sprite; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_polygon_offset_clamp; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_post_depth_coverage; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_program_interface_query; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_provoking_vertex; @@ -19270,6 +23029,7 @@ GLEW_VAR_EXPORT GLboolean __GLEW_ARB_sparse_buffer; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_sparse_texture; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_sparse_texture2; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_sparse_texture_clamp; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_spirv_extensions; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_stencil_texturing; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_sync; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_tessellation_shader; @@ -19287,6 +23047,7 @@ GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_env_add; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_env_combine; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_env_crossbar; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_env_dot3; +GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_filter_anisotropic; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_filter_minmax; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_float; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_texture_gather; @@ -19323,6 +23084,11 @@ GLEW_VAR_EXPORT GLboolean __GLEW_ARB_vertex_type_10f_11f_11f_rev; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_vertex_type_2_10_10_10_rev; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_viewport_array; GLEW_VAR_EXPORT GLboolean __GLEW_ARB_window_pos; +GLEW_VAR_EXPORT GLboolean __GLEW_ARM_mali_program_binary; +GLEW_VAR_EXPORT GLboolean __GLEW_ARM_mali_shader_binary; +GLEW_VAR_EXPORT GLboolean __GLEW_ARM_rgba8; +GLEW_VAR_EXPORT GLboolean __GLEW_ARM_shader_framebuffer_fetch; +GLEW_VAR_EXPORT GLboolean __GLEW_ARM_shader_framebuffer_fetch_depth_stencil; GLEW_VAR_EXPORT GLboolean __GLEW_ATIX_point_sprites; GLEW_VAR_EXPORT GLboolean __GLEW_ATIX_texture_env_combine3; GLEW_VAR_EXPORT GLboolean __GLEW_ATIX_texture_env_route; @@ -19344,51 +23110,86 @@ GLEW_VAR_EXPORT GLboolean __GLEW_ATI_texture_mirror_once; GLEW_VAR_EXPORT GLboolean __GLEW_ATI_vertex_array_object; GLEW_VAR_EXPORT GLboolean __GLEW_ATI_vertex_attrib_array_object; GLEW_VAR_EXPORT GLboolean __GLEW_ATI_vertex_streams; +GLEW_VAR_EXPORT GLboolean __GLEW_EGL_KHR_context_flush_control; +GLEW_VAR_EXPORT GLboolean __GLEW_EGL_NV_robustness_video_memory_purge; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_422_pixels; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_Cg_shader; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_EGL_image_array; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_YUV_target; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_abgr; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_base_instance; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_bgra; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_bindable_uniform; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_blend_color; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_blend_equation_separate; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_blend_func_extended; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_blend_func_separate; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_blend_logic_op; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_blend_minmax; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_blend_subtract; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_buffer_storage; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_clear_texture; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_clip_cull_distance; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_clip_volume_hint; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_cmyka; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_color_buffer_float; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_color_buffer_half_float; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_color_subtable; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_compiled_vertex_array; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_compressed_ETC1_RGB8_sub_texture; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_conservative_depth; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_convolution; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_coordinate_frame; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_copy_image; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_copy_texture; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_cull_vertex; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_debug_label; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_debug_marker; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_depth_bounds_test; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_direct_state_access; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_discard_framebuffer; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_draw_buffers; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_draw_buffers2; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_draw_buffers_indexed; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_draw_elements_base_vertex; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_draw_instanced; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_draw_range_elements; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_external_buffer; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_float_blend; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_fog_coord; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_frag_depth; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_fragment_lighting; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_framebuffer_blit; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_framebuffer_multisample; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_framebuffer_multisample_blit_scaled; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_framebuffer_object; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_framebuffer_sRGB; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_geometry_point_size; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_geometry_shader; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_geometry_shader4; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_gpu_program_parameters; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_gpu_shader4; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_gpu_shader5; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_histogram; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_index_array_formats; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_index_func; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_index_material; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_index_texture; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_instanced_arrays; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_light_texture; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_map_buffer_range; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_memory_object; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_memory_object_fd; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_memory_object_win32; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_misc_attribute; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_multi_draw_arrays; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_multi_draw_indirect; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_multiple_textures; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_multisample; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_multisample_compatibility; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_multisampled_render_to_texture; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_multisampled_render_to_texture2; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_multiview_draw_buffers; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_packed_depth_stencil; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_packed_float; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_packed_pixels; @@ -19401,17 +23202,35 @@ GLEW_VAR_EXPORT GLboolean __GLEW_EXT_polygon_offset; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_polygon_offset_clamp; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_post_depth_coverage; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_provoking_vertex; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_pvrtc_sRGB; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_raster_multisample; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_read_format_bgra; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_render_snorm; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_rescale_normal; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_sRGB; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_sRGB_write_control; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_scene_marker; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_secondary_color; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_semaphore; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_semaphore_fd; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_semaphore_win32; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_separate_shader_objects; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_separate_specular_color; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shader_framebuffer_fetch; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shader_group_vote; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shader_image_load_formatted; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shader_image_load_store; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shader_implicit_conversions; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shader_integer_mix; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shader_io_blocks; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shader_non_constant_global_initializers; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shader_pixel_local_storage; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shader_pixel_local_storage2; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shader_texture_lod; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shadow_funcs; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shadow_samplers; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_shared_texture_palette; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_sparse_texture; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_sparse_texture2; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_stencil_clear_tag; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_stencil_two_side; @@ -19421,11 +23240,15 @@ GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture3D; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_array; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_buffer_object; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_compression_astc_decode_mode; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_compression_astc_decode_mode_rgb9e5; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_compression_bptc; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_compression_dxt1; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_compression_latc; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_compression_rgtc; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_compression_s3tc; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_cube_map; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_cube_map_array; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_edge_clamp; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_env; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_env_add; @@ -19433,24 +23256,36 @@ GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_env_combine; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_env_dot3; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_filter_anisotropic; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_filter_minmax; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_format_BGRA8888; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_integer; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_lod_bias; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_mirror_clamp; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_norm16; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_object; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_perturb_normal; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_rectangle; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_rg; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_sRGB; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_sRGB_R8; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_sRGB_RG8; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_sRGB_decode; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_shared_exponent; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_snorm; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_storage; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_swizzle; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_type_2_10_10_10_REV; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_texture_view; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_timer_query; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_transform_feedback; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_unpack_subimage; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_vertex_array; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_vertex_array_bgra; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_vertex_array_setXXX; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_vertex_attrib_64bit; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_vertex_shader; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_vertex_weighting; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_win32_keyed_mutex; +GLEW_VAR_EXPORT GLboolean __GLEW_EXT_window_rectangles; GLEW_VAR_EXPORT GLboolean __GLEW_EXT_x11_sync_object; GLEW_VAR_EXPORT GLboolean __GLEW_GREMEDY_frame_terminator; GLEW_VAR_EXPORT GLboolean __GLEW_GREMEDY_string_marker; @@ -19466,6 +23301,7 @@ GLEW_VAR_EXPORT GLboolean __GLEW_IBM_texture_mirrored_repeat; GLEW_VAR_EXPORT GLboolean __GLEW_IBM_vertex_array_lists; GLEW_VAR_EXPORT GLboolean __GLEW_INGR_color_clamp; GLEW_VAR_EXPORT GLboolean __GLEW_INGR_interlace_read; +GLEW_VAR_EXPORT GLboolean __GLEW_INTEL_conservative_rasterization; GLEW_VAR_EXPORT GLboolean __GLEW_INTEL_fragment_shader_ordering; GLEW_VAR_EXPORT GLboolean __GLEW_INTEL_framebuffer_CMAA; GLEW_VAR_EXPORT GLboolean __GLEW_INTEL_map_texture; @@ -19477,37 +23313,56 @@ GLEW_VAR_EXPORT GLboolean __GLEW_KHR_blend_equation_advanced_coherent; GLEW_VAR_EXPORT GLboolean __GLEW_KHR_context_flush_control; GLEW_VAR_EXPORT GLboolean __GLEW_KHR_debug; GLEW_VAR_EXPORT GLboolean __GLEW_KHR_no_error; +GLEW_VAR_EXPORT GLboolean __GLEW_KHR_parallel_shader_compile; GLEW_VAR_EXPORT GLboolean __GLEW_KHR_robust_buffer_access_behavior; GLEW_VAR_EXPORT GLboolean __GLEW_KHR_robustness; GLEW_VAR_EXPORT GLboolean __GLEW_KHR_texture_compression_astc_hdr; GLEW_VAR_EXPORT GLboolean __GLEW_KHR_texture_compression_astc_ldr; +GLEW_VAR_EXPORT GLboolean __GLEW_KHR_texture_compression_astc_sliced_3d; GLEW_VAR_EXPORT GLboolean __GLEW_KTX_buffer_region; GLEW_VAR_EXPORT GLboolean __GLEW_MESAX_texture_stack; GLEW_VAR_EXPORT GLboolean __GLEW_MESA_pack_invert; GLEW_VAR_EXPORT GLboolean __GLEW_MESA_resize_buffers; +GLEW_VAR_EXPORT GLboolean __GLEW_MESA_shader_integer_functions; GLEW_VAR_EXPORT GLboolean __GLEW_MESA_window_pos; GLEW_VAR_EXPORT GLboolean __GLEW_MESA_ycbcr_texture; +GLEW_VAR_EXPORT GLboolean __GLEW_NVX_blend_equation_advanced_multi_draw_buffers; GLEW_VAR_EXPORT GLboolean __GLEW_NVX_conditional_render; GLEW_VAR_EXPORT GLboolean __GLEW_NVX_gpu_memory_info; +GLEW_VAR_EXPORT GLboolean __GLEW_NVX_linked_gpu_multicast; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_3dvision_settings; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_EGL_stream_consumer_external; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_alpha_to_coverage_dither_control; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_bgr; GLEW_VAR_EXPORT GLboolean __GLEW_NV_bindless_multi_draw_indirect; GLEW_VAR_EXPORT GLboolean __GLEW_NV_bindless_multi_draw_indirect_count; GLEW_VAR_EXPORT GLboolean __GLEW_NV_bindless_texture; GLEW_VAR_EXPORT GLboolean __GLEW_NV_blend_equation_advanced; GLEW_VAR_EXPORT GLboolean __GLEW_NV_blend_equation_advanced_coherent; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_blend_minmax_factor; GLEW_VAR_EXPORT GLboolean __GLEW_NV_blend_square; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_clip_space_w_scaling; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_command_list; GLEW_VAR_EXPORT GLboolean __GLEW_NV_compute_program5; GLEW_VAR_EXPORT GLboolean __GLEW_NV_conditional_render; GLEW_VAR_EXPORT GLboolean __GLEW_NV_conservative_raster; GLEW_VAR_EXPORT GLboolean __GLEW_NV_conservative_raster_dilate; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_conservative_raster_pre_snap_triangles; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_copy_buffer; GLEW_VAR_EXPORT GLboolean __GLEW_NV_copy_depth_to_color; GLEW_VAR_EXPORT GLboolean __GLEW_NV_copy_image; GLEW_VAR_EXPORT GLboolean __GLEW_NV_deep_texture3D; GLEW_VAR_EXPORT GLboolean __GLEW_NV_depth_buffer_float; GLEW_VAR_EXPORT GLboolean __GLEW_NV_depth_clamp; GLEW_VAR_EXPORT GLboolean __GLEW_NV_depth_range_unclamped; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_draw_buffers; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_draw_instanced; GLEW_VAR_EXPORT GLboolean __GLEW_NV_draw_texture; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_draw_vulkan_image; GLEW_VAR_EXPORT GLboolean __GLEW_NV_evaluators; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_explicit_attrib_location; GLEW_VAR_EXPORT GLboolean __GLEW_NV_explicit_multisample; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_fbo_color_attachments; GLEW_VAR_EXPORT GLboolean __GLEW_NV_fence; GLEW_VAR_EXPORT GLboolean __GLEW_NV_fill_rectangle; GLEW_VAR_EXPORT GLboolean __GLEW_NV_float_buffer; @@ -19518,52 +23373,82 @@ GLEW_VAR_EXPORT GLboolean __GLEW_NV_fragment_program2; GLEW_VAR_EXPORT GLboolean __GLEW_NV_fragment_program4; GLEW_VAR_EXPORT GLboolean __GLEW_NV_fragment_program_option; GLEW_VAR_EXPORT GLboolean __GLEW_NV_fragment_shader_interlock; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_framebuffer_blit; GLEW_VAR_EXPORT GLboolean __GLEW_NV_framebuffer_mixed_samples; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_framebuffer_multisample; GLEW_VAR_EXPORT GLboolean __GLEW_NV_framebuffer_multisample_coverage; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_generate_mipmap_sRGB; GLEW_VAR_EXPORT GLboolean __GLEW_NV_geometry_program4; GLEW_VAR_EXPORT GLboolean __GLEW_NV_geometry_shader4; GLEW_VAR_EXPORT GLboolean __GLEW_NV_geometry_shader_passthrough; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_gpu_multicast; GLEW_VAR_EXPORT GLboolean __GLEW_NV_gpu_program4; GLEW_VAR_EXPORT GLboolean __GLEW_NV_gpu_program5; GLEW_VAR_EXPORT GLboolean __GLEW_NV_gpu_program5_mem_extended; GLEW_VAR_EXPORT GLboolean __GLEW_NV_gpu_program_fp64; GLEW_VAR_EXPORT GLboolean __GLEW_NV_gpu_shader5; GLEW_VAR_EXPORT GLboolean __GLEW_NV_half_float; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_image_formats; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_instanced_arrays; GLEW_VAR_EXPORT GLboolean __GLEW_NV_internalformat_sample_query; GLEW_VAR_EXPORT GLboolean __GLEW_NV_light_max_exponent; GLEW_VAR_EXPORT GLboolean __GLEW_NV_multisample_coverage; GLEW_VAR_EXPORT GLboolean __GLEW_NV_multisample_filter_hint; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_non_square_matrices; GLEW_VAR_EXPORT GLboolean __GLEW_NV_occlusion_query; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_pack_subimage; GLEW_VAR_EXPORT GLboolean __GLEW_NV_packed_depth_stencil; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_packed_float; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_packed_float_linear; GLEW_VAR_EXPORT GLboolean __GLEW_NV_parameter_buffer_object; GLEW_VAR_EXPORT GLboolean __GLEW_NV_parameter_buffer_object2; GLEW_VAR_EXPORT GLboolean __GLEW_NV_path_rendering; GLEW_VAR_EXPORT GLboolean __GLEW_NV_path_rendering_shared_edge; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_pixel_buffer_object; GLEW_VAR_EXPORT GLboolean __GLEW_NV_pixel_data_range; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_platform_binary; GLEW_VAR_EXPORT GLboolean __GLEW_NV_point_sprite; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_polygon_mode; GLEW_VAR_EXPORT GLboolean __GLEW_NV_present_video; GLEW_VAR_EXPORT GLboolean __GLEW_NV_primitive_restart; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_read_depth; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_read_depth_stencil; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_read_stencil; GLEW_VAR_EXPORT GLboolean __GLEW_NV_register_combiners; GLEW_VAR_EXPORT GLboolean __GLEW_NV_register_combiners2; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_robustness_video_memory_purge; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_sRGB_formats; GLEW_VAR_EXPORT GLboolean __GLEW_NV_sample_locations; GLEW_VAR_EXPORT GLboolean __GLEW_NV_sample_mask_override_coverage; GLEW_VAR_EXPORT GLboolean __GLEW_NV_shader_atomic_counters; GLEW_VAR_EXPORT GLboolean __GLEW_NV_shader_atomic_float; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_shader_atomic_float64; GLEW_VAR_EXPORT GLboolean __GLEW_NV_shader_atomic_fp16_vector; GLEW_VAR_EXPORT GLboolean __GLEW_NV_shader_atomic_int64; GLEW_VAR_EXPORT GLboolean __GLEW_NV_shader_buffer_load; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_shader_noperspective_interpolation; GLEW_VAR_EXPORT GLboolean __GLEW_NV_shader_storage_buffer_object; GLEW_VAR_EXPORT GLboolean __GLEW_NV_shader_thread_group; GLEW_VAR_EXPORT GLboolean __GLEW_NV_shader_thread_shuffle; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_shadow_samplers_array; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_shadow_samplers_cube; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_stereo_view_rendering; GLEW_VAR_EXPORT GLboolean __GLEW_NV_tessellation_program5; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texgen_emboss; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texgen_reflection; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_array; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_barrier; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_border_clamp; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_compression_latc; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_compression_s3tc; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_compression_s3tc_update; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_compression_vtc; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_env_combine4; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_expand_normal; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_multisample; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_npot_2D_mipmap; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_rectangle; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_rectangle_compressed; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_shader; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_shader2; GLEW_VAR_EXPORT GLboolean __GLEW_NV_texture_shader3; @@ -19582,18 +23467,28 @@ GLEW_VAR_EXPORT GLboolean __GLEW_NV_vertex_program2_option; GLEW_VAR_EXPORT GLboolean __GLEW_NV_vertex_program3; GLEW_VAR_EXPORT GLboolean __GLEW_NV_vertex_program4; GLEW_VAR_EXPORT GLboolean __GLEW_NV_video_capture; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_viewport_array; GLEW_VAR_EXPORT GLboolean __GLEW_NV_viewport_array2; +GLEW_VAR_EXPORT GLboolean __GLEW_NV_viewport_swizzle; GLEW_VAR_EXPORT GLboolean __GLEW_OES_byte_coordinates; -GLEW_VAR_EXPORT GLboolean __GLEW_OES_compressed_paletted_texture; -GLEW_VAR_EXPORT GLboolean __GLEW_OES_read_format; -GLEW_VAR_EXPORT GLboolean __GLEW_OES_single_precision; GLEW_VAR_EXPORT GLboolean __GLEW_OML_interlace; GLEW_VAR_EXPORT GLboolean __GLEW_OML_resample; GLEW_VAR_EXPORT GLboolean __GLEW_OML_subsample; GLEW_VAR_EXPORT GLboolean __GLEW_OVR_multiview; GLEW_VAR_EXPORT GLboolean __GLEW_OVR_multiview2; +GLEW_VAR_EXPORT GLboolean __GLEW_OVR_multiview_multisampled_render_to_texture; GLEW_VAR_EXPORT GLboolean __GLEW_PGI_misc_hints; GLEW_VAR_EXPORT GLboolean __GLEW_PGI_vertex_hints; +GLEW_VAR_EXPORT GLboolean __GLEW_QCOM_alpha_test; +GLEW_VAR_EXPORT GLboolean __GLEW_QCOM_binning_control; +GLEW_VAR_EXPORT GLboolean __GLEW_QCOM_driver_control; +GLEW_VAR_EXPORT GLboolean __GLEW_QCOM_extended_get; +GLEW_VAR_EXPORT GLboolean __GLEW_QCOM_extended_get2; +GLEW_VAR_EXPORT GLboolean __GLEW_QCOM_framebuffer_foveated; +GLEW_VAR_EXPORT GLboolean __GLEW_QCOM_perfmon_global_mode; +GLEW_VAR_EXPORT GLboolean __GLEW_QCOM_shader_framebuffer_fetch_noncoherent; +GLEW_VAR_EXPORT GLboolean __GLEW_QCOM_tiled_rendering; +GLEW_VAR_EXPORT GLboolean __GLEW_QCOM_writeonly_rendering; GLEW_VAR_EXPORT GLboolean __GLEW_REGAL_ES1_0_compatibility; GLEW_VAR_EXPORT GLboolean __GLEW_REGAL_ES1_1_compatibility; GLEW_VAR_EXPORT GLboolean __GLEW_REGAL_enable; @@ -19603,13 +23498,17 @@ GLEW_VAR_EXPORT GLboolean __GLEW_REGAL_log; GLEW_VAR_EXPORT GLboolean __GLEW_REGAL_proc_address; GLEW_VAR_EXPORT GLboolean __GLEW_REND_screen_coordinates; GLEW_VAR_EXPORT GLboolean __GLEW_S3_s3tc; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIS_clip_band_hint; GLEW_VAR_EXPORT GLboolean __GLEW_SGIS_color_range; GLEW_VAR_EXPORT GLboolean __GLEW_SGIS_detail_texture; GLEW_VAR_EXPORT GLboolean __GLEW_SGIS_fog_function; GLEW_VAR_EXPORT GLboolean __GLEW_SGIS_generate_mipmap; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIS_line_texgen; GLEW_VAR_EXPORT GLboolean __GLEW_SGIS_multisample; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIS_multitexture; GLEW_VAR_EXPORT GLboolean __GLEW_SGIS_pixel_texture; GLEW_VAR_EXPORT GLboolean __GLEW_SGIS_point_line_texgen; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIS_shared_multisample; GLEW_VAR_EXPORT GLboolean __GLEW_SGIS_sharpen_texture; GLEW_VAR_EXPORT GLboolean __GLEW_SGIS_texture4D; GLEW_VAR_EXPORT GLboolean __GLEW_SGIS_texture_border_clamp; @@ -19620,37 +23519,90 @@ GLEW_VAR_EXPORT GLboolean __GLEW_SGIS_texture_select; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_async; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_async_histogram; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_async_pixel; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_bali_g_instruments; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_bali_r_instruments; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_bali_timer_instruments; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_blend_alpha_minmax; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_blend_cadd; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_blend_cmultiply; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_calligraphic_fragment; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_clipmap; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_color_matrix_accuracy; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_color_table_index_mode; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_complex_polar; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_convolution_accuracy; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_cube_map; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_cylinder_texgen; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_datapipe; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_decimation; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_depth_pass_instrument; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_depth_texture; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_dvc; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_flush_raster; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_fog_blend; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_fog_factor_to_alpha; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_fog_layers; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_fog_offset; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_fog_patchy; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_fog_scale; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_fog_texture; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_fragment_lighting_space; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_fragment_specular_lighting; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_fragments_instrument; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_framezoom; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_icc_texture; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_igloo_interface; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_image_compression; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_impact_pixel_texture; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_instrument_error; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_interlace; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_ir_instrument1; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_line_quality_hint; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_list_priority; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_mpeg1; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_mpeg2; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_nonlinear_lighting_pervertex; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_nurbs_eval; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_occlusion_instrument; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_packed_6bytes; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_pixel_texture; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_pixel_texture_bits; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_pixel_texture_lod; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_pixel_tiles; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_polynomial_ffd; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_quad_mesh; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_reference_plane; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_resample; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_scalebias_hint; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_shadow; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_shadow_ambient; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_slim; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_spotlight_cutoff; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_sprite; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_subdiv_patch; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_subsample; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_tag_sample_buffer; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_texture_add_env; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_texture_coordinate_clamp; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_texture_lod_bias; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_texture_mipmap_anisotropic; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_texture_multi_buffer; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_texture_phase; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_texture_range; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_texture_scale_bias; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_texture_supersample; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_vector_ops; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_vertex_array_object; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_vertex_preclip; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_vertex_preclip_hint; GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_ycrcb; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_ycrcb_subsample; +GLEW_VAR_EXPORT GLboolean __GLEW_SGIX_ycrcba; GLEW_VAR_EXPORT GLboolean __GLEW_SGI_color_matrix; GLEW_VAR_EXPORT GLboolean __GLEW_SGI_color_table; +GLEW_VAR_EXPORT GLboolean __GLEW_SGI_complex; +GLEW_VAR_EXPORT GLboolean __GLEW_SGI_complex_type; +GLEW_VAR_EXPORT GLboolean __GLEW_SGI_fft; GLEW_VAR_EXPORT GLboolean __GLEW_SGI_texture_color_table; GLEW_VAR_EXPORT GLboolean __GLEW_SUNX_constant_data; GLEW_VAR_EXPORT GLboolean __GLEW_SUN_convolution_border_modes; @@ -19661,13 +23613,9 @@ GLEW_VAR_EXPORT GLboolean __GLEW_SUN_slice_accum; GLEW_VAR_EXPORT GLboolean __GLEW_SUN_triangle_list; GLEW_VAR_EXPORT GLboolean __GLEW_SUN_vertex; GLEW_VAR_EXPORT GLboolean __GLEW_WIN_phong_shading; +GLEW_VAR_EXPORT GLboolean __GLEW_WIN_scene_markerXXX; GLEW_VAR_EXPORT GLboolean __GLEW_WIN_specular_fog; GLEW_VAR_EXPORT GLboolean __GLEW_WIN_swap_hint; - -#ifdef GLEW_MX -}; /* GLEWContextStruct */ -#endif /* GLEW_MX */ - /* ------------------------------------------------------------------------- */ /* error codes */ @@ -19676,6 +23624,7 @@ GLEW_VAR_EXPORT GLboolean __GLEW_WIN_swap_hint; #define GLEW_ERROR_NO_GL_VERSION 1 /* missing GL version */ #define GLEW_ERROR_GL_VERSION_10_ONLY 2 /* Need at least OpenGL 1.1 */ #define GLEW_ERROR_GLX_VERSION_11_ONLY 3 /* Need at least GLX 1.2 */ +#define GLEW_ERROR_NO_GLX_DISPLAY 4 /* Need GLX display for GLX support */ /* string codes */ #define GLEW_VERSION 1 @@ -19688,40 +23637,24 @@ GLEW_VAR_EXPORT GLboolean __GLEW_WIN_swap_hint; /* GLEW version info */ /* -VERSION 1.13.0 -VERSION_MAJOR 1 -VERSION_MINOR 13 +VERSION 2.1.0 +VERSION_MAJOR 2 +VERSION_MINOR 1 VERSION_MICRO 0 */ /* API */ -#ifdef GLEW_MX - -typedef struct GLEWContextStruct GLEWContext; -GLEWAPI GLenum GLEWAPIENTRY glewContextInit (GLEWContext *ctx); -GLEWAPI GLboolean GLEWAPIENTRY glewContextIsSupported (const GLEWContext *ctx, const char *name); - -#define glewInit() glewContextInit(glewGetContext()) -#define glewIsSupported(x) glewContextIsSupported(glewGetContext(), x) -#define glewIsExtensionSupported(x) glewIsSupported(x) - -#define GLEW_GET_VAR(x) (*(const GLboolean*)&(glewGetContext()->x)) -#ifdef _WIN32 -# define GLEW_GET_FUN(x) glewGetContext()->x -#else -# define GLEW_GET_FUN(x) x -#endif - -#else /* GLEW_MX */ - GLEWAPI GLenum GLEWAPIENTRY glewInit (void); GLEWAPI GLboolean GLEWAPIENTRY glewIsSupported (const char *name); #define glewIsExtensionSupported(x) glewIsSupported(x) +#ifndef GLEW_GET_VAR #define GLEW_GET_VAR(x) (*(const GLboolean*)&x) -#define GLEW_GET_FUN(x) x +#endif -#endif /* GLEW_MX */ +#ifndef GLEW_GET_FUN +#define GLEW_GET_FUN(x) x +#endif GLEWAPI GLboolean glewExperimental; GLEWAPI GLboolean GLEWAPIENTRY glewGetExtension (const char *name); diff --git a/external/include/GL/glxew.h b/external/include/GL/glxew.h index d803d260b..7e39c2fd9 100644 --- a/external/include/GL/glxew.h +++ b/external/include/GL/glxew.h @@ -1,6 +1,6 @@ /* ** The OpenGL Extension Wrangler Library -** Copyright (C) 2008-2015, Nigel Stewart +** Copyright (C) 2008-2017, Nigel Stewart ** Copyright (C) 2002-2008, Milan Ikits ** Copyright (C) 2002-2008, Marcelo E. Magallon ** Copyright (C) 2002, Lev Povalahev @@ -392,10 +392,6 @@ typedef Bool ( * PFNGLXMAKEASSOCIATEDCONTEXTCURRENTAMDPROC) (GLXContext ctx); #ifndef GLX_ARB_context_flush_control #define GLX_ARB_context_flush_control 1 -#define GLX_CONTEXT_RELEASE_BEHAVIOR_NONE_ARB 0x0000 -#define GLX_CONTEXT_RELEASE_BEHAVIOR_ARB 0x2097 -#define GLX_CONTEXT_RELEASE_BEHAVIOR_FLUSH_ARB 0x2098 - #define GLXEW_ARB_context_flush_control GLXEW_GET_VAR(__GLXEW_ARB_context_flush_control) #endif /* GLX_ARB_context_flush_control */ @@ -419,6 +415,15 @@ typedef GLXContext ( * PFNGLXCREATECONTEXTATTRIBSARBPROC) (Display* dpy, GLXFBCo #endif /* GLX_ARB_create_context */ +/* -------------------- GLX_ARB_create_context_no_error -------------------- */ + +#ifndef GLX_ARB_create_context_no_error +#define GLX_ARB_create_context_no_error 1 + +#define GLXEW_ARB_create_context_no_error GLXEW_GET_VAR(__GLXEW_ARB_create_context_no_error) + +#endif /* GLX_ARB_create_context_no_error */ + /* --------------------- GLX_ARB_create_context_profile -------------------- */ #ifndef GLX_ARB_create_context_profile @@ -670,6 +675,17 @@ typedef int ( * PFNGLXQUERYCONTEXTINFOEXTPROC) (Display* dpy, GLXContext context #endif /* GLX_EXT_import_context */ +/* ---------------------------- GLX_EXT_libglvnd --------------------------- */ + +#ifndef GLX_EXT_libglvnd +#define GLX_EXT_libglvnd 1 + +#define GLX_VENDOR_NAMES_EXT 0x20F6 + +#define GLXEW_EXT_libglvnd GLXEW_GET_VAR(__GLXEW_EXT_libglvnd) + +#endif /* GLX_EXT_libglvnd */ + /* -------------------------- GLX_EXT_scene_marker ------------------------- */ #ifndef GLX_EXT_scene_marker @@ -1015,6 +1031,17 @@ typedef unsigned int* ( * PFNGLXENUMERATEVIDEODEVICESNVPROC) (Display *dpy, int #endif /* GLX_NV_present_video */ +/* ------------------ GLX_NV_robustness_video_memory_purge ----------------- */ + +#ifndef GLX_NV_robustness_video_memory_purge +#define GLX_NV_robustness_video_memory_purge 1 + +#define GLX_GENERATE_RESET_ON_VIDEO_MEMORY_PURGE_NV 0x20F7 + +#define GLXEW_NV_robustness_video_memory_purge GLXEW_GET_VAR(__GLXEW_NV_robustness_video_memory_purge) + +#endif /* GLX_NV_robustness_video_memory_purge */ + /* --------------------------- GLX_NV_swap_group --------------------------- */ #ifndef GLX_NV_swap_group @@ -1500,13 +1527,8 @@ typedef int ( * PFNGLXVIDEORESIZESUNPROC) (Display* display, GLXDrawable window, /* ------------------------------------------------------------------------- */ -#ifdef GLEW_MX -#define GLXEW_FUN_EXPORT GLEW_FUN_EXPORT -#define GLXEW_VAR_EXPORT -#else #define GLXEW_FUN_EXPORT GLEW_FUN_EXPORT #define GLXEW_VAR_EXPORT GLEW_VAR_EXPORT -#endif /* GLEW_MX */ GLXEW_FUN_EXPORT PFNGLXGETCURRENTDISPLAYPROC __glewXGetCurrentDisplay; @@ -1658,12 +1680,6 @@ GLXEW_FUN_EXPORT PFNGLXGETTRANSPARENTINDEXSUNPROC __glewXGetTransparentIndexSUN; GLXEW_FUN_EXPORT PFNGLXGETVIDEORESIZESUNPROC __glewXGetVideoResizeSUN; GLXEW_FUN_EXPORT PFNGLXVIDEORESIZESUNPROC __glewXVideoResizeSUN; - -#if defined(GLEW_MX) -struct GLXEWContextStruct -{ -#endif /* GLEW_MX */ - GLXEW_VAR_EXPORT GLboolean __GLXEW_VERSION_1_0; GLXEW_VAR_EXPORT GLboolean __GLXEW_VERSION_1_1; GLXEW_VAR_EXPORT GLboolean __GLXEW_VERSION_1_2; @@ -1673,6 +1689,7 @@ GLXEW_VAR_EXPORT GLboolean __GLXEW_3DFX_multisample; GLXEW_VAR_EXPORT GLboolean __GLXEW_AMD_gpu_association; GLXEW_VAR_EXPORT GLboolean __GLXEW_ARB_context_flush_control; GLXEW_VAR_EXPORT GLboolean __GLXEW_ARB_create_context; +GLXEW_VAR_EXPORT GLboolean __GLXEW_ARB_create_context_no_error; GLXEW_VAR_EXPORT GLboolean __GLXEW_ARB_create_context_profile; GLXEW_VAR_EXPORT GLboolean __GLXEW_ARB_create_context_robustness; GLXEW_VAR_EXPORT GLboolean __GLXEW_ARB_fbconfig_float; @@ -1690,6 +1707,7 @@ GLXEW_VAR_EXPORT GLboolean __GLXEW_EXT_create_context_es_profile; GLXEW_VAR_EXPORT GLboolean __GLXEW_EXT_fbconfig_packed_float; GLXEW_VAR_EXPORT GLboolean __GLXEW_EXT_framebuffer_sRGB; GLXEW_VAR_EXPORT GLboolean __GLXEW_EXT_import_context; +GLXEW_VAR_EXPORT GLboolean __GLXEW_EXT_libglvnd; GLXEW_VAR_EXPORT GLboolean __GLXEW_EXT_scene_marker; GLXEW_VAR_EXPORT GLboolean __GLXEW_EXT_stereo_tree; GLXEW_VAR_EXPORT GLboolean __GLXEW_EXT_swap_control; @@ -1711,6 +1729,7 @@ GLXEW_VAR_EXPORT GLboolean __GLXEW_NV_delay_before_swap; GLXEW_VAR_EXPORT GLboolean __GLXEW_NV_float_buffer; GLXEW_VAR_EXPORT GLboolean __GLXEW_NV_multisample_coverage; GLXEW_VAR_EXPORT GLboolean __GLXEW_NV_present_video; +GLXEW_VAR_EXPORT GLboolean __GLXEW_NV_robustness_video_memory_purge; GLXEW_VAR_EXPORT GLboolean __GLXEW_NV_swap_group; GLXEW_VAR_EXPORT GLboolean __GLXEW_NV_vertex_array_range; GLXEW_VAR_EXPORT GLboolean __GLXEW_NV_video_capture; @@ -1734,34 +1753,18 @@ GLXEW_VAR_EXPORT GLboolean __GLXEW_SGI_swap_control; GLXEW_VAR_EXPORT GLboolean __GLXEW_SGI_video_sync; GLXEW_VAR_EXPORT GLboolean __GLXEW_SUN_get_transparent_index; GLXEW_VAR_EXPORT GLboolean __GLXEW_SUN_video_resize; - -#ifdef GLEW_MX -}; /* GLXEWContextStruct */ -#endif /* GLEW_MX */ - /* ------------------------------------------------------------------------ */ -#ifdef GLEW_MX - -typedef struct GLXEWContextStruct GLXEWContext; -GLEWAPI GLenum GLEWAPIENTRY glxewContextInit (GLXEWContext *ctx); -GLEWAPI GLboolean GLEWAPIENTRY glxewContextIsSupported (const GLXEWContext *ctx, const char *name); - -#define glxewInit() glxewContextInit(glxewGetContext()) -#define glxewIsSupported(x) glxewContextIsSupported(glxewGetContext(), x) - -#define GLXEW_GET_VAR(x) (*(const GLboolean*)&(glxewGetContext()->x)) -#define GLXEW_GET_FUN(x) x - -#else /* GLEW_MX */ - GLEWAPI GLenum GLEWAPIENTRY glxewInit (); GLEWAPI GLboolean GLEWAPIENTRY glxewIsSupported (const char *name); +#ifndef GLXEW_GET_VAR #define GLXEW_GET_VAR(x) (*(const GLboolean*)&x) -#define GLXEW_GET_FUN(x) x +#endif -#endif /* GLEW_MX */ +#ifndef GLXEW_GET_FUN +#define GLXEW_GET_FUN(x) x +#endif GLEWAPI GLboolean GLEWAPIENTRY glxewGetExtension (const char *name); diff --git a/external/include/GL/wglew.h b/external/include/GL/wglew.h index 23e4d3fba..2097c0f03 100644 --- a/external/include/GL/wglew.h +++ b/external/include/GL/wglew.h @@ -1,6 +1,6 @@ /* ** The OpenGL Extension Wrangler Library -** Copyright (C) 2008-2015, Nigel Stewart +** Copyright (C) 2008-2017, Nigel Stewart ** Copyright (C) 2002-2008, Milan Ikits ** Copyright (C) 2002-2008, Marcelo E. Magallon ** Copyright (C) 2002, Lev Povalahev @@ -188,10 +188,6 @@ typedef BOOL (WINAPI * PFNWGLSAVEBUFFERREGIONARBPROC) (HANDLE hRegion, int x, in #ifndef WGL_ARB_context_flush_control #define WGL_ARB_context_flush_control 1 -#define WGL_CONTEXT_RELEASE_BEHAVIOR_NONE_ARB 0x0000 -#define WGL_CONTEXT_RELEASE_BEHAVIOR_ARB 0x2097 -#define WGL_CONTEXT_RELEASE_BEHAVIOR_FLUSH_ARB 0x2098 - #define WGLEW_ARB_context_flush_control WGLEW_GET_VAR(__WGLEW_ARB_context_flush_control) #endif /* WGL_ARB_context_flush_control */ @@ -218,6 +214,15 @@ typedef HGLRC (WINAPI * PFNWGLCREATECONTEXTATTRIBSARBPROC) (HDC hDC, HGLRC hShar #endif /* WGL_ARB_create_context */ +/* -------------------- WGL_ARB_create_context_no_error -------------------- */ + +#ifndef WGL_ARB_create_context_no_error +#define WGL_ARB_create_context_no_error 1 + +#define WGLEW_ARB_create_context_no_error WGLEW_GET_VAR(__WGLEW_ARB_create_context_no_error) + +#endif /* WGL_ARB_create_context_no_error */ + /* --------------------- WGL_ARB_create_context_profile -------------------- */ #ifndef WGL_ARB_create_context_profile @@ -506,6 +511,19 @@ typedef BOOL (WINAPI * PFNWGLSETPBUFFERATTRIBARBPROC) (HPBUFFERARB hPbuffer, con #endif /* WGL_ATI_render_texture_rectangle */ +/* --------------------------- WGL_EXT_colorspace -------------------------- */ + +#ifndef WGL_EXT_colorspace +#define WGL_EXT_colorspace 1 + +#define WGL_COLORSPACE_SRGB_EXT 0x3089 +#define WGL_COLORSPACE_LINEAR_EXT 0x308A +#define WGL_COLORSPACE_EXT 0x309D + +#define WGLEW_EXT_colorspace WGLEW_GET_VAR(__WGLEW_EXT_colorspace) + +#endif /* WGL_EXT_colorspace */ + /* ------------------- WGL_EXT_create_context_es2_profile ------------------ */ #ifndef WGL_EXT_create_context_es2_profile @@ -1197,18 +1215,8 @@ typedef BOOL (WINAPI * PFNWGLWAITFORSBCOMLPROC) (HDC hdc, INT64 target_sbc, INT6 /* ------------------------------------------------------------------------- */ -#ifdef GLEW_MX -#define WGLEW_FUN_EXPORT -#define WGLEW_VAR_EXPORT -#else #define WGLEW_FUN_EXPORT GLEW_FUN_EXPORT #define WGLEW_VAR_EXPORT GLEW_VAR_EXPORT -#endif /* GLEW_MX */ - -#ifdef GLEW_MX -struct WGLEWContextStruct -{ -#endif /* GLEW_MX */ WGLEW_FUN_EXPORT PFNWGLSETSTEREOEMITTERSTATE3DLPROC __wglewSetStereoEmitterState3DL; @@ -1365,6 +1373,7 @@ WGLEW_VAR_EXPORT GLboolean __WGLEW_AMD_gpu_association; WGLEW_VAR_EXPORT GLboolean __WGLEW_ARB_buffer_region; WGLEW_VAR_EXPORT GLboolean __WGLEW_ARB_context_flush_control; WGLEW_VAR_EXPORT GLboolean __WGLEW_ARB_create_context; +WGLEW_VAR_EXPORT GLboolean __WGLEW_ARB_create_context_no_error; WGLEW_VAR_EXPORT GLboolean __WGLEW_ARB_create_context_profile; WGLEW_VAR_EXPORT GLboolean __WGLEW_ARB_create_context_robustness; WGLEW_VAR_EXPORT GLboolean __WGLEW_ARB_extensions_string; @@ -1379,6 +1388,7 @@ WGLEW_VAR_EXPORT GLboolean __WGLEW_ARB_robustness_application_isolation; WGLEW_VAR_EXPORT GLboolean __WGLEW_ARB_robustness_share_group_isolation; WGLEW_VAR_EXPORT GLboolean __WGLEW_ATI_pixel_format_float; WGLEW_VAR_EXPORT GLboolean __WGLEW_ATI_render_texture_rectangle; +WGLEW_VAR_EXPORT GLboolean __WGLEW_EXT_colorspace; WGLEW_VAR_EXPORT GLboolean __WGLEW_EXT_create_context_es2_profile; WGLEW_VAR_EXPORT GLboolean __WGLEW_EXT_create_context_es_profile; WGLEW_VAR_EXPORT GLboolean __WGLEW_EXT_depth_float; @@ -1413,34 +1423,18 @@ WGLEW_VAR_EXPORT GLboolean __WGLEW_NV_vertex_array_range; WGLEW_VAR_EXPORT GLboolean __WGLEW_NV_video_capture; WGLEW_VAR_EXPORT GLboolean __WGLEW_NV_video_output; WGLEW_VAR_EXPORT GLboolean __WGLEW_OML_sync_control; - -#ifdef GLEW_MX -}; /* WGLEWContextStruct */ -#endif /* GLEW_MX */ - /* ------------------------------------------------------------------------- */ -#ifdef GLEW_MX - -typedef struct WGLEWContextStruct WGLEWContext; -GLEWAPI GLenum GLEWAPIENTRY wglewContextInit (WGLEWContext *ctx); -GLEWAPI GLboolean GLEWAPIENTRY wglewContextIsSupported (const WGLEWContext *ctx, const char *name); - -#define wglewInit() wglewContextInit(wglewGetContext()) -#define wglewIsSupported(x) wglewContextIsSupported(wglewGetContext(), x) - -#define WGLEW_GET_VAR(x) (*(const GLboolean*)&(wglewGetContext()->x)) -#define WGLEW_GET_FUN(x) wglewGetContext()->x - -#else /* GLEW_MX */ - GLEWAPI GLenum GLEWAPIENTRY wglewInit (); GLEWAPI GLboolean GLEWAPIENTRY wglewIsSupported (const char *name); +#ifndef WGLEW_GET_VAR #define WGLEW_GET_VAR(x) (*(const GLboolean*)&x) -#define WGLEW_GET_FUN(x) x +#endif -#endif /* GLEW_MX */ +#ifndef WGLEW_GET_FUN +#define WGLEW_GET_FUN(x) x +#endif GLEWAPI GLboolean GLEWAPIENTRY wglewGetExtension (const char *name); diff --git a/external/include/GLFW/glfw3.h b/external/include/GLFW/glfw3.h index 009fa755f..0521d1980 100644 --- a/external/include/GLFW/glfw3.h +++ b/external/include/GLFW/glfw3.h @@ -1,9 +1,9 @@ /************************************************************************* - * GLFW 3.1 - www.glfw.org + * GLFW 3.3 - www.glfw.org * A library for OpenGL, window and input *------------------------------------------------------------------------ * Copyright (c) 2002-2006 Marcus Geelnard - * Copyright (c) 2006-2010 Camilla Berglund + * Copyright (c) 2006-2019 Camilla Löwy * * This software is provided 'as-is', without any express or implied * warranty. In no event will the authors be held liable for any damages @@ -38,32 +38,51 @@ extern "C" { * Doxygen documentation *************************************************************************/ -/*! @defgroup context Context handling +/*! @file glfw3.h + * @brief The header of the GLFW 3 API. * - * This is the reference documentation for context related functions. For more - * information, see the @ref context. + * This is the header file of the GLFW 3 API. It defines all its types and + * declares all its functions. + * + * For more information about how to use this file, see @ref build_include. + */ +/*! @defgroup context Context reference + * @brief Functions and types related to OpenGL and OpenGL ES contexts. + * + * This is the reference documentation for OpenGL and OpenGL ES context related + * functions. For more task-oriented information, see the @ref context_guide. + */ +/*! @defgroup vulkan Vulkan reference + * @brief Functions and types related to Vulkan. + * + * This is the reference documentation for Vulkan related functions and types. + * For more task-oriented information, see the @ref vulkan_guide. */ -/*! @defgroup init Initialization, version and errors +/*! @defgroup init Initialization, version and error reference + * @brief Functions and types related to initialization and error handling. * * This is the reference documentation for initialization and termination of - * the library, version management and error handling. For more information, - * see the @ref intro. + * the library, version management and error handling. For more task-oriented + * information, see the @ref intro_guide. */ -/*! @defgroup input Input handling +/*! @defgroup input Input reference + * @brief Functions and types related to input handling. * * This is the reference documentation for input related functions and types. - * For more information, see the @ref input. + * For more task-oriented information, see the @ref input_guide. */ -/*! @defgroup monitor Monitor handling +/*! @defgroup monitor Monitor reference + * @brief Functions and types related to monitors. * * This is the reference documentation for monitor related functions and types. - * For more information, see the @ref monitor. + * For more task-oriented information, see the @ref monitor_guide. */ -/*! @defgroup window Window handling +/*! @defgroup window Window reference + * @brief Functions and types related to windows. * * This is the reference documentation for window related functions and types, - * including creation, deletion and event polling. For more information, see - * the @ref window. + * including creation, deletion and event polling. For more task-oriented + * information, see the @ref window_guide. */ @@ -86,6 +105,7 @@ extern "C" { #else #define APIENTRY #endif + #define GLFW_APIENTRY_DEFINED #endif /* APIENTRY */ /* Some Windows OpenGL headers need this. @@ -102,70 +122,105 @@ extern "C" { #define GLFW_CALLBACK_DEFINED #endif /* CALLBACK */ -/* Most Windows GLU headers need wchar_t. - * The OS X OpenGL header blocks the definition of ptrdiff_t by glext.h. +/* Include because most Windows GLU headers need wchar_t and + * the macOS OpenGL header blocks the definition of ptrdiff_t by glext.h. + * Include it unconditionally to avoid surprising side-effects. */ -#if !defined(GLFW_INCLUDE_NONE) - #include -#endif +#include + +/* Include because it is needed by Vulkan and related functions. + * Include it unconditionally to avoid surprising side-effects. + */ +#include -/* Include the chosen client API headers. +/* Include the chosen OpenGL or OpenGL ES headers. */ -#if defined(__APPLE_CC__) - #if defined(GLFW_INCLUDE_GLCOREARB) +#if defined(GLFW_INCLUDE_ES1) + + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + +#elif defined(GLFW_INCLUDE_ES2) + + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + +#elif defined(GLFW_INCLUDE_ES3) + + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + +#elif defined(GLFW_INCLUDE_ES31) + + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + +#elif defined(GLFW_INCLUDE_ES32) + + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + +#elif defined(GLFW_INCLUDE_GLCOREARB) + + #if defined(__APPLE__) + #include #if defined(GLFW_INCLUDE_GLEXT) #include - #endif - #elif !defined(GLFW_INCLUDE_NONE) + #endif /*GLFW_INCLUDE_GLEXT*/ + + #else /*__APPLE__*/ + + #include + + #endif /*__APPLE__*/ + +#elif !defined(GLFW_INCLUDE_NONE) + + #if defined(__APPLE__) + #if !defined(GLFW_INCLUDE_GLEXT) #define GL_GLEXT_LEGACY #endif #include - #endif - #if defined(GLFW_INCLUDE_GLU) - #include - #endif -#else - #if defined(GLFW_INCLUDE_GLCOREARB) - #include - #elif defined(GLFW_INCLUDE_ES1) - #include - #if defined(GLFW_INCLUDE_GLEXT) - #include - #endif - #elif defined(GLFW_INCLUDE_ES2) - #include - #if defined(GLFW_INCLUDE_GLEXT) - #include + #if defined(GLFW_INCLUDE_GLU) + #include #endif - #elif defined(GLFW_INCLUDE_ES3) - #include - #if defined(GLFW_INCLUDE_GLEXT) - #include - #endif - #elif defined(GLFW_INCLUDE_ES31) - #include - #if defined(GLFW_INCLUDE_GLEXT) - #include - #endif - #elif !defined(GLFW_INCLUDE_NONE) + + #else /*__APPLE__*/ + #include #if defined(GLFW_INCLUDE_GLEXT) #include #endif - #endif - #if defined(GLFW_INCLUDE_GLU) - #include - #endif -#endif + #if defined(GLFW_INCLUDE_GLU) + #include + #endif + + #endif /*__APPLE__*/ + +#endif /* OpenGL and OpenGL ES headers */ + +#if defined(GLFW_INCLUDE_VULKAN) + #include +#endif /* Vulkan header */ #if defined(GLFW_DLL) && defined(_GLFW_BUILD_DLL) /* GLFW_DLL must be defined by applications that are linking against the DLL * version of the GLFW library. _GLFW_BUILD_DLL is defined by the GLFW * configuration header when compiling the DLL version of the library. */ - #error "You may not have both GLFW_DLL and _GLFW_BUILD_DLL defined" + #error "You must not have both GLFW_DLL and _GLFW_BUILD_DLL defined" #endif /* GLFWAPI is used to declare public API functions for export @@ -204,16 +259,35 @@ extern "C" { * backward-compatible. * @ingroup init */ -#define GLFW_VERSION_MINOR 1 +#define GLFW_VERSION_MINOR 3 /*! @brief The revision number of the GLFW library. * * This is incremented when a bug fix release is made that does not contain any * API changes. * @ingroup init */ -#define GLFW_VERSION_REVISION 1 +#define GLFW_VERSION_REVISION 0 /*! @} */ +/*! @brief One. + * + * This is only semantic sugar for the number 1. You can instead use `1` or + * `true` or `_True` or `GL_TRUE` or `VK_TRUE` or anything else that is equal + * to one. + * + * @ingroup init + */ +#define GLFW_TRUE 1 +/*! @brief Zero. + * + * This is only semantic sugar for the number 0. You can instead use `0` or + * `false` or `_False` or `GL_FALSE` or `VK_FALSE` or anything else that is + * equal to zero. + * + * @ingroup init + */ +#define GLFW_FALSE 0 + /*! @name Key and button actions * @{ */ /*! @brief The key or mouse button was released. @@ -239,7 +313,26 @@ extern "C" { #define GLFW_REPEAT 2 /*! @} */ +/*! @defgroup hat_state Joystick hat states + * @brief Joystick hat states. + * + * See [joystick hat input](@ref joystick_hat) for how these are used. + * + * @ingroup input + * @{ */ +#define GLFW_HAT_CENTERED 0 +#define GLFW_HAT_UP 1 +#define GLFW_HAT_RIGHT 2 +#define GLFW_HAT_DOWN 4 +#define GLFW_HAT_LEFT 8 +#define GLFW_HAT_RIGHT_UP (GLFW_HAT_RIGHT | GLFW_HAT_UP) +#define GLFW_HAT_RIGHT_DOWN (GLFW_HAT_RIGHT | GLFW_HAT_DOWN) +#define GLFW_HAT_LEFT_UP (GLFW_HAT_LEFT | GLFW_HAT_UP) +#define GLFW_HAT_LEFT_DOWN (GLFW_HAT_LEFT | GLFW_HAT_DOWN) +/*! @} */ + /*! @defgroup keys Keyboard keys + * @brief Keyboard key IDs. * * See [key input](@ref input_key) for how these are used. * @@ -388,11 +481,13 @@ extern "C" { #define GLFW_KEY_RIGHT_ALT 346 #define GLFW_KEY_RIGHT_SUPER 347 #define GLFW_KEY_MENU 348 + #define GLFW_KEY_LAST GLFW_KEY_MENU /*! @} */ /*! @defgroup mods Modifier key flags + * @brief Modifier key flags. * * See [key input](@ref input_key) for how these are used. * @@ -400,21 +495,42 @@ extern "C" { * @{ */ /*! @brief If this bit is set one or more Shift keys were held down. + * + * If this bit is set one or more Shift keys were held down. */ #define GLFW_MOD_SHIFT 0x0001 /*! @brief If this bit is set one or more Control keys were held down. + * + * If this bit is set one or more Control keys were held down. */ #define GLFW_MOD_CONTROL 0x0002 /*! @brief If this bit is set one or more Alt keys were held down. + * + * If this bit is set one or more Alt keys were held down. */ #define GLFW_MOD_ALT 0x0004 /*! @brief If this bit is set one or more Super keys were held down. + * + * If this bit is set one or more Super keys were held down. */ #define GLFW_MOD_SUPER 0x0008 +/*! @brief If this bit is set the Caps Lock key is enabled. + * + * If this bit is set the Caps Lock key is enabled and the @ref + * GLFW_LOCK_KEY_MODS input mode is set. + */ +#define GLFW_MOD_CAPS_LOCK 0x0010 +/*! @brief If this bit is set the Num Lock key is enabled. + * + * If this bit is set the Num Lock key is enabled and the @ref + * GLFW_LOCK_KEY_MODS input mode is set. + */ +#define GLFW_MOD_NUM_LOCK 0x0020 /*! @} */ /*! @defgroup buttons Mouse buttons + * @brief Mouse button IDs. * * See [mouse button input](@ref input_mouse_button) for how these are used. * @@ -435,6 +551,7 @@ extern "C" { /*! @} */ /*! @defgroup joysticks Joysticks + * @brief Joystick IDs. * * See [joystick input](@ref joystick) for how these are used. * @@ -459,20 +576,73 @@ extern "C" { #define GLFW_JOYSTICK_LAST GLFW_JOYSTICK_16 /*! @} */ +/*! @defgroup gamepad_buttons Gamepad buttons + * @brief Gamepad buttons. + * + * See @ref gamepad for how these are used. + * + * @ingroup input + * @{ */ +#define GLFW_GAMEPAD_BUTTON_A 0 +#define GLFW_GAMEPAD_BUTTON_B 1 +#define GLFW_GAMEPAD_BUTTON_X 2 +#define GLFW_GAMEPAD_BUTTON_Y 3 +#define GLFW_GAMEPAD_BUTTON_LEFT_BUMPER 4 +#define GLFW_GAMEPAD_BUTTON_RIGHT_BUMPER 5 +#define GLFW_GAMEPAD_BUTTON_BACK 6 +#define GLFW_GAMEPAD_BUTTON_START 7 +#define GLFW_GAMEPAD_BUTTON_GUIDE 8 +#define GLFW_GAMEPAD_BUTTON_LEFT_THUMB 9 +#define GLFW_GAMEPAD_BUTTON_RIGHT_THUMB 10 +#define GLFW_GAMEPAD_BUTTON_DPAD_UP 11 +#define GLFW_GAMEPAD_BUTTON_DPAD_RIGHT 12 +#define GLFW_GAMEPAD_BUTTON_DPAD_DOWN 13 +#define GLFW_GAMEPAD_BUTTON_DPAD_LEFT 14 +#define GLFW_GAMEPAD_BUTTON_LAST GLFW_GAMEPAD_BUTTON_DPAD_LEFT + +#define GLFW_GAMEPAD_BUTTON_CROSS GLFW_GAMEPAD_BUTTON_A +#define GLFW_GAMEPAD_BUTTON_CIRCLE GLFW_GAMEPAD_BUTTON_B +#define GLFW_GAMEPAD_BUTTON_SQUARE GLFW_GAMEPAD_BUTTON_X +#define GLFW_GAMEPAD_BUTTON_TRIANGLE GLFW_GAMEPAD_BUTTON_Y +/*! @} */ + +/*! @defgroup gamepad_axes Gamepad axes + * @brief Gamepad axes. + * + * See @ref gamepad for how these are used. + * + * @ingroup input + * @{ */ +#define GLFW_GAMEPAD_AXIS_LEFT_X 0 +#define GLFW_GAMEPAD_AXIS_LEFT_Y 1 +#define GLFW_GAMEPAD_AXIS_RIGHT_X 2 +#define GLFW_GAMEPAD_AXIS_RIGHT_Y 3 +#define GLFW_GAMEPAD_AXIS_LEFT_TRIGGER 4 +#define GLFW_GAMEPAD_AXIS_RIGHT_TRIGGER 5 +#define GLFW_GAMEPAD_AXIS_LAST GLFW_GAMEPAD_AXIS_RIGHT_TRIGGER +/*! @} */ + /*! @defgroup errors Error codes + * @brief Error codes. * * See [error handling](@ref error_handling) for how these are used. * * @ingroup init * @{ */ +/*! @brief No error has occurred. + * + * No error has occurred. + * + * @analysis Yay. + */ +#define GLFW_NO_ERROR 0 /*! @brief GLFW has not been initialized. * - * This occurs if a GLFW function was called that may not be called unless the + * This occurs if a GLFW function was called that must not be called unless the * library is [initialized](@ref intro_init). * - * @par Analysis - * Application programmer error. Initialize GLFW before calling any function - * that requires initialization. + * @analysis Application programmer error. Initialize GLFW before calling any + * function that requires initialization. */ #define GLFW_NOT_INITIALIZED 0x00010001 /*! @brief No context is current for this thread. @@ -481,19 +651,16 @@ extern "C" { * current OpenGL or OpenGL ES context but no context is current on the calling * thread. One such function is @ref glfwSwapInterval. * - * @par Analysis - * Application programmer error. Ensure a context is current before calling - * functions that require a current context. + * @analysis Application programmer error. Ensure a context is current before + * calling functions that require a current context. */ #define GLFW_NO_CURRENT_CONTEXT 0x00010002 /*! @brief One of the arguments to the function was an invalid enum value. * * One of the arguments to the function was an invalid enum value, for example - * requesting [GLFW_RED_BITS](@ref window_hints_fb) with @ref - * glfwGetWindowAttrib. + * requesting @ref GLFW_RED_BITS with @ref glfwGetWindowAttrib. * - * @par Analysis - * Application programmer error. Fix the offending call. + * @analysis Application programmer error. Fix the offending call. */ #define GLFW_INVALID_ENUM 0x00010003 /*! @brief One of the arguments to the function was an invalid value. @@ -504,37 +671,31 @@ extern "C" { * Requesting a valid but unavailable OpenGL or OpenGL ES version will instead * result in a @ref GLFW_VERSION_UNAVAILABLE error. * - * @par Analysis - * Application programmer error. Fix the offending call. + * @analysis Application programmer error. Fix the offending call. */ #define GLFW_INVALID_VALUE 0x00010004 /*! @brief A memory allocation failed. * * A memory allocation failed. * - * @par Analysis - * A bug in GLFW or the underlying operating system. Report the bug to our - * [issue tracker](https://github.com/glfw/glfw/issues). + * @analysis A bug in GLFW or the underlying operating system. Report the bug + * to our [issue tracker](https://github.com/glfw/glfw/issues). */ #define GLFW_OUT_OF_MEMORY 0x00010005 -/*! @brief GLFW could not find support for the requested client API on the - * system. +/*! @brief GLFW could not find support for the requested API on the system. * - * GLFW could not find support for the requested client API on the system. If - * emitted by functions other than @ref glfwCreateWindow, no supported client - * API was found. + * GLFW could not find support for the requested API on the system. * - * @par Analysis - * The installed graphics driver does not support the requested client API, or - * does not support it via the chosen context creation backend. Below are - * a few examples. + * @analysis The installed graphics driver does not support the requested + * API, or does not support it via the chosen context creation backend. + * Below are a few examples. * * @par * Some pre-installed Windows graphics drivers do not support OpenGL. AMD only - * supports OpenGL ES via EGL, while Nvidia and Intel only supports it via - * a WGL or GLX extension. OS X does not provide OpenGL ES at all. The Mesa + * supports OpenGL ES via EGL, while Nvidia and Intel only support it via + * a WGL or GLX extension. macOS does not provide OpenGL ES at all. The Mesa * EGL, OpenGL and OpenGL ES libraries do not interface with the Nvidia binary - * driver. + * driver. Older graphics drivers do not support Vulkan. */ #define GLFW_API_UNAVAILABLE 0x00010006 /*! @brief The requested OpenGL or OpenGL ES version is not available. @@ -542,10 +703,9 @@ extern "C" { * The requested OpenGL or OpenGL ES version (including any requested context * or framebuffer hints) is not available on this machine. * - * @par Analysis - * The machine does not support your requirements. If your application is - * sufficiently flexible, downgrade your requirements and try again. - * Otherwise, inform the user that their machine does not match your + * @analysis The machine does not support your requirements. If your + * application is sufficiently flexible, downgrade your requirements and try + * again. Otherwise, inform the user that their machine does not match your * requirements. * * @par @@ -561,10 +721,9 @@ extern "C" { * A platform-specific error occurred that does not match any of the more * specific categories. * - * @par Analysis - * A bug or configuration error in GLFW, the underlying operating system or - * its drivers, or a lack of required resources. Report the issue to our - * [issue tracker](https://github.com/glfw/glfw/issues). + * @analysis A bug or configuration error in GLFW, the underlying operating + * system or its drivers, or a lack of required resources. Report the issue to + * our [issue tracker](https://github.com/glfw/glfw/issues). */ #define GLFW_PLATFORM_ERROR 0x00010008 /*! @brief The requested format is not supported or available. @@ -575,8 +734,7 @@ extern "C" { * If emitted when querying the clipboard, the contents of the clipboard could * not be converted to the requested format. * - * @par Analysis - * If emitted during window creation, one or more + * @analysis If emitted during window creation, one or more * [hard constraints](@ref window_hints_hard) did not match any of the * available pixel formats. If your application is sufficiently flexible, * downgrade your requirements and try again. Otherwise, inform the user that @@ -587,43 +745,263 @@ extern "C" { * the user, as appropriate. */ #define GLFW_FORMAT_UNAVAILABLE 0x00010009 +/*! @brief The specified window does not have an OpenGL or OpenGL ES context. + * + * A window that does not have an OpenGL or OpenGL ES context was passed to + * a function that requires it to have one. + * + * @analysis Application programmer error. Fix the offending call. + */ +#define GLFW_NO_WINDOW_CONTEXT 0x0001000A /*! @} */ +/*! @addtogroup window + * @{ */ +/*! @brief Input focus window hint and attribute + * + * Input focus [window hint](@ref GLFW_FOCUSED_hint) or + * [window attribute](@ref GLFW_FOCUSED_attrib). + */ #define GLFW_FOCUSED 0x00020001 +/*! @brief Window iconification window attribute + * + * Window iconification [window attribute](@ref GLFW_ICONIFIED_attrib). + */ #define GLFW_ICONIFIED 0x00020002 +/*! @brief Window resize-ability window hint and attribute + * + * Window resize-ability [window hint](@ref GLFW_RESIZABLE_hint) and + * [window attribute](@ref GLFW_RESIZABLE_attrib). + */ #define GLFW_RESIZABLE 0x00020003 +/*! @brief Window visibility window hint and attribute + * + * Window visibility [window hint](@ref GLFW_VISIBLE_hint) and + * [window attribute](@ref GLFW_VISIBLE_attrib). + */ #define GLFW_VISIBLE 0x00020004 +/*! @brief Window decoration window hint and attribute + * + * Window decoration [window hint](@ref GLFW_DECORATED_hint) and + * [window attribute](@ref GLFW_DECORATED_attrib). + */ #define GLFW_DECORATED 0x00020005 +/*! @brief Window auto-iconification window hint and attribute + * + * Window auto-iconification [window hint](@ref GLFW_AUTO_ICONIFY_hint) and + * [window attribute](@ref GLFW_AUTO_ICONIFY_attrib). + */ #define GLFW_AUTO_ICONIFY 0x00020006 +/*! @brief Window decoration window hint and attribute + * + * Window decoration [window hint](@ref GLFW_FLOATING_hint) and + * [window attribute](@ref GLFW_FLOATING_attrib). + */ #define GLFW_FLOATING 0x00020007 +/*! @brief Window maximization window hint and attribute + * + * Window maximization [window hint](@ref GLFW_MAXIMIZED_hint) and + * [window attribute](@ref GLFW_MAXIMIZED_attrib). + */ +#define GLFW_MAXIMIZED 0x00020008 +/*! @brief Cursor centering window hint + * + * Cursor centering [window hint](@ref GLFW_CENTER_CURSOR_hint). + */ +#define GLFW_CENTER_CURSOR 0x00020009 +/*! @brief Window framebuffer transparency hint and attribute + * + * Window framebuffer transparency + * [window hint](@ref GLFW_TRANSPARENT_FRAMEBUFFER_hint) and + * [window attribute](@ref GLFW_TRANSPARENT_FRAMEBUFFER_attrib). + */ +#define GLFW_TRANSPARENT_FRAMEBUFFER 0x0002000A +/*! @brief Mouse cursor hover window attribute. + * + * Mouse cursor hover [window attribute](@ref GLFW_HOVERED_attrib). + */ +#define GLFW_HOVERED 0x0002000B +/*! @brief Input focus on calling show window hint and attribute + * + * Input focus [window hint](@ref GLFW_FOCUS_ON_SHOW_hint) or + * [window attribute](@ref GLFW_FOCUS_ON_SHOW_attrib). + */ +#define GLFW_FOCUS_ON_SHOW 0x0002000C +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_RED_BITS). + */ #define GLFW_RED_BITS 0x00021001 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_GREEN_BITS). + */ #define GLFW_GREEN_BITS 0x00021002 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_BLUE_BITS). + */ #define GLFW_BLUE_BITS 0x00021003 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_ALPHA_BITS). + */ #define GLFW_ALPHA_BITS 0x00021004 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_DEPTH_BITS). + */ #define GLFW_DEPTH_BITS 0x00021005 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_STENCIL_BITS). + */ #define GLFW_STENCIL_BITS 0x00021006 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_ACCUM_RED_BITS). + */ #define GLFW_ACCUM_RED_BITS 0x00021007 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_ACCUM_GREEN_BITS). + */ #define GLFW_ACCUM_GREEN_BITS 0x00021008 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_ACCUM_BLUE_BITS). + */ #define GLFW_ACCUM_BLUE_BITS 0x00021009 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_ACCUM_ALPHA_BITS). + */ #define GLFW_ACCUM_ALPHA_BITS 0x0002100A +/*! @brief Framebuffer auxiliary buffer hint. + * + * Framebuffer auxiliary buffer [hint](@ref GLFW_AUX_BUFFERS). + */ #define GLFW_AUX_BUFFERS 0x0002100B +/*! @brief OpenGL stereoscopic rendering hint. + * + * OpenGL stereoscopic rendering [hint](@ref GLFW_STEREO). + */ #define GLFW_STEREO 0x0002100C +/*! @brief Framebuffer MSAA samples hint. + * + * Framebuffer MSAA samples [hint](@ref GLFW_SAMPLES). + */ #define GLFW_SAMPLES 0x0002100D +/*! @brief Framebuffer sRGB hint. + * + * Framebuffer sRGB [hint](@ref GLFW_SRGB_CAPABLE). + */ #define GLFW_SRGB_CAPABLE 0x0002100E +/*! @brief Monitor refresh rate hint. + * + * Monitor refresh rate [hint](@ref GLFW_REFRESH_RATE). + */ #define GLFW_REFRESH_RATE 0x0002100F +/*! @brief Framebuffer double buffering hint. + * + * Framebuffer double buffering [hint](@ref GLFW_DOUBLEBUFFER). + */ #define GLFW_DOUBLEBUFFER 0x00021010 +/*! @brief Context client API hint and attribute. + * + * Context client API [hint](@ref GLFW_CLIENT_API_hint) and + * [attribute](@ref GLFW_CLIENT_API_attrib). + */ #define GLFW_CLIENT_API 0x00022001 +/*! @brief Context client API major version hint and attribute. + * + * Context client API major version [hint](@ref GLFW_CLIENT_API_hint) and + * [attribute](@ref GLFW_CLIENT_API_attrib). + */ #define GLFW_CONTEXT_VERSION_MAJOR 0x00022002 +/*! @brief Context client API minor version hint and attribute. + * + * Context client API minor version [hint](@ref GLFW_CLIENT_API_hint) and + * [attribute](@ref GLFW_CLIENT_API_attrib). + */ #define GLFW_CONTEXT_VERSION_MINOR 0x00022003 +/*! @brief Context client API revision number hint and attribute. + * + * Context client API revision number [hint](@ref GLFW_CLIENT_API_hint) and + * [attribute](@ref GLFW_CLIENT_API_attrib). + */ #define GLFW_CONTEXT_REVISION 0x00022004 +/*! @brief Context robustness hint and attribute. + * + * Context client API revision number [hint](@ref GLFW_CLIENT_API_hint) and + * [attribute](@ref GLFW_CLIENT_API_attrib). + */ #define GLFW_CONTEXT_ROBUSTNESS 0x00022005 +/*! @brief OpenGL forward-compatibility hint and attribute. + * + * OpenGL forward-compatibility [hint](@ref GLFW_CLIENT_API_hint) and + * [attribute](@ref GLFW_CLIENT_API_attrib). + */ #define GLFW_OPENGL_FORWARD_COMPAT 0x00022006 +/*! @brief OpenGL debug context hint and attribute. + * + * OpenGL debug context [hint](@ref GLFW_CLIENT_API_hint) and + * [attribute](@ref GLFW_CLIENT_API_attrib). + */ #define GLFW_OPENGL_DEBUG_CONTEXT 0x00022007 +/*! @brief OpenGL profile hint and attribute. + * + * OpenGL profile [hint](@ref GLFW_CLIENT_API_hint) and + * [attribute](@ref GLFW_CLIENT_API_attrib). + */ #define GLFW_OPENGL_PROFILE 0x00022008 +/*! @brief Context flush-on-release hint and attribute. + * + * Context flush-on-release [hint](@ref GLFW_CLIENT_API_hint) and + * [attribute](@ref GLFW_CLIENT_API_attrib). + */ #define GLFW_CONTEXT_RELEASE_BEHAVIOR 0x00022009 +/*! @brief Context error suppression hint and attribute. + * + * Context error suppression [hint](@ref GLFW_CLIENT_API_hint) and + * [attribute](@ref GLFW_CLIENT_API_attrib). + */ +#define GLFW_CONTEXT_NO_ERROR 0x0002200A +/*! @brief Context creation API hint and attribute. + * + * Context creation API [hint](@ref GLFW_CLIENT_API_hint) and + * [attribute](@ref GLFW_CLIENT_API_attrib). + */ +#define GLFW_CONTEXT_CREATION_API 0x0002200B +/*! @brief Window content area scaling window + * [window hint](@ref GLFW_SCALE_TO_MONITOR). + */ +#define GLFW_SCALE_TO_MONITOR 0x0002200C +/*! @brief macOS specific + * [window hint](@ref GLFW_COCOA_RETINA_FRAMEBUFFER_hint). + */ +#define GLFW_COCOA_RETINA_FRAMEBUFFER 0x00023001 +/*! @brief macOS specific + * [window hint](@ref GLFW_COCOA_FRAME_NAME_hint). + */ +#define GLFW_COCOA_FRAME_NAME 0x00023002 +/*! @brief macOS specific + * [window hint](@ref GLFW_COCOA_GRAPHICS_SWITCHING_hint). + */ +#define GLFW_COCOA_GRAPHICS_SWITCHING 0x00023003 +/*! @brief X11 specific + * [window hint](@ref GLFW_X11_CLASS_NAME_hint). + */ +#define GLFW_X11_CLASS_NAME 0x00024001 +/*! @brief X11 specific + * [window hint](@ref GLFW_X11_CLASS_NAME_hint). + */ +#define GLFW_X11_INSTANCE_NAME 0x00024002 +/*! @} */ +#define GLFW_NO_API 0 #define GLFW_OPENGL_API 0x00030001 #define GLFW_OPENGL_ES_API 0x00030002 @@ -638,6 +1016,8 @@ extern "C" { #define GLFW_CURSOR 0x00033001 #define GLFW_STICKY_KEYS 0x00033002 #define GLFW_STICKY_MOUSE_BUTTONS 0x00033003 +#define GLFW_LOCK_KEY_MODS 0x00033004 +#define GLFW_RAW_MOUSE_MOTION 0x00033005 #define GLFW_CURSOR_NORMAL 0x00034001 #define GLFW_CURSOR_HIDDEN 0x00034002 @@ -647,7 +1027,12 @@ extern "C" { #define GLFW_RELEASE_BEHAVIOR_FLUSH 0x00035001 #define GLFW_RELEASE_BEHAVIOR_NONE 0x00035002 +#define GLFW_NATIVE_CONTEXT_API 0x00036001 +#define GLFW_EGL_CONTEXT_API 0x00036002 +#define GLFW_OSMESA_CONTEXT_API 0x00036003 + /*! @defgroup shapes Standard cursor shapes + * @brief Standard system cursor shapes. * * See [standard cursor creation](@ref cursor_standard) for how these are used. * @@ -689,6 +1074,25 @@ extern "C" { #define GLFW_CONNECTED 0x00040001 #define GLFW_DISCONNECTED 0x00040002 +/*! @addtogroup init + * @{ */ +/*! @brief Joystick hat buttons init hint. + * + * Joystick hat buttons [init hint](@ref GLFW_JOYSTICK_HAT_BUTTONS). + */ +#define GLFW_JOYSTICK_HAT_BUTTONS 0x00050001 +/*! @brief macOS specific init hint. + * + * macOS specific [init hint](@ref GLFW_COCOA_CHDIR_RESOURCES_hint). + */ +#define GLFW_COCOA_CHDIR_RESOURCES 0x00051001 +/*! @brief macOS specific init hint. + * + * macOS specific [init hint](@ref GLFW_COCOA_MENUBAR_hint). + */ +#define GLFW_COCOA_MENUBAR 0x00051002 +/*! @} */ + #define GLFW_DONT_CARE -1 @@ -701,14 +1105,37 @@ extern "C" { * Generic function pointer used for returning client API function pointers * without forcing a cast from a regular pointer. * + * @sa @ref context_glext + * @sa @ref glfwGetProcAddress + * + * @since Added in version 3.0. + * * @ingroup context */ typedef void (*GLFWglproc)(void); +/*! @brief Vulkan API function pointer type. + * + * Generic function pointer used for returning Vulkan API function pointers + * without forcing a cast from a regular pointer. + * + * @sa @ref vulkan_proc + * @sa @ref glfwGetInstanceProcAddress + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +typedef void (*GLFWvkproc)(void); + /*! @brief Opaque monitor object. * * Opaque monitor object. * + * @see @ref monitor_object + * + * @since Added in version 3.0. + * * @ingroup monitor */ typedef struct GLFWmonitor GLFWmonitor; @@ -717,6 +1144,10 @@ typedef struct GLFWmonitor GLFWmonitor; * * Opaque window object. * + * @see @ref window_object + * + * @since Added in version 3.0. + * * @ingroup window */ typedef struct GLFWwindow GLFWwindow; @@ -725,7 +1156,11 @@ typedef struct GLFWwindow GLFWwindow; * * Opaque cursor object. * - * @ingroup cursor + * @see @ref cursor_object + * + * @since Added in version 3.1. + * + * @ingroup input */ typedef struct GLFWcursor GLFWcursor; @@ -736,7 +1171,10 @@ typedef struct GLFWcursor GLFWcursor; * @param[in] error An [error code](@ref errors). * @param[in] description A UTF-8 encoded string describing the error. * - * @sa glfwSetErrorCallback + * @sa @ref error_handling + * @sa @ref glfwSetErrorCallback + * + * @since Added in version 3.0. * * @ingroup init */ @@ -748,11 +1186,14 @@ typedef void (* GLFWerrorfun)(int,const char*); * * @param[in] window The window that was moved. * @param[in] xpos The new x-coordinate, in screen coordinates, of the - * upper-left corner of the client area of the window. + * upper-left corner of the content area of the window. * @param[in] ypos The new y-coordinate, in screen coordinates, of the - * upper-left corner of the client area of the window. + * upper-left corner of the content area of the window. + * + * @sa @ref window_pos + * @sa @ref glfwSetWindowPosCallback * - * @sa glfwSetWindowPosCallback + * @since Added in version 3.0. * * @ingroup window */ @@ -766,7 +1207,11 @@ typedef void (* GLFWwindowposfun)(GLFWwindow*,int,int); * @param[in] width The new width, in screen coordinates, of the window. * @param[in] height The new height, in screen coordinates, of the window. * - * @sa glfwSetWindowSizeCallback + * @sa @ref window_size + * @sa @ref glfwSetWindowSizeCallback + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. * * @ingroup window */ @@ -778,7 +1223,11 @@ typedef void (* GLFWwindowsizefun)(GLFWwindow*,int,int); * * @param[in] window The window that the user attempted to close. * - * @sa glfwSetWindowCloseCallback + * @sa @ref window_close + * @sa @ref glfwSetWindowCloseCallback + * + * @since Added in version 2.5. + * @glfw3 Added window handle parameter. * * @ingroup window */ @@ -790,7 +1239,11 @@ typedef void (* GLFWwindowclosefun)(GLFWwindow*); * * @param[in] window The window whose content needs to be refreshed. * - * @sa glfwSetWindowRefreshCallback + * @sa @ref window_refresh + * @sa @ref glfwSetWindowRefreshCallback + * + * @since Added in version 2.5. + * @glfw3 Added window handle parameter. * * @ingroup window */ @@ -801,10 +1254,13 @@ typedef void (* GLFWwindowrefreshfun)(GLFWwindow*); * This is the function signature for window focus callback functions. * * @param[in] window The window that gained or lost input focus. - * @param[in] focused `GL_TRUE` if the window was given input focus, or - * `GL_FALSE` if it lost it. + * @param[in] focused `GLFW_TRUE` if the window was given input focus, or + * `GLFW_FALSE` if it lost it. + * + * @sa @ref window_focus + * @sa @ref glfwSetWindowFocusCallback * - * @sa glfwSetWindowFocusCallback + * @since Added in version 3.0. * * @ingroup window */ @@ -816,15 +1272,36 @@ typedef void (* GLFWwindowfocusfun)(GLFWwindow*,int); * functions. * * @param[in] window The window that was iconified or restored. - * @param[in] iconified `GL_TRUE` if the window was iconified, or `GL_FALSE` - * if it was restored. + * @param[in] iconified `GLFW_TRUE` if the window was iconified, or + * `GLFW_FALSE` if it was restored. * - * @sa glfwSetWindowIconifyCallback + * @sa @ref window_iconify + * @sa @ref glfwSetWindowIconifyCallback + * + * @since Added in version 3.0. * * @ingroup window */ typedef void (* GLFWwindowiconifyfun)(GLFWwindow*,int); +/*! @brief The function signature for window maximize/restore callbacks. + * + * This is the function signature for window maximize/restore callback + * functions. + * + * @param[in] window The window that was maximized or restored. + * @param[in] iconified `GLFW_TRUE` if the window was maximized, or + * `GLFW_FALSE` if it was restored. + * + * @sa @ref window_maximize + * @sa glfwSetWindowMaximizeCallback + * + * @since Added in version 3.3. + * + * @ingroup window + */ +typedef void (* GLFWwindowmaximizefun)(GLFWwindow*,int); + /*! @brief The function signature for framebuffer resize callbacks. * * This is the function signature for framebuffer resize callback @@ -834,12 +1311,33 @@ typedef void (* GLFWwindowiconifyfun)(GLFWwindow*,int); * @param[in] width The new width, in pixels, of the framebuffer. * @param[in] height The new height, in pixels, of the framebuffer. * - * @sa glfwSetFramebufferSizeCallback + * @sa @ref window_fbsize + * @sa @ref glfwSetFramebufferSizeCallback + * + * @since Added in version 3.0. * * @ingroup window */ typedef void (* GLFWframebuffersizefun)(GLFWwindow*,int,int); +/*! @brief The function signature for window content scale callbacks. + * + * This is the function signature for window content scale callback + * functions. + * + * @param[in] window The window whose content scale changed. + * @param[in] xscale The new x-axis content scale of the window. + * @param[in] yscale The new y-axis content scale of the window. + * + * @sa @ref window_scale + * @sa @ref glfwSetWindowContentScaleCallback + * + * @since Added in version 3.3. + * + * @ingroup window + */ +typedef void (* GLFWwindowcontentscalefun)(GLFWwindow*,float,float); + /*! @brief The function signature for mouse button callbacks. * * This is the function signature for mouse button callback functions. @@ -851,7 +1349,11 @@ typedef void (* GLFWframebuffersizefun)(GLFWwindow*,int,int); * @param[in] mods Bit field describing which [modifier keys](@ref mods) were * held down. * - * @sa glfwSetMouseButtonCallback + * @sa @ref input_mouse_button + * @sa @ref glfwSetMouseButtonCallback + * + * @since Added in version 1.0. + * @glfw3 Added window handle and modifier mask parameters. * * @ingroup input */ @@ -862,10 +1364,15 @@ typedef void (* GLFWmousebuttonfun)(GLFWwindow*,int,int,int); * This is the function signature for cursor position callback functions. * * @param[in] window The window that received the event. - * @param[in] xpos The new x-coordinate, in screen coordinates, of the cursor. - * @param[in] ypos The new y-coordinate, in screen coordinates, of the cursor. + * @param[in] xpos The new cursor x-coordinate, relative to the left edge of + * the content area. + * @param[in] ypos The new cursor y-coordinate, relative to the top edge of the + * content area. * - * @sa glfwSetCursorPosCallback + * @sa @ref cursor_pos + * @sa @ref glfwSetCursorPosCallback + * + * @since Added in version 3.0. Replaces `GLFWmouseposfun`. * * @ingroup input */ @@ -876,10 +1383,13 @@ typedef void (* GLFWcursorposfun)(GLFWwindow*,double,double); * This is the function signature for cursor enter/leave callback functions. * * @param[in] window The window that received the event. - * @param[in] entered `GL_TRUE` if the cursor entered the window's client - * area, or `GL_FALSE` if it left it. + * @param[in] entered `GLFW_TRUE` if the cursor entered the window's content + * area, or `GLFW_FALSE` if it left it. + * + * @sa @ref cursor_enter + * @sa @ref glfwSetCursorEnterCallback * - * @sa glfwSetCursorEnterCallback + * @since Added in version 3.0. * * @ingroup input */ @@ -893,7 +1403,10 @@ typedef void (* GLFWcursorenterfun)(GLFWwindow*,int); * @param[in] xoffset The scroll offset along the x-axis. * @param[in] yoffset The scroll offset along the y-axis. * - * @sa glfwSetScrollCallback + * @sa @ref scrolling + * @sa @ref glfwSetScrollCallback + * + * @since Added in version 3.0. Replaces `GLFWmousewheelfun`. * * @ingroup input */ @@ -910,7 +1423,11 @@ typedef void (* GLFWscrollfun)(GLFWwindow*,double,double); * @param[in] mods Bit field describing which [modifier keys](@ref mods) were * held down. * - * @sa glfwSetKeyCallback + * @sa @ref input_key + * @sa @ref glfwSetKeyCallback + * + * @since Added in version 1.0. + * @glfw3 Added window handle, scancode and modifier mask parameters. * * @ingroup input */ @@ -923,7 +1440,11 @@ typedef void (* GLFWkeyfun)(GLFWwindow*,int,int,int,int); * @param[in] window The window that received the event. * @param[in] codepoint The Unicode code point of the character. * - * @sa glfwSetCharCallback + * @sa @ref input_char + * @sa @ref glfwSetCharCallback + * + * @since Added in version 2.4. + * @glfw3 Added window handle parameter. * * @ingroup input */ @@ -941,9 +1462,14 @@ typedef void (* GLFWcharfun)(GLFWwindow*,unsigned int); * @param[in] mods Bit field describing which [modifier keys](@ref mods) were * held down. * - * @sa glfwSetCharModsCallback + * @sa @ref input_char + * @sa @ref glfwSetCharModsCallback * - * @ingroup input + * @deprecated Scheduled for removal in version 4.0. + * + * @since Added in version 3.1. + * + * @ingroup input */ typedef void (* GLFWcharmodsfun)(GLFWwindow*,unsigned int,int); @@ -955,7 +1481,10 @@ typedef void (* GLFWcharmodsfun)(GLFWwindow*,unsigned int,int); * @param[in] count The number of dropped files. * @param[in] paths The UTF-8 encoded file and/or directory path names. * - * @sa glfwSetDropCallback + * @sa @ref path_drop + * @sa @ref glfwSetDropCallback + * + * @since Added in version 3.1. * * @ingroup input */ @@ -966,18 +1495,47 @@ typedef void (* GLFWdropfun)(GLFWwindow*,int,const char**); * This is the function signature for monitor configuration callback functions. * * @param[in] monitor The monitor that was connected or disconnected. - * @param[in] event One of `GLFW_CONNECTED` or `GLFW_DISCONNECTED`. + * @param[in] event One of `GLFW_CONNECTED` or `GLFW_DISCONNECTED`. Remaining + * values reserved for future use. + * + * @sa @ref monitor_event + * @sa @ref glfwSetMonitorCallback * - * @sa glfwSetMonitorCallback + * @since Added in version 3.0. * * @ingroup monitor */ typedef void (* GLFWmonitorfun)(GLFWmonitor*,int); +/*! @brief The function signature for joystick configuration callbacks. + * + * This is the function signature for joystick configuration callback + * functions. + * + * @param[in] jid The joystick that was connected or disconnected. + * @param[in] event One of `GLFW_CONNECTED` or `GLFW_DISCONNECTED`. Remaining + * values reserved for future use. + * + * @sa @ref joystick_event + * @sa @ref glfwSetJoystickCallback + * + * @since Added in version 3.2. + * + * @ingroup input + */ +typedef void (* GLFWjoystickfun)(int,int); + /*! @brief Video mode type. * * This describes a single video mode. * + * @sa @ref monitor_modes + * @sa @ref glfwGetVideoMode + * @sa @ref glfwGetVideoModes + * + * @since Added in version 1.0. + * @glfw3 Added refresh rate member. + * * @ingroup monitor */ typedef struct GLFWvidmode @@ -1006,7 +1564,11 @@ typedef struct GLFWvidmode * * This describes the gamma ramp for a monitor. * - * @sa glfwGetGammaRamp glfwSetGammaRamp + * @sa @ref monitor_gamma + * @sa @ref glfwGetGammaRamp + * @sa @ref glfwSetGammaRamp + * + * @since Added in version 3.0. * * @ingroup monitor */ @@ -1027,6 +1589,17 @@ typedef struct GLFWgammaramp } GLFWgammaramp; /*! @brief Image data. + * + * This describes a single 2D image. See the documentation for each related + * function what the expected pixel format is. + * + * @sa @ref cursor_custom + * @sa @ref window_icon + * + * @since Added in version 2.1. + * @glfw3 Removed format and bytes-per-pixel members. + * + * @ingroup window */ typedef struct GLFWimage { @@ -1041,6 +1614,29 @@ typedef struct GLFWimage unsigned char* pixels; } GLFWimage; +/*! @brief Gamepad input state + * + * This describes the input state of a gamepad. + * + * @sa @ref gamepad + * @sa @ref glfwGetGamepadState + * + * @since Added in version 3.3. + * + * @ingroup input + */ +typedef struct GLFWgamepadstate +{ + /*! The states of each [gamepad button](@ref gamepad_buttons), `GLFW_PRESS` + * or `GLFW_RELEASE`. + */ + unsigned char buttons[15]; + /*! The states of each [gamepad axis](@ref gamepad_axes), in the range -1.0 + * to 1.0 inclusive. + */ + float axes[6]; +} GLFWgamepadstate; + /************************************************************************* * GLFW API functions @@ -1057,29 +1653,24 @@ typedef struct GLFWimage * succeeds, you should call @ref glfwTerminate before the application exits. * * Additional calls to this function after successful initialization but before - * termination will return `GL_TRUE` immediately. + * termination will return `GLFW_TRUE` immediately. * - * @return `GL_TRUE` if successful, or `GL_FALSE` if an + * @return `GLFW_TRUE` if successful, or `GLFW_FALSE` if an * [error](@ref error_handling) occurred. * - * @remarks __OS X:__ This function will change the current directory of the - * application to the `Contents/Resources` subdirectory of the application's - * bundle, if present. This can be disabled with a - * [compile-time option](@ref compile_options_osx). + * @errors Possible errors include @ref GLFW_PLATFORM_ERROR. * - * @remarks __X11:__ If the `LC_CTYPE` category of the current locale is set to - * `"C"` then the environment's locale will be applied to that category. This - * is done because character input will not function when `LC_CTYPE` is set to - * `"C"`. If another locale was set before this function was called, it will - * be left untouched. + * @remark @macos This function will change the current directory of the + * application to the `Contents/Resources` subdirectory of the application's + * bundle, if present. This can be disabled with the @ref + * GLFW_COCOA_CHDIR_RESOURCES init hint. * - * @par Thread Safety - * This function may only be called from the main thread. + * @thread_safety This function must only be called from the main thread. * * @sa @ref intro_init - * @sa glfwTerminate + * @sa @ref glfwTerminate * - * @since Added in GLFW 1.0. + * @since Added in version 1.0. * * @ingroup init */ @@ -1097,48 +1688,80 @@ GLFWAPI int glfwInit(void); * call this function, as it is called by @ref glfwInit before it returns * failure. * - * @remarks This function may be called before @ref glfwInit. + * @errors Possible errors include @ref GLFW_PLATFORM_ERROR. * - * @warning No window's context may be current on another thread when this - * function is called. + * @remark This function may be called before @ref glfwInit. * - * @par Reentrancy - * This function may not be called from a callback. + * @warning The contexts of any remaining windows must not be current on any + * other thread when this function is called. * - * @par Thread Safety - * This function may only be called from the main thread. + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref intro_init - * @sa glfwInit + * @sa @ref glfwInit * - * @since Added in GLFW 1.0. + * @since Added in version 1.0. * * @ingroup init */ GLFWAPI void glfwTerminate(void); +/*! @brief Sets the specified init hint to the desired value. + * + * This function sets hints for the next initialization of GLFW. + * + * The values you set hints to are never reset by GLFW, but they only take + * effect during initialization. Once GLFW has been initialized, any values + * you set will be ignored until the library is terminated and initialized + * again. + * + * Some hints are platform specific. These may be set on any platform but they + * will only affect their specific platform. Other platforms will ignore them. + * Setting these hints requires no platform specific headers or functions. + * + * @param[in] hint The [init hint](@ref init_hints) to set. + * @param[in] value The new value of the init hint. + * + * @errors Possible errors include @ref GLFW_INVALID_ENUM and @ref + * GLFW_INVALID_VALUE. + * + * @remarks This function may be called before @ref glfwInit. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa init_hints + * @sa glfwInit + * + * @since Added in version 3.3. + * + * @ingroup init + */ +GLFWAPI void glfwInitHint(int hint, int value); + /*! @brief Retrieves the version of the GLFW library. * * This function retrieves the major, minor and revision numbers of the GLFW * library. It is intended for when you are using GLFW as a shared library and * want to ensure that you are using the minimum required version. * - * Any or all of the version arguments may be `NULL`. This function always - * succeeds. + * Any or all of the version arguments may be `NULL`. * * @param[out] major Where to store the major version number, or `NULL`. * @param[out] minor Where to store the minor version number, or `NULL`. * @param[out] rev Where to store the revision number, or `NULL`. * - * @remarks This function may be called before @ref glfwInit. + * @errors None. * - * @par Thread Safety - * This function may be called from any thread. + * @remark This function may be called before @ref glfwInit. + * + * @thread_safety This function may be called from any thread. * * @sa @ref intro_version - * @sa glfwGetVersionString + * @sa @ref glfwGetVersionString * - * @since Added in GLFW 1.0. + * @since Added in version 1.0. * * @ingroup init */ @@ -1149,38 +1772,72 @@ GLFWAPI void glfwGetVersion(int* major, int* minor, int* rev); * This function returns the compile-time generated * [version string](@ref intro_version_string) of the GLFW library binary. It * describes the version, platform, compiler and any platform-specific - * compile-time options. + * compile-time options. It should not be confused with the OpenGL or OpenGL + * ES version string, queried with `glGetString`. * * __Do not use the version string__ to parse the GLFW library version. The - * @ref glfwGetVersion function already provides the version of the running - * library binary. + * @ref glfwGetVersion function provides the version of the running library + * binary in numerical format. * - * This function always succeeds. + * @return The ASCII encoded GLFW version string. * - * @return The GLFW version string. + * @errors None. * - * @remarks This function may be called before @ref glfwInit. + * @remark This function may be called before @ref glfwInit. * - * @par Pointer Lifetime - * The returned string is static and compile-time generated. + * @pointer_lifetime The returned string is static and compile-time generated. * - * @par Thread Safety - * This function may be called from any thread. + * @thread_safety This function may be called from any thread. * * @sa @ref intro_version - * @sa glfwGetVersion + * @sa @ref glfwGetVersion * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup init */ GLFWAPI const char* glfwGetVersionString(void); +/*! @brief Returns and clears the last error for the calling thread. + * + * This function returns and clears the [error code](@ref errors) of the last + * error that occurred on the calling thread, and optionally a UTF-8 encoded + * human-readable description of it. If no error has occurred since the last + * call, it returns @ref GLFW_NO_ERROR (zero) and the description pointer is + * set to `NULL`. + * + * @param[in] description Where to store the error description pointer, or `NULL`. + * @return The last error code for the calling thread, or @ref GLFW_NO_ERROR + * (zero). + * + * @errors None. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is guaranteed to be valid only until the + * next error occurs or the library is terminated. + * + * @remark This function may be called before @ref glfwInit. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref error_handling + * @sa @ref glfwSetErrorCallback + * + * @since Added in version 3.3. + * + * @ingroup init + */ +GLFWAPI int glfwGetError(const char** description); + /*! @brief Sets the error callback. * * This function sets the error callback, which is called with an error code * and a human-readable description each time a GLFW error occurs. * + * The error code is set before the callback is called. Calling @ref + * glfwGetError from the error callback will return the same value as the error + * code argument. + * * The error callback is called on the thread where the error occurred. If you * are using GLFW from multiple threads, your error callback needs to be * written accordingly. @@ -1196,14 +1853,16 @@ GLFWAPI const char* glfwGetVersionString(void); * callback. * @return The previously set callback, or `NULL` if no callback was set. * - * @remarks This function may be called before @ref glfwInit. + * @errors None. * - * @par Thread Safety - * This function may only be called from the main thread. + * @remark This function may be called before @ref glfwInit. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref error_handling + * @sa @ref glfwGetError * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup init */ @@ -1212,26 +1871,27 @@ GLFWAPI GLFWerrorfun glfwSetErrorCallback(GLFWerrorfun cbfun); /*! @brief Returns the currently connected monitors. * * This function returns an array of handles for all currently connected - * monitors. + * monitors. The primary monitor is always first in the returned array. If no + * monitors were found, this function returns `NULL`. * * @param[out] count Where to store the number of monitors in the returned * array. This is set to zero if an error occurred. - * @return An array of monitor handles, or `NULL` if an - * [error](@ref error_handling) occurred. + * @return An array of monitor handles, or `NULL` if no monitors were found or + * if an [error](@ref error_handling) occurred. * - * @par Pointer Lifetime - * The returned array is allocated and freed by GLFW. You should not free it - * yourself. It is guaranteed to be valid only until the monitor configuration - * changes or the library is terminated. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. * - * @par Thread Safety - * This function may only be called from the main thread. + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is guaranteed to be valid only until the + * monitor configuration changes or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref monitor_monitors * @sa @ref monitor_event - * @sa glfwGetPrimaryMonitor + * @sa @ref glfwGetPrimaryMonitor * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup monitor */ @@ -1240,18 +1900,22 @@ GLFWAPI GLFWmonitor** glfwGetMonitors(int* count); /*! @brief Returns the primary monitor. * * This function returns the primary monitor. This is usually the monitor - * where elements like the Windows task bar or the OS X menu bar is located. + * where elements like the task bar or global menu bar are located. * - * @return The primary monitor, or `NULL` if an [error](@ref error_handling) - * occurred. + * @return The primary monitor, or `NULL` if no monitors were found or if an + * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @remark The primary monitor is always first in the array returned by @ref + * glfwGetMonitors. * * @sa @ref monitor_monitors - * @sa glfwGetMonitors + * @sa @ref glfwGetMonitors * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup monitor */ @@ -1269,17 +1933,50 @@ GLFWAPI GLFWmonitor* glfwGetPrimaryMonitor(void); * @param[out] xpos Where to store the monitor x-coordinate, or `NULL`. * @param[out] ypos Where to store the monitor y-coordinate, or `NULL`. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref monitor_properties * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup monitor */ GLFWAPI void glfwGetMonitorPos(GLFWmonitor* monitor, int* xpos, int* ypos); +/*! @brief Retrives the work area of the monitor. + * + * This function returns the position, in screen coordinates, of the upper-left + * corner of the work area of the specified monitor along with the work area + * size in screen coordinates. The work area is defined as the area of the + * monitor not occluded by the operating system task bar where present. If no + * task bar exists then the work area is the monitor resolution in screen + * coordinates. + * + * Any or all of the position and size arguments may be `NULL`. If an error + * occurs, all non-`NULL` position and size arguments will be set to zero. + * + * @param[in] monitor The monitor to query. + * @param[out] xpos Where to store the monitor x-coordinate, or `NULL`. + * @param[out] ypos Where to store the monitor y-coordinate, or `NULL`. + * @param[out] width Where to store the monitor width, or `NULL`. + * @param[out] height Where to store the monitor height, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_workarea + * + * @since Added in version 3.3. + * + * @ingroup monitor + */ +GLFWAPI void glfwGetMonitorWorkarea(GLFWmonitor* monitor, int* xpos, int* ypos, int* width, int* height); + /*! @brief Returns the physical size of the monitor. * * This function returns the size, in millimetres, of the display area of the @@ -1299,20 +1996,53 @@ GLFWAPI void glfwGetMonitorPos(GLFWmonitor* monitor, int* xpos, int* ypos); * @param[out] heightMM Where to store the height, in millimetres, of the * monitor's display area, or `NULL`. * - * @remarks __Windows:__ The OS calculates the returned physical size from the + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @remark @win32 calculates the returned physical size from the * current resolution and system DPI instead of querying the monitor EDID data. * - * @par Thread Safety - * This function may only be called from the main thread. + * @thread_safety This function must only be called from the main thread. * * @sa @ref monitor_properties * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup monitor */ GLFWAPI void glfwGetMonitorPhysicalSize(GLFWmonitor* monitor, int* widthMM, int* heightMM); +/*! @brief Retrieves the content scale for the specified monitor. + * + * This function retrieves the content scale for the specified monitor. The + * content scale is the ratio between the current DPI and the platform's + * default DPI. This is especially important for text and any UI elements. If + * the pixel dimensions of your UI scaled by this look appropriate on your + * machine then it should appear at a reasonable size on other machines + * regardless of their DPI and scaling settings. This relies on the system DPI + * and scaling settings being somewhat correct. + * + * The content scale may depend on both the monitor resolution and pixel + * density and on user settings. It may be very different from the raw DPI + * calculated from the physical size and current resolution. + * + * @param[in] monitor The monitor to query. + * @param[out] xscale Where to store the x-axis content scale, or `NULL`. + * @param[out] yscale Where to store the y-axis content scale, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_scale + * @sa @ref glfwGetWindowContentScale + * + * @since Added in version 3.3. + * + * @ingroup monitor + */ +GLFWAPI void glfwGetMonitorContentScale(GLFWmonitor* monitor, float* xscale, float* yscale); + /*! @brief Returns the name of the specified monitor. * * This function returns a human-readable name, encoded as UTF-8, of the @@ -1323,22 +2053,72 @@ GLFWAPI void glfwGetMonitorPhysicalSize(GLFWmonitor* monitor, int* widthMM, int* * @return The UTF-8 encoded name of the monitor, or `NULL` if an * [error](@ref error_handling) occurred. * - * @par Pointer Lifetime - * The returned string is allocated and freed by GLFW. You should not free it - * yourself. It is valid until the specified monitor is disconnected or the - * library is terminated. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. * - * @par Thread Safety - * This function may only be called from the main thread. + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified monitor is + * disconnected or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref monitor_properties * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup monitor */ GLFWAPI const char* glfwGetMonitorName(GLFWmonitor* monitor); +/*! @brief Sets the user pointer of the specified monitor. + * + * This function sets the user-defined pointer of the specified monitor. The + * current value is retained until the monitor is disconnected. The initial + * value is `NULL`. + * + * This function may be called from the monitor callback, even for a monitor + * that is being disconnected. + * + * @param[in] monitor The monitor whose pointer to set. + * @param[in] pointer The new value. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref monitor_userptr + * @sa @ref glfwGetMonitorUserPointer + * + * @since Added in version 3.3. + * + * @ingroup monitor + */ +GLFWAPI void glfwSetMonitorUserPointer(GLFWmonitor* monitor, void* pointer); + +/*! @brief Returns the user pointer of the specified monitor. + * + * This function returns the current value of the user-defined pointer of the + * specified monitor. The initial value is `NULL`. + * + * This function may be called from the monitor callback, even for a monitor + * that is being disconnected. + * + * @param[in] monitor The monitor whose pointer to return. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref monitor_userptr + * @sa @ref glfwSetMonitorUserPointer + * + * @since Added in version 3.3. + * + * @ingroup monitor + */ +GLFWAPI void* glfwGetMonitorUserPointer(GLFWmonitor* monitor); + /*! @brief Sets the monitor configuration callback. * * This function sets the monitor configuration callback, or removes the @@ -1350,15 +2130,13 @@ GLFWAPI const char* glfwGetMonitorName(GLFWmonitor* monitor); * @return The previously set callback, or `NULL` if no callback was set or the * library had not been [initialized](@ref intro_init). * - * @bug __X11:__ This callback is not yet called on monitor configuration - * changes. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. * - * @par Thread Safety - * This function may only be called from the main thread. + * @thread_safety This function must only be called from the main thread. * * @sa @ref monitor_event * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup monitor */ @@ -1377,21 +2155,21 @@ GLFWAPI GLFWmonitorfun glfwSetMonitorCallback(GLFWmonitorfun cbfun); * @return An array of video modes, or `NULL` if an * [error](@ref error_handling) occurred. * - * @par Pointer Lifetime - * The returned array is allocated and freed by GLFW. You should not free it - * yourself. It is valid until the specified monitor is disconnected, this - * function is called again for that monitor or the library is terminated. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @par Thread Safety - * This function may only be called from the main thread. + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified monitor is + * disconnected, this function is called again for that monitor or the library + * is terminated. * - * @sa @ref monitor_modes - * @sa glfwGetVideoMode + * @thread_safety This function must only be called from the main thread. * - * @since Added in GLFW 1.0. + * @sa @ref monitor_modes + * @sa @ref glfwGetVideoMode * - * @par - * __GLFW 3:__ Changed to return an array of modes for a specific monitor. + * @since Added in version 1.0. + * @glfw3 Changed to return an array of modes for a specific monitor. * * @ingroup monitor */ @@ -1407,18 +2185,19 @@ GLFWAPI const GLFWvidmode* glfwGetVideoModes(GLFWmonitor* monitor, int* count); * @return The current mode of the monitor, or `NULL` if an * [error](@ref error_handling) occurred. * - * @par Pointer Lifetime - * The returned array is allocated and freed by GLFW. You should not free it - * yourself. It is valid until the specified monitor is disconnected or the - * library is terminated. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @par Thread Safety - * This function may only be called from the main thread. + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified monitor is + * disconnected or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref monitor_modes - * @sa glfwGetVideoModes + * @sa @ref glfwGetVideoModes * - * @since Added in GLFW 3.0. Replaces `glfwGetDesktopMode`. + * @since Added in version 3.0. Replaces `glfwGetDesktopMode`. * * @ingroup monitor */ @@ -1426,19 +2205,32 @@ GLFWAPI const GLFWvidmode* glfwGetVideoMode(GLFWmonitor* monitor); /*! @brief Generates a gamma ramp and sets it for the specified monitor. * - * This function generates a 256-element gamma ramp from the specified exponent - * and then calls @ref glfwSetGammaRamp with it. The value must be a finite - * number greater than zero. + * This function generates an appropriately sized gamma ramp from the specified + * exponent and then calls @ref glfwSetGammaRamp with it. The value must be + * a finite number greater than zero. + * + * The software controlled gamma ramp is applied _in addition_ to the hardware + * gamma correction, which today is usually an approximation of sRGB gamma. + * This means that setting a perfectly linear ramp, or gamma 1.0, will produce + * the default (usually sRGB-like) behavior. + * + * For gamma correct rendering with OpenGL or OpenGL ES, see the @ref + * GLFW_SRGB_CAPABLE hint. * * @param[in] monitor The monitor whose gamma ramp to set. * @param[in] gamma The desired exponent. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_VALUE and @ref GLFW_PLATFORM_ERROR. + * + * @remark @wayland Gamma handling is a priviledged protocol, this function + * will thus never be implemented and emits @ref GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref monitor_gamma * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup monitor */ @@ -1452,18 +2244,23 @@ GLFWAPI void glfwSetGamma(GLFWmonitor* monitor, float gamma); * @return The current gamma ramp, or `NULL` if an * [error](@ref error_handling) occurred. * - * @par Pointer Lifetime - * The returned structure and its arrays are allocated and freed by GLFW. You - * should not free them yourself. They are valid until the specified monitor - * is disconnected, this function is called again for that monitor or the - * library is terminated. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @par Thread Safety - * This function may only be called from the main thread. + * @remark @wayland Gamma handling is a priviledged protocol, this function + * will thus never be implemented and emits @ref GLFW_PLATFORM_ERROR while + * returning `NULL`. + * + * @pointer_lifetime The returned structure and its arrays are allocated and + * freed by GLFW. You should not free them yourself. They are valid until the + * specified monitor is disconnected, this function is called again for that + * monitor or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref monitor_gamma * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup monitor */ @@ -1475,23 +2272,36 @@ GLFWAPI const GLFWgammaramp* glfwGetGammaRamp(GLFWmonitor* monitor); * original gamma ramp for that monitor is saved by GLFW the first time this * function is called and is restored by @ref glfwTerminate. * + * The software controlled gamma ramp is applied _in addition_ to the hardware + * gamma correction, which today is usually an approximation of sRGB gamma. + * This means that setting a perfectly linear ramp, or gamma 1.0, will produce + * the default (usually sRGB-like) behavior. + * + * For gamma correct rendering with OpenGL or OpenGL ES, see the @ref + * GLFW_SRGB_CAPABLE hint. + * * @param[in] monitor The monitor whose gamma ramp to set. * @param[in] ramp The gamma ramp to use. * - * @remarks Gamma ramp sizes other than 256 are not supported by all platforms - * or graphics hardware. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @remarks __Windows:__ The gamma ramp size must be 256. + * @remark The size of the specified gamma ramp should match the size of the + * current ramp for that monitor. * - * @par Pointer Lifetime - * The specified gamma ramp is copied before this function returns. + * @remark @win32 The gamma ramp size must be 256. * - * @par Thread Safety - * This function may only be called from the main thread. + * @remark @wayland Gamma handling is a priviledged protocol, this function + * will thus never be implemented and emits @ref GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The specified gamma ramp is copied before this function + * returns. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref monitor_gamma * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup monitor */ @@ -1502,13 +2312,15 @@ GLFWAPI void glfwSetGammaRamp(GLFWmonitor* monitor, const GLFWgammaramp* ramp); * This function resets all window hints to their * [default values](@ref window_hints_values). * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref window_hints - * @sa glfwWindowHint + * @sa @ref glfwWindowHint + * @sa @ref glfwWindowHintString * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup window */ @@ -1517,24 +2329,75 @@ GLFWAPI void glfwDefaultWindowHints(void); /*! @brief Sets the specified window hint to the desired value. * * This function sets hints for the next call to @ref glfwCreateWindow. The - * hints, once set, retain their values until changed by a call to @ref - * glfwWindowHint or @ref glfwDefaultWindowHints, or until the library is - * terminated. + * hints, once set, retain their values until changed by a call to this + * function or @ref glfwDefaultWindowHints, or until the library is terminated. * - * @param[in] target The [window hint](@ref window_hints) to set. - * @param[in] hint The new value of the window hint. + * Only integer value hints can be set with this function. String value hints + * are set with @ref glfwWindowHintString. * - * @par Thread Safety - * This function may only be called from the main thread. + * This function does not check whether the specified hint values are valid. + * If you set hints to invalid values this will instead be reported by the next + * call to @ref glfwCreateWindow. + * + * Some hints are platform specific. These may be set on any platform but they + * will only affect their specific platform. Other platforms will ignore them. + * Setting these hints requires no platform specific headers or functions. + * + * @param[in] hint The [window hint](@ref window_hints) to set. + * @param[in] value The new value of the window hint. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_hints + * @sa @ref glfwWindowHintString + * @sa @ref glfwDefaultWindowHints + * + * @since Added in version 3.0. Replaces `glfwOpenWindowHint`. + * + * @ingroup window + */ +GLFWAPI void glfwWindowHint(int hint, int value); + +/*! @brief Sets the specified window hint to the desired value. + * + * This function sets hints for the next call to @ref glfwCreateWindow. The + * hints, once set, retain their values until changed by a call to this + * function or @ref glfwDefaultWindowHints, or until the library is terminated. + * + * Only string type hints can be set with this function. Integer value hints + * are set with @ref glfwWindowHint. + * + * This function does not check whether the specified hint values are valid. + * If you set hints to invalid values this will instead be reported by the next + * call to @ref glfwCreateWindow. + * + * Some hints are platform specific. These may be set on any platform but they + * will only affect their specific platform. Other platforms will ignore them. + * Setting these hints requires no platform specific headers or functions. + * + * @param[in] hint The [window hint](@ref window_hints) to set. + * @param[in] value The new value of the window hint. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @pointer_lifetime The specified string is copied before this function + * returns. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref window_hints - * @sa glfwDefaultWindowHints + * @sa @ref glfwWindowHint + * @sa @ref glfwDefaultWindowHints * - * @since Added in GLFW 3.0. Replaces `glfwOpenWindowHint`. + * @since Added in version 3.3. * * @ingroup window */ -GLFWAPI void glfwWindowHint(int target, int hint); +GLFWAPI void glfwWindowHintString(int hint, const char* value); /*! @brief Creates a window and its associated context. * @@ -1551,30 +2414,34 @@ GLFWAPI void glfwWindowHint(int target, int hint); * requested, as not all parameters and hints are * [hard constraints](@ref window_hints_hard). This includes the size of the * window, especially for full screen windows. To query the actual attributes - * of the created window, framebuffer and context, use queries like @ref - * glfwGetWindowAttrib and @ref glfwGetWindowSize. + * of the created window, framebuffer and context, see @ref + * glfwGetWindowAttrib, @ref glfwGetWindowSize and @ref glfwGetFramebufferSize. * * To create a full screen window, you need to specify the monitor the window - * will cover. If no monitor is specified, windowed mode will be used. Unless - * you have a way for the user to choose a specific monitor, it is recommended - * that you pick the primary monitor. For more information on how to query - * connected monitors, see @ref monitor_monitors. + * will cover. If no monitor is specified, the window will be windowed mode. + * Unless you have a way for the user to choose a specific monitor, it is + * recommended that you pick the primary monitor. For more information on how + * to query connected monitors, see @ref monitor_monitors. * * For full screen windows, the specified size becomes the resolution of the - * window's _desired video mode_. As long as a full screen window has input - * focus, the supported video mode most closely matching the desired video mode - * is set for the specified monitor. For more information about full screen - * windows, including the creation of so called _windowed full screen_ or - * _borderless full screen_ windows, see @ref window_windowed_full_screen. + * window's _desired video mode_. As long as a full screen window is not + * iconified, the supported video mode most closely matching the desired video + * mode is set for the specified monitor. For more information about full + * screen windows, including the creation of so called _windowed full screen_ + * or _borderless full screen_ windows, see @ref window_windowed_full_screen. + * + * Once you have created the window, you can switch it between windowed and + * full screen mode with @ref glfwSetWindowMonitor. This will not affect its + * OpenGL or OpenGL ES context. * * By default, newly created windows use the placement recommended by the * window system. To create the window at a specific position, make it - * initially invisible using the [GLFW_VISIBLE](@ref window_hints_wnd) window + * initially invisible using the [GLFW_VISIBLE](@ref GLFW_VISIBLE_hint) window * hint, set its [position](@ref window_pos) and then [show](@ref window_hide) * it. * - * If a full screen window has input focus, the screensaver is prohibited from - * starting. + * As long as at least one full screen window is not iconified, the screensaver + * is prohibited from starting. * * Window systems put limits on window sizes. Very large or very small window * dimensions may be overridden by the window system on creation. Check the @@ -1588,57 +2455,99 @@ GLFWAPI void glfwWindowHint(int target, int hint); * @param[in] height The desired height, in screen coordinates, of the window. * This must be greater than zero. * @param[in] title The initial, UTF-8 encoded window title. - * @param[in] monitor The monitor to use for full screen mode, or `NULL` to use + * @param[in] monitor The monitor to use for full screen mode, or `NULL` for * windowed mode. * @param[in] share The window whose context to share resources with, or `NULL` * to not share resources. * @return The handle of the created window, or `NULL` if an * [error](@ref error_handling) occurred. * - * @remarks __Windows:__ Window creation will fail if the Microsoft GDI - * software OpenGL implementation is the only one available. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM, @ref GLFW_INVALID_VALUE, @ref GLFW_API_UNAVAILABLE, @ref + * GLFW_VERSION_UNAVAILABLE, @ref GLFW_FORMAT_UNAVAILABLE and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark @win32 Window creation will fail if the Microsoft GDI software + * OpenGL implementation is the only one available. * - * @remarks __Windows:__ If the executable has an icon resource named - * `GLFW_ICON,` it will be set as the icon for the window. If no such icon is - * present, the `IDI_WINLOGO` icon will be used instead. + * @remark @win32 If the executable has an icon resource named `GLFW_ICON,` it + * will be set as the initial icon for the window. If no such icon is present, + * the `IDI_APPLICATION` icon will be used instead. To set a different icon, + * see @ref glfwSetWindowIcon. * - * @remarks __Windows:__ The context to share resources with may not be current - * on any other thread. + * @remark @win32 The context to share resources with must not be current on + * any other thread. * - * @remarks __OS X:__ The GLFW window has no icon, as it is not a document + * @remark @macos The OS only supports forward-compatible core profile contexts + * for OpenGL versions 3.2 and later. Before creating an OpenGL context of + * version 3.2 or later you must set the + * [GLFW_OPENGL_FORWARD_COMPAT](@ref GLFW_OPENGL_FORWARD_COMPAT_hint) and + * [GLFW_OPENGL_PROFILE](@ref GLFW_OPENGL_PROFILE_hint) hints accordingly. + * OpenGL 3.0 and 3.1 contexts are not supported at all on macOS. + * + * @remark @macos The GLFW window has no icon, as it is not a document * window, but the dock icon will be the same as the application bundle's icon. * For more information on bundles, see the * [Bundle Programming Guide](https://developer.apple.com/library/mac/documentation/CoreFoundation/Conceptual/CFBundles/) * in the Mac Developer Library. * - * @remarks __OS X:__ The first time a window is created the menu bar is - * populated with common commands like Hide, Quit and About. The About entry - * opens a minimal about dialog with information from the application's bundle. - * The menu bar can be disabled with a - * [compile-time option](@ref compile_options_osx). - * - * @remarks __OS X:__ On OS X 10.10 and later the window frame will not be - * rendered at full resolution on Retina displays unless the - * `NSHighResolutionCapable` key is enabled in the application bundle's - * `Info.plist`. For more information, see + * @remark @macos The first time a window is created the menu bar is created. + * If GLFW finds a `MainMenu.nib` it is loaded and assumed to contain a menu + * bar. Otherwise a minimal menu bar is created manually with common commands + * like Hide, Quit and About. The About entry opens a minimal about dialog + * with information from the application's bundle. Menu bar creation can be + * disabled entirely with the @ref GLFW_COCOA_MENUBAR init hint. + * + * @remark @macos On OS X 10.10 and later the window frame will not be rendered + * at full resolution on Retina displays unless the + * [GLFW_COCOA_RETINA_FRAMEBUFFER](@ref GLFW_COCOA_RETINA_FRAMEBUFFER_hint) + * hint is `GLFW_TRUE` and the `NSHighResolutionCapable` key is enabled in the + * application bundle's `Info.plist`. For more information, see * [High Resolution Guidelines for OS X](https://developer.apple.com/library/mac/documentation/GraphicsAnimation/Conceptual/HighResolutionOSX/Explained/Explained.html) - * in the Mac Developer Library. + * in the Mac Developer Library. The GLFW test and example programs use + * a custom `Info.plist` template for this, which can be found as + * `CMake/MacOSXBundleInfo.plist.in` in the source tree. * - * @remarks __X11:__ There is no mechanism for setting the window icon yet. + * @remark @macos When activating frame autosaving with + * [GLFW_COCOA_FRAME_NAME](@ref GLFW_COCOA_FRAME_NAME_hint), the specified + * window size and position may be overriden by previously saved values. * - * @remarks __X11:__ Some window managers will not respect the placement of + * @remark @x11 Some window managers will not respect the placement of * initially hidden windows. * - * @par Reentrancy - * This function may not be called from a callback. + * @remark @x11 Due to the asynchronous nature of X11, it may take a moment for + * a window to reach its requested state. This means you may not be able to + * query the final size, position or other attributes directly after window + * creation. * - * @par Thread Safety - * This function may only be called from the main thread. + * @remark @x11 The class part of the `WM_CLASS` window property will by + * default be set to the window title passed to this function. The instance + * part will use the contents of the `RESOURCE_NAME` environment variable, if + * present and not empty, or fall back to the window title. Set the + * [GLFW_X11_CLASS_NAME](@ref GLFW_X11_CLASS_NAME_hint) and + * [GLFW_X11_INSTANCE_NAME](@ref GLFW_X11_INSTANCE_NAME_hint) window hints to + * override this. + * + * @remark @wayland Compositors should implement the xdg-decoration protocol + * for GLFW to decorate the window properly. If this protocol isn't + * supported, or if the compositor prefers client-side decorations, a very + * simple fallback frame will be drawn using the wp_viewporter protocol. A + * compositor can still emit close, maximize or fullscreen events, using for + * instance a keybind mechanism. If neither of these protocols is supported, + * the window won't be decorated. + * + * @remark @wayland A full screen window will not attempt to change the mode, + * no matter what the requested size or refresh rate. + * + * @remark @wayland Screensaver inhibition requires the idle-inhibit protocol + * to be implemented in the user's compositor. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref window_creation - * @sa glfwDestroyWindow + * @sa @ref glfwDestroyWindow * - * @since Added in GLFW 3.0. Replaces `glfwOpenWindow`. + * @since Added in version 3.0. Replaces `glfwOpenWindow`. * * @ingroup window */ @@ -1654,19 +2563,20 @@ GLFWAPI GLFWwindow* glfwCreateWindow(int width, int height, const char* title, G * * @param[in] window The window to destroy. * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * * @note The context of the specified window must not be current on any other * thread when this function is called. * - * @par Reentrancy - * This function may not be called from a callback. + * @reentrancy This function must not be called from a callback. * - * @par Thread Safety - * This function may only be called from the main thread. + * @thread_safety This function must only be called from the main thread. * * @sa @ref window_creation - * @sa glfwCreateWindow + * @sa @ref glfwCreateWindow * - * @since Added in GLFW 3.0. Replaces `glfwCloseWindow`. + * @since Added in version 3.0. Replaces `glfwCloseWindow`. * * @ingroup window */ @@ -1679,12 +2589,14 @@ GLFWAPI void glfwDestroyWindow(GLFWwindow* window); * @param[in] window The window to query. * @return The value of the close flag. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * * @sa @ref window_close * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup window */ @@ -1699,12 +2611,14 @@ GLFWAPI int glfwWindowShouldClose(GLFWwindow* window); * @param[in] window The window whose flag to change. * @param[in] value The new value. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * * @sa @ref window_close * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup window */ @@ -1718,50 +2632,106 @@ GLFWAPI void glfwSetWindowShouldClose(GLFWwindow* window, int value); * @param[in] window The window whose title to change. * @param[in] title The UTF-8 encoded window title. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @sa @ref window_title + * @remark @macos The window title will not be updated until the next time you + * process events. * - * @since Added in GLFW 1.0. + * @thread_safety This function must only be called from the main thread. * - * @par - * __GLFW 3:__ Added window handle parameter. + * @sa @ref window_title + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. * * @ingroup window */ GLFWAPI void glfwSetWindowTitle(GLFWwindow* window, const char* title); -/*! @brief Retrieves the position of the client area of the specified window. +/*! @brief Sets the icon for the specified window. + * + * This function sets the icon of the specified window. If passed an array of + * candidate images, those of or closest to the sizes desired by the system are + * selected. If no images are specified, the window reverts to its default + * icon. + * + * The pixels are 32-bit, little-endian, non-premultiplied RGBA, i.e. eight + * bits per channel with the red channel first. They are arranged canonically + * as packed sequential rows, starting from the top-left corner. + * + * The desired image sizes varies depending on platform and system settings. + * The selected images will be rescaled as needed. Good sizes include 16x16, + * 32x32 and 48x48. + * + * @param[in] window The window whose icon to set. + * @param[in] count The number of images in the specified array, or zero to + * revert to the default window icon. + * @param[in] images The images to create the icon from. This is ignored if + * count is zero. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The specified image data is copied before this function + * returns. + * + * @remark @macos The GLFW window has no icon, as it is not a document + * window, so this function does nothing. The dock icon will be the same as + * the application bundle's icon. For more information on bundles, see the + * [Bundle Programming Guide](https://developer.apple.com/library/mac/documentation/CoreFoundation/Conceptual/CFBundles/) + * in the Mac Developer Library. + * + * @remark @wayland There is no existing protocol to change an icon, the + * window will thus inherit the one defined in the application's desktop file. + * This function always emits @ref GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_icon + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowIcon(GLFWwindow* window, int count, const GLFWimage* images); + +/*! @brief Retrieves the position of the content area of the specified window. * * This function retrieves the position, in screen coordinates, of the - * upper-left corner of the client area of the specified window. + * upper-left corner of the content area of the specified window. * * Any or all of the position arguments may be `NULL`. If an error occurs, all * non-`NULL` position arguments will be set to zero. * * @param[in] window The window to query. * @param[out] xpos Where to store the x-coordinate of the upper-left corner of - * the client area, or `NULL`. + * the content area, or `NULL`. * @param[out] ypos Where to store the y-coordinate of the upper-left corner of - * the client area, or `NULL`. + * the content area, or `NULL`. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @sa @ref window_pos - * @sa glfwSetWindowPos + * @remark @wayland There is no way for an application to retrieve the global + * position of its windows, this function will always emit @ref + * GLFW_PLATFORM_ERROR. * - * @since Added in GLFW 3.0. + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_pos + * @sa @ref glfwSetWindowPos + * + * @since Added in version 3.0. * * @ingroup window */ GLFWAPI void glfwGetWindowPos(GLFWwindow* window, int* xpos, int* ypos); -/*! @brief Sets the position of the client area of the specified window. +/*! @brief Sets the position of the content area of the specified window. * * This function sets the position, in screen coordinates, of the upper-left - * corner of the client area of the specified windowed mode window. If the + * corner of the content area of the specified windowed mode window. If the * window is a full screen window, this function does nothing. * * __Do not use this function__ to move an already visible window unless you @@ -1771,27 +2741,31 @@ GLFWAPI void glfwGetWindowPos(GLFWwindow* window, int* xpos, int* ypos); * cannot and should not override these limits. * * @param[in] window The window to query. - * @param[in] xpos The x-coordinate of the upper-left corner of the client area. - * @param[in] ypos The y-coordinate of the upper-left corner of the client area. + * @param[in] xpos The x-coordinate of the upper-left corner of the content area. + * @param[in] ypos The y-coordinate of the upper-left corner of the content area. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @sa @ref window_pos - * @sa glfwGetWindowPos + * @remark @wayland There is no way for an application to set the global + * position of its windows, this function will always emit @ref + * GLFW_PLATFORM_ERROR. * - * @since Added in GLFW 1.0. + * @thread_safety This function must only be called from the main thread. * - * @par - * __GLFW 3:__ Added window handle parameter. + * @sa @ref window_pos + * @sa @ref glfwGetWindowPos + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. * * @ingroup window */ GLFWAPI void glfwSetWindowPos(GLFWwindow* window, int xpos, int ypos); -/*! @brief Retrieves the size of the client area of the specified window. +/*! @brief Retrieves the size of the content area of the specified window. * - * This function retrieves the size, in screen coordinates, of the client area + * This function retrieves the size, in screen coordinates, of the content area * of the specified window. If you wish to retrieve the size of the * framebuffer of the window in pixels, see @ref glfwGetFramebufferSize. * @@ -1800,52 +2774,147 @@ GLFWAPI void glfwSetWindowPos(GLFWwindow* window, int xpos, int ypos); * * @param[in] window The window whose size to retrieve. * @param[out] width Where to store the width, in screen coordinates, of the - * client area, or `NULL`. + * content area, or `NULL`. * @param[out] height Where to store the height, in screen coordinates, of the - * client area, or `NULL`. + * content area, or `NULL`. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @sa @ref window_size - * @sa glfwSetWindowSize + * @thread_safety This function must only be called from the main thread. * - * @since Added in GLFW 1.0. + * @sa @ref window_size + * @sa @ref glfwSetWindowSize * - * @par - * __GLFW 3:__ Added window handle parameter. + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. * * @ingroup window */ GLFWAPI void glfwGetWindowSize(GLFWwindow* window, int* width, int* height); -/*! @brief Sets the size of the client area of the specified window. +/*! @brief Sets the size limits of the specified window. + * + * This function sets the size limits of the content area of the specified + * window. If the window is full screen, the size limits only take effect + * once it is made windowed. If the window is not resizable, this function + * does nothing. + * + * The size limits are applied immediately to a windowed mode window and may + * cause it to be resized. + * + * The maximum dimensions must be greater than or equal to the minimum + * dimensions and all must be greater than or equal to zero. + * + * @param[in] window The window to set limits for. + * @param[in] minwidth The minimum width, in screen coordinates, of the content + * area, or `GLFW_DONT_CARE`. + * @param[in] minheight The minimum height, in screen coordinates, of the + * content area, or `GLFW_DONT_CARE`. + * @param[in] maxwidth The maximum width, in screen coordinates, of the content + * area, or `GLFW_DONT_CARE`. + * @param[in] maxheight The maximum height, in screen coordinates, of the + * content area, or `GLFW_DONT_CARE`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_VALUE and @ref GLFW_PLATFORM_ERROR. + * + * @remark If you set size limits and an aspect ratio that conflict, the + * results are undefined. + * + * @remark @wayland The size limits will not be applied until the window is + * actually resized, either by the user or by the compositor. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_sizelimits + * @sa @ref glfwSetWindowAspectRatio + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowSizeLimits(GLFWwindow* window, int minwidth, int minheight, int maxwidth, int maxheight); + +/*! @brief Sets the aspect ratio of the specified window. + * + * This function sets the required aspect ratio of the content area of the + * specified window. If the window is full screen, the aspect ratio only takes + * effect once it is made windowed. If the window is not resizable, this + * function does nothing. + * + * The aspect ratio is specified as a numerator and a denominator and both + * values must be greater than zero. For example, the common 16:9 aspect ratio + * is specified as 16 and 9, respectively. + * + * If the numerator and denominator is set to `GLFW_DONT_CARE` then the aspect + * ratio limit is disabled. + * + * The aspect ratio is applied immediately to a windowed mode window and may + * cause it to be resized. + * + * @param[in] window The window to set limits for. + * @param[in] numer The numerator of the desired aspect ratio, or + * `GLFW_DONT_CARE`. + * @param[in] denom The denominator of the desired aspect ratio, or + * `GLFW_DONT_CARE`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_VALUE and @ref GLFW_PLATFORM_ERROR. + * + * @remark If you set size limits and an aspect ratio that conflict, the + * results are undefined. + * + * @remark @wayland The aspect ratio will not be applied until the window is + * actually resized, either by the user or by the compositor. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_sizelimits + * @sa @ref glfwSetWindowSizeLimits + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowAspectRatio(GLFWwindow* window, int numer, int denom); + +/*! @brief Sets the size of the content area of the specified window. * - * This function sets the size, in screen coordinates, of the client area of + * This function sets the size, in screen coordinates, of the content area of * the specified window. * - * For full screen windows, this function selects and switches to the resolution - * closest to the specified size, without affecting the window's context. As - * the context is unaffected, the bit depths of the framebuffer remain - * unchanged. + * For full screen windows, this function updates the resolution of its desired + * video mode and switches to the video mode closest to it, without affecting + * the window's context. As the context is unaffected, the bit depths of the + * framebuffer remain unchanged. + * + * If you wish to update the refresh rate of the desired video mode in addition + * to its resolution, see @ref glfwSetWindowMonitor. * * The window manager may put limits on what sizes are allowed. GLFW cannot * and should not override these limits. * * @param[in] window The window to resize. - * @param[in] width The desired width of the specified window. - * @param[in] height The desired height of the specified window. + * @param[in] width The desired width, in screen coordinates, of the window + * content area. + * @param[in] height The desired height, in screen coordinates, of the window + * content area. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @sa @ref window_size - * @sa glfwGetWindowSize + * @remark @wayland A full screen window will not attempt to change the mode, + * no matter what the requested size. * - * @since Added in GLFW 1.0. + * @thread_safety This function must only be called from the main thread. * - * @par - * __GLFW 3:__ Added window handle parameter. + * @sa @ref window_size + * @sa @ref glfwGetWindowSize + * @sa @ref glfwSetWindowMonitor + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. * * @ingroup window */ @@ -1866,13 +2935,15 @@ GLFWAPI void glfwSetWindowSize(GLFWwindow* window, int width, int height); * @param[out] height Where to store the height, in pixels, of the framebuffer, * or `NULL`. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref window_fbsize - * @sa glfwSetFramebufferSizeCallback + * @sa @ref glfwSetFramebufferSizeCallback * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup window */ @@ -1902,17 +2973,108 @@ GLFWAPI void glfwGetFramebufferSize(GLFWwindow* window, int* width, int* height) * @param[out] bottom Where to store the size, in screen coordinates, of the * bottom edge of the window frame, or `NULL`. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref window_size * - * @since Added in GLFW 3.1. + * @since Added in version 3.1. * * @ingroup window */ GLFWAPI void glfwGetWindowFrameSize(GLFWwindow* window, int* left, int* top, int* right, int* bottom); +/*! @brief Retrieves the content scale for the specified window. + * + * This function retrieves the content scale for the specified window. The + * content scale is the ratio between the current DPI and the platform's + * default DPI. This is especially important for text and any UI elements. If + * the pixel dimensions of your UI scaled by this look appropriate on your + * machine then it should appear at a reasonable size on other machines + * regardless of their DPI and scaling settings. This relies on the system DPI + * and scaling settings being somewhat correct. + * + * On systems where each monitors can have its own content scale, the window + * content scale will depend on which monitor the system considers the window + * to be on. + * + * @param[in] window The window to query. + * @param[out] xscale Where to store the x-axis content scale, or `NULL`. + * @param[out] yscale Where to store the y-axis content scale, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_scale + * @sa @ref glfwSetWindowContentScaleCallback + * @sa @ref glfwGetMonitorContentScale + * + * @since Added in version 3.3. + * + * @ingroup window + */ +GLFWAPI void glfwGetWindowContentScale(GLFWwindow* window, float* xscale, float* yscale); + +/*! @brief Returns the opacity of the whole window. + * + * This function returns the opacity of the window, including any decorations. + * + * The opacity (or alpha) value is a positive finite number between zero and + * one, where zero is fully transparent and one is fully opaque. If the system + * does not support whole window transparency, this function always returns one. + * + * The initial opacity value for newly created windows is one. + * + * @param[in] window The window to query. + * @return The opacity value of the specified window. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_transparency + * @sa @ref glfwSetWindowOpacity + * + * @since Added in version 3.3. + * + * @ingroup window + */ +GLFWAPI float glfwGetWindowOpacity(GLFWwindow* window); + +/*! @brief Sets the opacity of the whole window. + * + * This function sets the opacity of the window, including any decorations. + * + * The opacity (or alpha) value is a positive finite number between zero and + * one, where zero is fully transparent and one is fully opaque. + * + * The initial opacity value for newly created windows is one. + * + * A window created with framebuffer transparency may not use whole window + * transparency. The results of doing this are undefined. + * + * @param[in] window The window to set the opacity for. + * @param[in] opacity The desired opacity of the specified window. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_transparency + * @sa @ref glfwGetWindowOpacity + * + * @since Added in version 3.3. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowOpacity(GLFWwindow* window, float opacity); + /*! @brief Iconifies the specified window. * * This function iconifies (minimizes) the specified window if it was @@ -1924,16 +3086,21 @@ GLFWAPI void glfwGetWindowFrameSize(GLFWwindow* window, int* left, int* top, int * * @param[in] window The window to iconify. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @sa @ref window_iconify - * @sa glfwRestoreWindow + * @remark @wayland There is no concept of iconification in wl_shell, this + * function will emit @ref GLFW_PLATFORM_ERROR when using this deprecated + * protocol. * - * @since Added in GLFW 2.1. + * @thread_safety This function must only be called from the main thread. * - * @par - * __GLFW 3:__ Added window handle parameter. + * @sa @ref window_iconify + * @sa @ref glfwRestoreWindow + * @sa @ref glfwMaximizeWindow + * + * @since Added in version 2.1. + * @glfw3 Added window handle parameter. * * @ingroup window */ @@ -1942,27 +3109,54 @@ GLFWAPI void glfwIconifyWindow(GLFWwindow* window); /*! @brief Restores the specified window. * * This function restores the specified window if it was previously iconified - * (minimized). If the window is already restored, this function does nothing. + * (minimized) or maximized. If the window is already restored, this function + * does nothing. * * If the specified window is a full screen window, the resolution chosen for * the window is restored on the selected monitor. * * @param[in] window The window to restore. * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_iconify + * @sa @ref glfwIconifyWindow + * @sa @ref glfwMaximizeWindow + * + * @since Added in version 2.1. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +GLFWAPI void glfwRestoreWindow(GLFWwindow* window); + +/*! @brief Maximizes the specified window. + * + * This function maximizes the specified window if it was previously not + * maximized. If the window is already maximized, this function does nothing. + * + * If the specified window is a full screen window, this function does nothing. + * + * @param[in] window The window to maximize. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * * @par Thread Safety * This function may only be called from the main thread. * * @sa @ref window_iconify - * @sa glfwIconifyWindow - * - * @since Added in GLFW 2.1. + * @sa @ref glfwIconifyWindow + * @sa @ref glfwRestoreWindow * - * @par - * __GLFW 3:__ Added window handle parameter. + * @since Added in GLFW 3.2. * * @ingroup window */ -GLFWAPI void glfwRestoreWindow(GLFWwindow* window); +GLFWAPI void glfwMaximizeWindow(GLFWwindow* window); /*! @brief Makes the specified window visible. * @@ -1970,15 +3164,22 @@ GLFWAPI void glfwRestoreWindow(GLFWwindow* window); * hidden. If the window is already visible or is in full screen mode, this * function does nothing. * + * By default, windowed mode windows are focused when shown + * Set the [GLFW_FOCUS_ON_SHOW](@ref GLFW_FOCUS_ON_SHOW_hint) window hint + * to change this behavior for all newly created windows, or change the + * behavior for an existing window with @ref glfwSetWindowAttrib. + * * @param[in] window The window to make visible. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref window_hide - * @sa glfwHideWindow + * @sa @ref glfwHideWindow * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup window */ @@ -1992,38 +3193,167 @@ GLFWAPI void glfwShowWindow(GLFWwindow* window); * * @param[in] window The window to hide. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref window_hide - * @sa glfwShowWindow + * @sa @ref glfwShowWindow * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup window */ GLFWAPI void glfwHideWindow(GLFWwindow* window); +/*! @brief Brings the specified window to front and sets input focus. + * + * This function brings the specified window to front and sets input focus. + * The window should already be visible and not iconified. + * + * By default, both windowed and full screen mode windows are focused when + * initially created. Set the [GLFW_FOCUSED](@ref GLFW_FOCUSED_hint) to + * disable this behavior. + * + * Also by default, windowed mode windows are focused when shown + * with @ref glfwShowWindow. Set the + * [GLFW_FOCUS_ON_SHOW](@ref GLFW_FOCUS_ON_SHOW_hint) to disable this behavior. + * + * __Do not use this function__ to steal focus from other applications unless + * you are certain that is what the user wants. Focus stealing can be + * extremely disruptive. + * + * For a less disruptive way of getting the user's attention, see + * [attention requests](@ref window_attention). + * + * @param[in] window The window to give input focus. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark @wayland It is not possible for an application to bring its windows + * to front, this function will always emit @ref GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_focus + * @sa @ref window_attention + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwFocusWindow(GLFWwindow* window); + +/*! @brief Requests user attention to the specified window. + * + * This function requests user attention to the specified window. On + * platforms where this is not supported, attention is requested to the + * application as a whole. + * + * Once the user has given attention, usually by focusing the window or + * application, the system will end the request automatically. + * + * @param[in] window The window to request attention to. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark @macos Attention is requested to the application as a whole, not the + * specific window. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_attention + * + * @since Added in version 3.3. + * + * @ingroup window + */ +GLFWAPI void glfwRequestWindowAttention(GLFWwindow* window); + /*! @brief Returns the monitor that the window uses for full screen mode. * * This function returns the handle of the monitor that the specified window is * in full screen on. * * @param[in] window The window to query. - * @return The monitor, or `NULL` if the window is in windowed mode or an error - * occurred. + * @return The monitor, or `NULL` if the window is in windowed mode or an + * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref window_monitor + * @sa @ref glfwSetWindowMonitor * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup window */ GLFWAPI GLFWmonitor* glfwGetWindowMonitor(GLFWwindow* window); +/*! @brief Sets the mode, monitor, video mode and placement of a window. + * + * This function sets the monitor that the window uses for full screen mode or, + * if the monitor is `NULL`, makes it windowed mode. + * + * When setting a monitor, this function updates the width, height and refresh + * rate of the desired video mode and switches to the video mode closest to it. + * The window position is ignored when setting a monitor. + * + * When the monitor is `NULL`, the position, width and height are used to + * place the window content area. The refresh rate is ignored when no monitor + * is specified. + * + * If you only wish to update the resolution of a full screen window or the + * size of a windowed mode window, see @ref glfwSetWindowSize. + * + * When a window transitions from full screen to windowed mode, this function + * restores any previous window settings such as whether it is decorated, + * floating, resizable, has size or aspect ratio limits, etc. + * + * @param[in] window The window whose monitor, size or video mode to set. + * @param[in] monitor The desired monitor, or `NULL` to set windowed mode. + * @param[in] xpos The desired x-coordinate of the upper-left corner of the + * content area. + * @param[in] ypos The desired y-coordinate of the upper-left corner of the + * content area. + * @param[in] width The desired with, in screen coordinates, of the content + * area or video mode. + * @param[in] height The desired height, in screen coordinates, of the content + * area or video mode. + * @param[in] refreshRate The desired refresh rate, in Hz, of the video mode, + * or `GLFW_DONT_CARE`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark The OpenGL or OpenGL ES context will not be destroyed or otherwise + * affected by any resizing or mode switching, although you may need to update + * your viewport if the framebuffer size has changed. + * + * @remark @wayland The desired window position is ignored, as there is no way + * for an application to set this property. + * + * @remark @wayland Setting the window to full screen will not attempt to + * change the mode, no matter what the requested size or refresh rate. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_monitor + * @sa @ref window_full_screen + * @sa @ref glfwGetWindowMonitor + * @sa @ref glfwSetWindowSize + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowMonitor(GLFWwindow* window, GLFWmonitor* monitor, int xpos, int ypos, int width, int height, int refreshRate); + /*! @brief Returns an attribute of the specified window. * * This function returns the value of an attribute of the specified window or @@ -2035,18 +3365,66 @@ GLFWAPI GLFWmonitor* glfwGetWindowMonitor(GLFWwindow* window); * @return The value of the attribute, or zero if an * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @remark Framebuffer related hints are not window attributes. See @ref + * window_attribs_fb for more information. + * + * @remark Zero is a valid value for many window and context related + * attributes so you cannot use a return value of zero as an indication of + * errors. However, this function should not fail as long as it is passed + * valid arguments and the library has been [initialized](@ref intro_init). + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref window_attribs + * @sa @ref glfwSetWindowAttrib * - * @since Added in GLFW 3.0. Replaces `glfwGetWindowParam` and + * @since Added in version 3.0. Replaces `glfwGetWindowParam` and * `glfwGetGLVersion`. * * @ingroup window */ GLFWAPI int glfwGetWindowAttrib(GLFWwindow* window, int attrib); +/*! @brief Sets an attribute of the specified window. + * + * This function sets the value of an attribute of the specified window. + * + * The supported attributes are [GLFW_DECORATED](@ref GLFW_DECORATED_attrib), + * [GLFW_RESIZABLE](@ref GLFW_RESIZABLE_attrib), + * [GLFW_FLOATING](@ref GLFW_FLOATING_attrib), + * [GLFW_AUTO_ICONIFY](@ref GLFW_AUTO_ICONIFY_attrib) and + * [GLFW_FOCUS_ON_SHOW](@ref GLFW_FOCUS_ON_SHOW_attrib). + * + * Some of these attributes are ignored for full screen windows. The new + * value will take effect if the window is later made windowed. + * + * Some of these attributes are ignored for windowed mode windows. The new + * value will take effect if the window is later made full screen. + * + * @param[in] window The window to set the attribute for. + * @param[in] attrib A supported window attribute. + * @param[in] value `GLFW_TRUE` or `GLFW_FALSE`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM, @ref GLFW_INVALID_VALUE and @ref GLFW_PLATFORM_ERROR. + * + * @remark Calling @ref glfwGetWindowAttrib will always return the latest + * value, even if that value is ignored by the current mode of the window. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_attribs + * @sa @ref glfwGetWindowAttrib + * + * @since Added in version 3.3. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowAttrib(GLFWwindow* window, int attrib, int value); + /*! @brief Sets the user pointer of the specified window. * * This function sets the user-defined pointer of the specified window. The @@ -2056,13 +3434,15 @@ GLFWAPI int glfwGetWindowAttrib(GLFWwindow* window, int attrib); * @param[in] window The window whose pointer to set. * @param[in] pointer The new value. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * * @sa @ref window_userptr - * @sa glfwGetWindowUserPointer + * @sa @ref glfwGetWindowUserPointer * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup window */ @@ -2075,13 +3455,15 @@ GLFWAPI void glfwSetWindowUserPointer(GLFWwindow* window, void* pointer); * * @param[in] window The window whose pointer to return. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * * @sa @ref window_userptr - * @sa glfwSetWindowUserPointer + * @sa @ref glfwSetWindowUserPointer * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup window */ @@ -2090,8 +3472,9 @@ GLFWAPI void* glfwGetWindowUserPointer(GLFWwindow* window); /*! @brief Sets the position callback for the specified window. * * This function sets the position callback of the specified window, which is - * called when the window is moved. The callback is provided with the screen - * position of the upper-left corner of the client area of the window. + * called when the window is moved. The callback is provided with the + * position, in screen coordinates, of the upper-left corner of the content + * area of the window. * * @param[in] window The window whose callback to set. * @param[in] cbfun The new callback, or `NULL` to remove the currently set @@ -2099,12 +3482,16 @@ GLFWAPI void* glfwGetWindowUserPointer(GLFWwindow* window); * @return The previously set callback, or `NULL` if no callback was set or the * library had not been [initialized](@ref intro_init). * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @remark @wayland This callback will never be called, as there is no way for + * an application to know its global position. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref window_pos * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup window */ @@ -2114,7 +3501,7 @@ GLFWAPI GLFWwindowposfun glfwSetWindowPosCallback(GLFWwindow* window, GLFWwindow * * This function sets the size callback of the specified window, which is * called when the window is resized. The callback is provided with the size, - * in screen coordinates, of the client area of the window. + * in screen coordinates, of the content area of the window. * * @param[in] window The window whose callback to set. * @param[in] cbfun The new callback, or `NULL` to remove the currently set @@ -2122,15 +3509,14 @@ GLFWAPI GLFWwindowposfun glfwSetWindowPosCallback(GLFWwindow* window, GLFWwindow * @return The previously set callback, or `NULL` if no callback was set or the * library had not been [initialized](@ref intro_init). * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. * - * @sa @ref window_size + * @thread_safety This function must only be called from the main thread. * - * @since Added in GLFW 1.0. + * @sa @ref window_size * - * @par - * __GLFW 3:__ Added window handle parameter. Updated callback signature. + * @since Added in version 1.0. + * @glfw3 Added window handle parameter and return value. * * @ingroup window */ @@ -2153,18 +3539,17 @@ GLFWAPI GLFWwindowsizefun glfwSetWindowSizeCallback(GLFWwindow* window, GLFWwind * @return The previously set callback, or `NULL` if no callback was set or the * library had not been [initialized](@ref intro_init). * - * @remarks __OS X:__ Selecting Quit from the application menu will - * trigger the close callback for all windows. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. * - * @par Thread Safety - * This function may only be called from the main thread. + * @remark @macos Selecting Quit from the application menu will trigger the + * close callback for all windows. * - * @sa @ref window_close + * @thread_safety This function must only be called from the main thread. * - * @since Added in GLFW 2.5. + * @sa @ref window_close * - * @par - * __GLFW 3:__ Added window handle parameter. Updated callback signature. + * @since Added in version 2.5. + * @glfw3 Added window handle parameter and return value. * * @ingroup window */ @@ -2173,12 +3558,12 @@ GLFWAPI GLFWwindowclosefun glfwSetWindowCloseCallback(GLFWwindow* window, GLFWwi /*! @brief Sets the refresh callback for the specified window. * * This function sets the refresh callback of the specified window, which is - * called when the client area of the window needs to be redrawn, for example + * called when the content area of the window needs to be redrawn, for example * if the window has been exposed after having been covered by another window. * - * On compositing window systems such as Aero, Compiz or Aqua, where the window - * contents are saved off-screen, this callback may be called only very - * infrequently or never at all. + * On compositing window systems such as Aero, Compiz, Aqua or Wayland, where + * the window contents are saved off-screen, this callback may be called only + * very infrequently or never at all. * * @param[in] window The window whose callback to set. * @param[in] cbfun The new callback, or `NULL` to remove the currently set @@ -2186,15 +3571,14 @@ GLFWAPI GLFWwindowclosefun glfwSetWindowCloseCallback(GLFWwindow* window, GLFWwi * @return The previously set callback, or `NULL` if no callback was set or the * library had not been [initialized](@ref intro_init). * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. * - * @sa @ref window_refresh + * @thread_safety This function must only be called from the main thread. * - * @since Added in GLFW 2.5. + * @sa @ref window_refresh * - * @par - * __GLFW 3:__ Added window handle parameter. Updated callback signature. + * @since Added in version 2.5. + * @glfw3 Added window handle parameter and return value. * * @ingroup window */ @@ -2216,12 +3600,13 @@ GLFWAPI GLFWwindowrefreshfun glfwSetWindowRefreshCallback(GLFWwindow* window, GL * @return The previously set callback, or `NULL` if no callback was set or the * library had not been [initialized](@ref intro_init). * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref window_focus * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup window */ @@ -2238,21 +3623,25 @@ GLFWAPI GLFWwindowfocusfun glfwSetWindowFocusCallback(GLFWwindow* window, GLFWwi * @return The previously set callback, or `NULL` if no callback was set or the * library had not been [initialized](@ref intro_init). * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @remark @wayland The wl_shell protocol has no concept of iconification, + * this callback will never be called when using this deprecated protocol. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref window_iconify * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup window */ GLFWAPI GLFWwindowiconifyfun glfwSetWindowIconifyCallback(GLFWwindow* window, GLFWwindowiconifyfun cbfun); -/*! @brief Sets the framebuffer resize callback for the specified window. +/*! @brief Sets the maximize callback for the specified window. * - * This function sets the framebuffer resize callback of the specified window, - * which is called when the framebuffer of the specified window is resized. + * This function sets the maximization callback of the specified window, which + * is called when the window is maximized or restored. * * @param[in] window The window whose callback to set. * @param[in] cbfun The new callback, or `NULL` to remove the currently set @@ -2260,45 +3649,98 @@ GLFWAPI GLFWwindowiconifyfun glfwSetWindowIconifyCallback(GLFWwindow* window, GL * @return The previously set callback, or `NULL` if no callback was set or the * library had not been [initialized](@ref intro_init). * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. * - * @sa @ref window_fbsize + * @thread_safety This function must only be called from the main thread. * - * @since Added in GLFW 3.0. + * @sa @ref window_maximize + * + * @since Added in version 3.3. * * @ingroup window */ -GLFWAPI GLFWframebuffersizefun glfwSetFramebufferSizeCallback(GLFWwindow* window, GLFWframebuffersizefun cbfun); +GLFWAPI GLFWwindowmaximizefun glfwSetWindowMaximizeCallback(GLFWwindow* window, GLFWwindowmaximizefun cbfun); -/*! @brief Processes all pending events. +/*! @brief Sets the framebuffer resize callback for the specified window. * - * This function processes only those events that are already in the event - * queue and then returns immediately. Processing events will cause the window - * and input callbacks associated with those events to be called. + * This function sets the framebuffer resize callback of the specified window, + * which is called when the framebuffer of the specified window is resized. * - * On some platforms, a window move, resize or menu operation will cause event - * processing to block. This is due to how event processing is designed on - * those platforms. You can use the - * [window refresh callback](@ref window_refresh) to redraw the contents of - * your window when necessary during such operations. + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). * - * On some platforms, certain events are sent directly to the application - * without going through the event queue, causing callbacks to be called - * outside of a call to one of the event processing functions. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. * - * Event processing is not required for joystick input to work. + * @thread_safety This function must only be called from the main thread. * - * @par Reentrancy - * This function may not be called from a callback. + * @sa @ref window_fbsize * - * @par Thread Safety - * This function may only be called from the main thread. + * @since Added in version 3.0. * - * @sa @ref events - * @sa glfwWaitEvents + * @ingroup window + */ +GLFWAPI GLFWframebuffersizefun glfwSetFramebufferSizeCallback(GLFWwindow* window, GLFWframebuffersizefun cbfun); + +/*! @brief Sets the window content scale callback for the specified window. + * + * This function sets the window content scale callback of the specified window, + * which is called when the content scale of the specified window changes. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_scale + * @sa @ref glfwGetWindowContentScale * - * @since Added in GLFW 1.0. + * @since Added in version 3.3. + * + * @ingroup window + */ +GLFWAPI GLFWwindowcontentscalefun glfwSetWindowContentScaleCallback(GLFWwindow* window, GLFWwindowcontentscalefun cbfun); + +/*! @brief Processes all pending events. + * + * This function processes only those events that are already in the event + * queue and then returns immediately. Processing events will cause the window + * and input callbacks associated with those events to be called. + * + * On some platforms, a window move, resize or menu operation will cause event + * processing to block. This is due to how event processing is designed on + * those platforms. You can use the + * [window refresh callback](@ref window_refresh) to redraw the contents of + * your window when necessary during such operations. + * + * Do not assume that callbacks you set will _only_ be called in response to + * event processing functions like this one. While it is necessary to poll for + * events, window systems that require GLFW to register callbacks of its own + * can pass events to GLFW in response to many window system function calls. + * GLFW will pass those events on to the application callbacks before + * returning. + * + * Event processing is not required for joystick input to work. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref events + * @sa @ref glfwWaitEvents + * @sa @ref glfwWaitEventsTimeout + * + * @since Added in version 1.0. * * @ingroup window */ @@ -2323,46 +3765,96 @@ GLFWAPI void glfwPollEvents(void); * [window refresh callback](@ref window_refresh) to redraw the contents of * your window when necessary during such operations. * - * On some platforms, certain callbacks may be called outside of a call to one - * of the event processing functions. - * - * If no windows exist, this function returns immediately. For synchronization - * of threads in applications that do not create windows, use your threading - * library of choice. + * Do not assume that callbacks you set will _only_ be called in response to + * event processing functions like this one. While it is necessary to poll for + * events, window systems that require GLFW to register callbacks of its own + * can pass events to GLFW in response to many window system function calls. + * GLFW will pass those events on to the application callbacks before + * returning. * * Event processing is not required for joystick input to work. * - * @par Reentrancy - * This function may not be called from a callback. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @par Thread Safety - * This function may only be called from the main thread. + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref events - * @sa glfwPollEvents + * @sa @ref glfwPollEvents + * @sa @ref glfwWaitEventsTimeout * - * @since Added in GLFW 2.5. + * @since Added in version 2.5. * * @ingroup window */ GLFWAPI void glfwWaitEvents(void); +/*! @brief Waits with timeout until events are queued and processes them. + * + * This function puts the calling thread to sleep until at least one event is + * available in the event queue, or until the specified timeout is reached. If + * one or more events are available, it behaves exactly like @ref + * glfwPollEvents, i.e. the events in the queue are processed and the function + * then returns immediately. Processing events will cause the window and input + * callbacks associated with those events to be called. + * + * The timeout value must be a positive finite number. + * + * Since not all events are associated with callbacks, this function may return + * without a callback having been called even if you are monitoring all + * callbacks. + * + * On some platforms, a window move, resize or menu operation will cause event + * processing to block. This is due to how event processing is designed on + * those platforms. You can use the + * [window refresh callback](@ref window_refresh) to redraw the contents of + * your window when necessary during such operations. + * + * Do not assume that callbacks you set will _only_ be called in response to + * event processing functions like this one. While it is necessary to poll for + * events, window systems that require GLFW to register callbacks of its own + * can pass events to GLFW in response to many window system function calls. + * GLFW will pass those events on to the application callbacks before + * returning. + * + * Event processing is not required for joystick input to work. + * + * @param[in] timeout The maximum amount of time, in seconds, to wait. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_VALUE and @ref GLFW_PLATFORM_ERROR. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref events + * @sa @ref glfwPollEvents + * @sa @ref glfwWaitEvents + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwWaitEventsTimeout(double timeout); + /*! @brief Posts an empty event to the event queue. * * This function posts an empty event from the current thread to the event - * queue, causing @ref glfwWaitEvents to return. + * queue, causing @ref glfwWaitEvents or @ref glfwWaitEventsTimeout to return. * - * If no windows exist, this function returns immediately. For synchronization - * of threads in applications that do not create windows, use your threading - * library of choice. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @par Thread Safety - * This function may be called from any thread. + * @thread_safety This function may be called from any thread. * * @sa @ref events - * @sa glfwWaitEvents + * @sa @ref glfwWaitEvents + * @sa @ref glfwWaitEventsTimeout * - * @since Added in GLFW 3.1. + * @since Added in version 3.1. * * @ingroup window */ @@ -2371,19 +3863,23 @@ GLFWAPI void glfwPostEmptyEvent(void); /*! @brief Returns the value of an input option for the specified window. * * This function returns the value of an input option for the specified window. - * The mode must be one of `GLFW_CURSOR`, `GLFW_STICKY_KEYS` or - * `GLFW_STICKY_MOUSE_BUTTONS`. + * The mode must be one of @ref GLFW_CURSOR, @ref GLFW_STICKY_KEYS, + * @ref GLFW_STICKY_MOUSE_BUTTONS, @ref GLFW_LOCK_KEY_MODS or + * @ref GLFW_RAW_MOUSE_MOTION. * * @param[in] window The window to query. - * @param[in] mode One of `GLFW_CURSOR`, `GLFW_STICKY_KEYS` or - * `GLFW_STICKY_MOUSE_BUTTONS`. + * @param[in] mode One of `GLFW_CURSOR`, `GLFW_STICKY_KEYS`, + * `GLFW_STICKY_MOUSE_BUTTONS`, `GLFW_LOCK_KEY_MODS` or + * `GLFW_RAW_MOUSE_MOTION`. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @thread_safety This function must only be called from the main thread. * - * @sa glfwSetInputMode + * @sa @ref glfwSetInputMode * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup input */ @@ -2392,49 +3888,184 @@ GLFWAPI int glfwGetInputMode(GLFWwindow* window, int mode); /*! @brief Sets an input option for the specified window. * * This function sets an input mode option for the specified window. The mode - * must be one of `GLFW_CURSOR`, `GLFW_STICKY_KEYS` or - * `GLFW_STICKY_MOUSE_BUTTONS`. + * must be one of @ref GLFW_CURSOR, @ref GLFW_STICKY_KEYS, + * @ref GLFW_STICKY_MOUSE_BUTTONS, @ref GLFW_LOCK_KEY_MODS or + * @ref GLFW_RAW_MOUSE_MOTION. * * If the mode is `GLFW_CURSOR`, the value must be one of the following cursor * modes: * - `GLFW_CURSOR_NORMAL` makes the cursor visible and behaving normally. - * - `GLFW_CURSOR_HIDDEN` makes the cursor invisible when it is over the client - * area of the window but does not restrict the cursor from leaving. + * - `GLFW_CURSOR_HIDDEN` makes the cursor invisible when it is over the + * content area of the window but does not restrict the cursor from leaving. * - `GLFW_CURSOR_DISABLED` hides and grabs the cursor, providing virtual * and unlimited cursor movement. This is useful for implementing for * example 3D camera controls. * - * If the mode is `GLFW_STICKY_KEYS`, the value must be either `GL_TRUE` to - * enable sticky keys, or `GL_FALSE` to disable it. If sticky keys are + * If the mode is `GLFW_STICKY_KEYS`, the value must be either `GLFW_TRUE` to + * enable sticky keys, or `GLFW_FALSE` to disable it. If sticky keys are * enabled, a key press will ensure that @ref glfwGetKey returns `GLFW_PRESS` * the next time it is called even if the key had been released before the * call. This is useful when you are only interested in whether keys have been * pressed but not when or in which order. * * If the mode is `GLFW_STICKY_MOUSE_BUTTONS`, the value must be either - * `GL_TRUE` to enable sticky mouse buttons, or `GL_FALSE` to disable it. If - * sticky mouse buttons are enabled, a mouse button press will ensure that @ref - * glfwGetMouseButton returns `GLFW_PRESS` the next time it is called even if - * the mouse button had been released before the call. This is useful when you - * are only interested in whether mouse buttons have been pressed but not when - * or in which order. + * `GLFW_TRUE` to enable sticky mouse buttons, or `GLFW_FALSE` to disable it. + * If sticky mouse buttons are enabled, a mouse button press will ensure that + * @ref glfwGetMouseButton returns `GLFW_PRESS` the next time it is called even + * if the mouse button had been released before the call. This is useful when + * you are only interested in whether mouse buttons have been pressed but not + * when or in which order. + * + * If the mode is `GLFW_LOCK_KEY_MODS`, the value must be either `GLFW_TRUE` to + * enable lock key modifier bits, or `GLFW_FALSE` to disable them. If enabled, + * callbacks that receive modifier bits will also have the @ref + * GLFW_MOD_CAPS_LOCK bit set when the event was generated with Caps Lock on, + * and the @ref GLFW_MOD_NUM_LOCK bit when Num Lock was on. + * + * If the mode is `GLFW_RAW_MOUSE_MOTION`, the value must be either `GLFW_TRUE` + * to enable raw (unscaled and unaccelerated) mouse motion when the cursor is + * disabled, or `GLFW_FALSE` to disable it. If raw motion is not supported, + * attempting to set this will emit @ref GLFW_PLATFORM_ERROR. Call @ref + * glfwRawMouseMotionSupported to check for support. * * @param[in] window The window whose input mode to set. - * @param[in] mode One of `GLFW_CURSOR`, `GLFW_STICKY_KEYS` or - * `GLFW_STICKY_MOUSE_BUTTONS`. + * @param[in] mode One of `GLFW_CURSOR`, `GLFW_STICKY_KEYS`, + * `GLFW_STICKY_MOUSE_BUTTONS`, `GLFW_LOCK_KEY_MODS` or + * `GLFW_RAW_MOUSE_MOTION`. * @param[in] value The new value of the specified input mode. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. * - * @sa glfwGetInputMode + * @sa @ref glfwGetInputMode * - * @since Added in GLFW 3.0. Replaces `glfwEnable` and `glfwDisable`. + * @since Added in version 3.0. Replaces `glfwEnable` and `glfwDisable`. * * @ingroup input */ GLFWAPI void glfwSetInputMode(GLFWwindow* window, int mode, int value); +/*! @brief Returns whether raw mouse motion is supported. + * + * This function returns whether raw mouse motion is supported on the current + * system. This status does not change after GLFW has been initialized so you + * only need to check this once. If you attempt to enable raw motion on + * a system that does not support it, @ref GLFW_PLATFORM_ERROR will be emitted. + * + * Raw mouse motion is closer to the actual motion of the mouse across + * a surface. It is not affected by the scaling and acceleration applied to + * the motion of the desktop cursor. That processing is suitable for a cursor + * while raw motion is better for controlling for example a 3D camera. Because + * of this, raw mouse motion is only provided when the cursor is disabled. + * + * @return `GLFW_TRUE` if raw mouse motion is supported on the current machine, + * or `GLFW_FALSE` otherwise. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref raw_mouse_motion + * @sa @ref glfwSetInputMode + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI int glfwRawMouseMotionSupported(void); + +/*! @brief Returns the layout-specific name of the specified printable key. + * + * This function returns the name of the specified printable key, encoded as + * UTF-8. This is typically the character that key would produce without any + * modifier keys, intended for displaying key bindings to the user. For dead + * keys, it is typically the diacritic it would add to a character. + * + * __Do not use this function__ for [text input](@ref input_char). You will + * break text input for many languages even if it happens to work for yours. + * + * If the key is `GLFW_KEY_UNKNOWN`, the scancode is used to identify the key, + * otherwise the scancode is ignored. If you specify a non-printable key, or + * `GLFW_KEY_UNKNOWN` and a scancode that maps to a non-printable key, this + * function returns `NULL` but does not emit an error. + * + * This behavior allows you to always pass in the arguments in the + * [key callback](@ref input_key) without modification. + * + * The printable keys are: + * - `GLFW_KEY_APOSTROPHE` + * - `GLFW_KEY_COMMA` + * - `GLFW_KEY_MINUS` + * - `GLFW_KEY_PERIOD` + * - `GLFW_KEY_SLASH` + * - `GLFW_KEY_SEMICOLON` + * - `GLFW_KEY_EQUAL` + * - `GLFW_KEY_LEFT_BRACKET` + * - `GLFW_KEY_RIGHT_BRACKET` + * - `GLFW_KEY_BACKSLASH` + * - `GLFW_KEY_WORLD_1` + * - `GLFW_KEY_WORLD_2` + * - `GLFW_KEY_0` to `GLFW_KEY_9` + * - `GLFW_KEY_A` to `GLFW_KEY_Z` + * - `GLFW_KEY_KP_0` to `GLFW_KEY_KP_9` + * - `GLFW_KEY_KP_DECIMAL` + * - `GLFW_KEY_KP_DIVIDE` + * - `GLFW_KEY_KP_MULTIPLY` + * - `GLFW_KEY_KP_SUBTRACT` + * - `GLFW_KEY_KP_ADD` + * - `GLFW_KEY_KP_EQUAL` + * + * Names for printable keys depend on keyboard layout, while names for + * non-printable keys are the same across layouts but depend on the application + * language and should be localized along with other user interface text. + * + * @param[in] key The key to query, or `GLFW_KEY_UNKNOWN`. + * @param[in] scancode The scancode of the key to query. + * @return The UTF-8 encoded, layout-specific name of the key, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the next call to @ref + * glfwGetKeyName, or until the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref input_key_name + * + * @since Added in version 3.2. + * + * @ingroup input + */ +GLFWAPI const char* glfwGetKeyName(int key, int scancode); + +/*! @brief Returns the platform-specific scancode of the specified key. + * + * This function returns the platform-specific scancode of the specified key. + * + * If the key is `GLFW_KEY_UNKNOWN` or does not exist on the keyboard this + * method will return `-1`. + * + * @param[in] key Any [named key](@ref keys). + * @return The platform-specific scancode for the key, or `-1` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref input_key + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI int glfwGetKeyScancode(int key); + /*! @brief Returns the last reported state of a keyboard key for the specified * window. * @@ -2443,7 +4074,7 @@ GLFWAPI void glfwSetInputMode(GLFWwindow* window, int mode, int value); * `GLFW_RELEASE`. The higher-level action `GLFW_REPEAT` is only reported to * the key callback. * - * If the `GLFW_STICKY_KEYS` input mode is enabled, this function returns + * If the @ref GLFW_STICKY_KEYS input mode is enabled, this function returns * `GLFW_PRESS` the first time you call it for a key that was pressed, even if * that key has already been released. * @@ -2454,20 +4085,22 @@ GLFWAPI void glfwSetInputMode(GLFWwindow* window, int mode, int value); * The [modifier key bit masks](@ref mods) are not key tokens and cannot be * used with this function. * + * __Do not use this function__ to implement [text input](@ref input_char). + * * @param[in] window The desired window. * @param[in] key The desired [keyboard key](@ref keys). `GLFW_KEY_UNKNOWN` is * not a valid key for this function. * @return One of `GLFW_PRESS` or `GLFW_RELEASE`. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. * - * @sa @ref input_key + * @thread_safety This function must only be called from the main thread. * - * @since Added in GLFW 1.0. + * @sa @ref input_key * - * @par - * __GLFW 3:__ Added window handle parameter. + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. * * @ingroup input */ @@ -2480,33 +4113,33 @@ GLFWAPI int glfwGetKey(GLFWwindow* window, int key); * to the specified window. The returned state is one of `GLFW_PRESS` or * `GLFW_RELEASE`. * - * If the `GLFW_STICKY_MOUSE_BUTTONS` input mode is enabled, this function - * `GLFW_PRESS` the first time you call it for a mouse button that was pressed, - * even if that mouse button has already been released. + * If the @ref GLFW_STICKY_MOUSE_BUTTONS input mode is enabled, this function + * returns `GLFW_PRESS` the first time you call it for a mouse button that was + * pressed, even if that mouse button has already been released. * * @param[in] window The desired window. * @param[in] button The desired [mouse button](@ref buttons). * @return One of `GLFW_PRESS` or `GLFW_RELEASE`. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. * - * @sa @ref input_mouse_button + * @thread_safety This function must only be called from the main thread. * - * @since Added in GLFW 1.0. + * @sa @ref input_mouse_button * - * @par - * __GLFW 3:__ Added window handle parameter. + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. * * @ingroup input */ GLFWAPI int glfwGetMouseButton(GLFWwindow* window, int button); -/*! @brief Retrieves the position of the cursor relative to the client area of +/*! @brief Retrieves the position of the cursor relative to the content area of * the window. * * This function returns the position of the cursor, in screen coordinates, - * relative to the upper-left corner of the client area of the specified + * relative to the upper-left corner of the content area of the specified * window. * * If the cursor is disabled (with `GLFW_CURSOR_DISABLED`) then the cursor @@ -2522,27 +4155,29 @@ GLFWAPI int glfwGetMouseButton(GLFWwindow* window, int button); * * @param[in] window The desired window. * @param[out] xpos Where to store the cursor x-coordinate, relative to the - * left edge of the client area, or `NULL`. + * left edge of the content area, or `NULL`. * @param[out] ypos Where to store the cursor y-coordinate, relative to the to - * top edge of the client area, or `NULL`. + * top edge of the content area, or `NULL`. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref cursor_pos - * @sa glfwSetCursorPos + * @sa @ref glfwSetCursorPos * - * @since Added in GLFW 3.0. Replaces `glfwGetMousePos`. + * @since Added in version 3.0. Replaces `glfwGetMousePos`. * * @ingroup input */ GLFWAPI void glfwGetCursorPos(GLFWwindow* window, double* xpos, double* ypos); -/*! @brief Sets the position of the cursor, relative to the client area of the +/*! @brief Sets the position of the cursor, relative to the content area of the * window. * * This function sets the position, in screen coordinates, of the cursor - * relative to the upper-left corner of the client area of the specified + * relative to the upper-left corner of the content area of the specified * window. The window must have input focus. If the window does not have * input focus when this function is called, it fails silently. * @@ -2557,21 +4192,22 @@ GLFWAPI void glfwGetCursorPos(GLFWwindow* window, double* xpos, double* ypos); * * @param[in] window The desired window. * @param[in] xpos The desired x-coordinate, relative to the left edge of the - * client area. + * content area. * @param[in] ypos The desired y-coordinate, relative to the top edge of the - * client area. + * content area. * - * @remarks __X11:__ Due to the asynchronous nature of a modern X desktop, it - * may take a moment for the window focus event to arrive. This means you will - * not be able to set the cursor position directly after window creation. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @par Thread Safety - * This function may only be called from the main thread. + * @remark @wayland This function will only work when the cursor mode is + * `GLFW_CURSOR_DISABLED`, otherwise it will do nothing. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref cursor_pos - * @sa glfwGetCursorPos + * @sa @ref glfwGetCursorPos * - * @since Added in GLFW 3.0. Replaces `glfwSetMousePos`. + * @since Added in version 3.0. Replaces `glfwSetMousePos`. * * @ingroup input */ @@ -2583,9 +4219,9 @@ GLFWAPI void glfwSetCursorPos(GLFWwindow* window, double xpos, double ypos); * glfwSetCursor. The cursor can be destroyed with @ref glfwDestroyCursor. * Any remaining cursors are destroyed by @ref glfwTerminate. * - * The pixels are 32-bit little-endian RGBA, i.e. eight bits per channel. They - * are arranged canonically as packed sequential rows, starting from the - * top-left corner. + * The pixels are 32-bit, little-endian, non-premultiplied RGBA, i.e. eight + * bits per channel with the red channel first. They are arranged canonically + * as packed sequential rows, starting from the top-left corner. * * The cursor hotspot is specified in pixels, relative to the upper-left corner * of the cursor image. Like all other coordinate systems in GLFW, the X-axis @@ -2594,24 +4230,22 @@ GLFWAPI void glfwSetCursorPos(GLFWwindow* window, double xpos, double ypos); * @param[in] image The desired cursor image. * @param[in] xhot The desired x-coordinate, in pixels, of the cursor hotspot. * @param[in] yhot The desired y-coordinate, in pixels, of the cursor hotspot. - * * @return The handle of the created cursor, or `NULL` if an * [error](@ref error_handling) occurred. * - * @par Pointer Lifetime - * The specified image data is copied before this function returns. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @par Reentrancy - * This function may not be called from a callback. + * @pointer_lifetime The specified image data is copied before this function + * returns. * - * @par Thread Safety - * This function may only be called from the main thread. + * @thread_safety This function must only be called from the main thread. * * @sa @ref cursor_object - * @sa glfwDestroyCursor - * @sa glfwCreateStandardCursor + * @sa @ref glfwDestroyCursor + * @sa @ref glfwCreateStandardCursor * - * @since Added in GLFW 3.1. + * @since Added in version 3.1. * * @ingroup input */ @@ -2623,20 +4257,18 @@ GLFWAPI GLFWcursor* glfwCreateCursor(const GLFWimage* image, int xhot, int yhot) * a window with @ref glfwSetCursor. * * @param[in] shape One of the [standard shapes](@ref shapes). - * * @return A new cursor ready to use or `NULL` if an * [error](@ref error_handling) occurred. * - * @par Reentrancy - * This function may not be called from a callback. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. * - * @par Thread Safety - * This function may only be called from the main thread. + * @thread_safety This function must only be called from the main thread. * * @sa @ref cursor_object - * @sa glfwCreateCursor + * @sa @ref glfwCreateCursor * - * @since Added in GLFW 3.1. + * @since Added in version 3.1. * * @ingroup input */ @@ -2648,18 +4280,22 @@ GLFWAPI GLFWcursor* glfwCreateStandardCursor(int shape); * glfwCreateCursor. Any remaining cursors will be destroyed by @ref * glfwTerminate. * + * If the specified cursor is current for any window, that window will be + * reverted to the default cursor. This does not affect the cursor mode. + * * @param[in] cursor The cursor object to destroy. * - * @par Reentrancy - * This function may not be called from a callback. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @par Thread Safety - * This function may only be called from the main thread. + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref cursor_object - * @sa glfwCreateCursor + * @sa @ref glfwCreateCursor * - * @since Added in GLFW 3.1. + * @since Added in version 3.1. * * @ingroup input */ @@ -2668,7 +4304,7 @@ GLFWAPI void glfwDestroyCursor(GLFWcursor* cursor); /*! @brief Sets the cursor for the window. * * This function sets the cursor image to be used when the cursor is over the - * client area of the specified window. The set cursor will only be visible + * content area of the specified window. The set cursor will only be visible * when the [cursor mode](@ref cursor_mode) of the window is * `GLFW_CURSOR_NORMAL`. * @@ -2679,12 +4315,14 @@ GLFWAPI void glfwDestroyCursor(GLFWcursor* cursor); * @param[in] cursor The cursor to set, or `NULL` to switch back to the default * arrow cursor. * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref cursor_object * - * @since Added in GLFW 3.1. + * @since Added in version 3.1. * * @ingroup input */ @@ -2720,15 +4358,14 @@ GLFWAPI void glfwSetCursor(GLFWwindow* window, GLFWcursor* cursor); * @return The previously set callback, or `NULL` if no callback was set or the * library had not been [initialized](@ref intro_init). * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. * - * @sa @ref input_key + * @thread_safety This function must only be called from the main thread. * - * @since Added in GLFW 1.0. + * @sa @ref input_key * - * @par - * __GLFW 3:__ Added window handle parameter. Updated callback signature. + * @since Added in version 1.0. + * @glfw3 Added window handle parameter and return value. * * @ingroup input */ @@ -2748,10 +4385,8 @@ GLFWAPI GLFWkeyfun glfwSetKeyCallback(GLFWwindow* window, GLFWkeyfun cbfun); * * The character callback behaves as system text input normally does and will * not be called if modifier keys are held down that would prevent normal text - * input on that platform, for example a Super (Command) key on OS X or Alt key - * on Windows. There is a - * [character with modifiers callback](@ref glfwSetCharModsCallback) that - * receives these events. + * input on that platform, for example a Super (Command) key on macOS or Alt key + * on Windows. * * @param[in] window The window whose callback to set. * @param[in] cbfun The new callback, or `NULL` to remove the currently set @@ -2759,15 +4394,14 @@ GLFWAPI GLFWkeyfun glfwSetKeyCallback(GLFWwindow* window, GLFWkeyfun cbfun); * @return The previously set callback, or `NULL` if no callback was set or the * library had not been [initialized](@ref intro_init). * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref input_char * - * @since Added in GLFW 2.4. - * - * @par - * __GLFW 3:__ Added window handle parameter. Updated callback signature. + * @since Added in version 2.4. + * @glfw3 Added window handle parameter and return value. * * @ingroup input */ @@ -2792,14 +4426,17 @@ GLFWAPI GLFWcharfun glfwSetCharCallback(GLFWwindow* window, GLFWcharfun cbfun); * @param[in] cbfun The new callback, or `NULL` to remove the currently set * callback. * @return The previously set callback, or `NULL` if no callback was set or an - * error occurred. + * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may only be called from the main thread. + * @deprecated Scheduled for removal in version 4.0. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref input_char * - * @since Added in GLFW 3.1. + * @since Added in version 3.1. * * @ingroup input */ @@ -2822,15 +4459,14 @@ GLFWAPI GLFWcharmodsfun glfwSetCharModsCallback(GLFWwindow* window, GLFWcharmods * @return The previously set callback, or `NULL` if no callback was set or the * library had not been [initialized](@ref intro_init). * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref input_mouse_button * - * @since Added in GLFW 1.0. - * - * @par - * __GLFW 3:__ Added window handle parameter. Updated callback signature. + * @since Added in version 1.0. + * @glfw3 Added window handle parameter and return value. * * @ingroup input */ @@ -2841,7 +4477,7 @@ GLFWAPI GLFWmousebuttonfun glfwSetMouseButtonCallback(GLFWwindow* window, GLFWmo * This function sets the cursor position callback of the specified window, * which is called when the cursor is moved. The callback is provided with the * position, in screen coordinates, relative to the upper-left corner of the - * client area of the window. + * content area of the window. * * @param[in] window The window whose callback to set. * @param[in] cbfun The new callback, or `NULL` to remove the currently set @@ -2849,12 +4485,13 @@ GLFWAPI GLFWmousebuttonfun glfwSetMouseButtonCallback(GLFWwindow* window, GLFWmo * @return The previously set callback, or `NULL` if no callback was set or the * library had not been [initialized](@ref intro_init). * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref cursor_pos * - * @since Added in GLFW 3.0. Replaces `glfwSetMousePosCallback`. + * @since Added in version 3.0. Replaces `glfwSetMousePosCallback`. * * @ingroup input */ @@ -2863,7 +4500,7 @@ GLFWAPI GLFWcursorposfun glfwSetCursorPosCallback(GLFWwindow* window, GLFWcursor /*! @brief Sets the cursor enter/exit callback. * * This function sets the cursor boundary crossing callback of the specified - * window, which is called when the cursor enters or leaves the client area of + * window, which is called when the cursor enters or leaves the content area of * the window. * * @param[in] window The window whose callback to set. @@ -2872,12 +4509,13 @@ GLFWAPI GLFWcursorposfun glfwSetCursorPosCallback(GLFWwindow* window, GLFWcursor * @return The previously set callback, or `NULL` if no callback was set or the * library had not been [initialized](@ref intro_init). * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref cursor_enter * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup input */ @@ -2898,12 +4536,13 @@ GLFWAPI GLFWcursorenterfun glfwSetCursorEnterCallback(GLFWwindow* window, GLFWcu * @return The previously set callback, or `NULL` if no callback was set or the * library had not been [initialized](@ref intro_init). * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref scrolling * - * @since Added in GLFW 3.0. Replaces `glfwSetMouseWheelCallback`. + * @since Added in version 3.0. Replaces `glfwSetMouseWheelCallback`. * * @ingroup input */ @@ -2925,12 +4564,15 @@ GLFWAPI GLFWscrollfun glfwSetScrollCallback(GLFWwindow* window, GLFWscrollfun cb * @return The previously set callback, or `NULL` if no callback was set or the * library had not been [initialized](@ref intro_init). * - * @par Thread Safety - * This function may only be called from the main thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @remark @wayland File drop is currently unimplemented. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref path_drop * - * @since Added in GLFW 3.1. + * @since Added in version 3.1. * * @ingroup input */ @@ -2940,74 +4582,156 @@ GLFWAPI GLFWdropfun glfwSetDropCallback(GLFWwindow* window, GLFWdropfun cbfun); * * This function returns whether the specified joystick is present. * - * @param[in] joy The [joystick](@ref joysticks) to query. - * @return `GL_TRUE` if the joystick is present, or `GL_FALSE` otherwise. + * There is no need to call this function before other functions that accept + * a joystick ID, as they all check for presence before performing any other + * work. * - * @par Thread Safety - * This function may only be called from the main thread. + * @param[in] jid The [joystick](@ref joysticks) to query. + * @return `GLFW_TRUE` if the joystick is present, or `GLFW_FALSE` otherwise. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref joystick * - * @since Added in GLFW 3.0. Replaces `glfwGetJoystickParam`. + * @since Added in version 3.0. Replaces `glfwGetJoystickParam`. * * @ingroup input */ -GLFWAPI int glfwJoystickPresent(int joy); +GLFWAPI int glfwJoystickPresent(int jid); /*! @brief Returns the values of all axes of the specified joystick. * * This function returns the values of all axes of the specified joystick. * Each element in the array is a value between -1.0 and 1.0. * - * @param[in] joy The [joystick](@ref joysticks) to query. + * If the specified joystick is not present this function will return `NULL` + * but will not generate an error. This can be used instead of first calling + * @ref glfwJoystickPresent. + * + * @param[in] jid The [joystick](@ref joysticks) to query. * @param[out] count Where to store the number of axis values in the returned - * array. This is set to zero if an error occurred. - * @return An array of axis values, or `NULL` if the joystick is not present. + * array. This is set to zero if the joystick is not present or an error + * occurred. + * @return An array of axis values, or `NULL` if the joystick is not present or + * an [error](@ref error_handling) occurred. * - * @par Pointer Lifetime - * The returned array is allocated and freed by GLFW. You should not free it - * yourself. It is valid until the specified joystick is disconnected, this - * function is called again for that joystick or the library is terminated. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. * - * @par Thread Safety - * This function may only be called from the main thread. + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified joystick is + * disconnected or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref joystick_axis * - * @since Added in GLFW 3.0. Replaces `glfwGetJoystickPos`. + * @since Added in version 3.0. Replaces `glfwGetJoystickPos`. * * @ingroup input */ -GLFWAPI const float* glfwGetJoystickAxes(int joy, int* count); +GLFWAPI const float* glfwGetJoystickAxes(int jid, int* count); /*! @brief Returns the state of all buttons of the specified joystick. * * This function returns the state of all buttons of the specified joystick. * Each element in the array is either `GLFW_PRESS` or `GLFW_RELEASE`. * - * @param[in] joy The [joystick](@ref joysticks) to query. + * For backward compatibility with earlier versions that did not have @ref + * glfwGetJoystickHats, the button array also includes all hats, each + * represented as four buttons. The hats are in the same order as returned by + * __glfwGetJoystickHats__ and are in the order _up_, _right_, _down_ and + * _left_. To disable these extra buttons, set the @ref + * GLFW_JOYSTICK_HAT_BUTTONS init hint before initialization. + * + * If the specified joystick is not present this function will return `NULL` + * but will not generate an error. This can be used instead of first calling + * @ref glfwJoystickPresent. + * + * @param[in] jid The [joystick](@ref joysticks) to query. * @param[out] count Where to store the number of button states in the returned - * array. This is set to zero if an error occurred. - * @return An array of button states, or `NULL` if the joystick is not present. + * array. This is set to zero if the joystick is not present or an error + * occurred. + * @return An array of button states, or `NULL` if the joystick is not present + * or an [error](@ref error_handling) occurred. * - * @par Pointer Lifetime - * The returned array is allocated and freed by GLFW. You should not free it - * yourself. It is valid until the specified joystick is disconnected, this - * function is called again for that joystick or the library is terminated. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. * - * @par Thread Safety - * This function may only be called from the main thread. + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified joystick is + * disconnected or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref joystick_button * - * @since Added in GLFW 2.2. + * @since Added in version 2.2. + * @glfw3 Changed to return a dynamic array. * - * @par - * __GLFW 3:__ Changed to return a dynamic array. + * @ingroup input + */ +GLFWAPI const unsigned char* glfwGetJoystickButtons(int jid, int* count); + +/*! @brief Returns the state of all hats of the specified joystick. + * + * This function returns the state of all hats of the specified joystick. + * Each element in the array is one of the following values: + * + * Name | Value + * ---- | ----- + * `GLFW_HAT_CENTERED` | 0 + * `GLFW_HAT_UP` | 1 + * `GLFW_HAT_RIGHT` | 2 + * `GLFW_HAT_DOWN` | 4 + * `GLFW_HAT_LEFT` | 8 + * `GLFW_HAT_RIGHT_UP` | `GLFW_HAT_RIGHT` \| `GLFW_HAT_UP` + * `GLFW_HAT_RIGHT_DOWN` | `GLFW_HAT_RIGHT` \| `GLFW_HAT_DOWN` + * `GLFW_HAT_LEFT_UP` | `GLFW_HAT_LEFT` \| `GLFW_HAT_UP` + * `GLFW_HAT_LEFT_DOWN` | `GLFW_HAT_LEFT` \| `GLFW_HAT_DOWN` + * + * The diagonal directions are bitwise combinations of the primary (up, right, + * down and left) directions and you can test for these individually by ANDing + * it with the corresponding direction. + * + * @code + * if (hats[2] & GLFW_HAT_RIGHT) + * { + * // State of hat 2 could be right-up, right or right-down + * } + * @endcode + * + * If the specified joystick is not present this function will return `NULL` + * but will not generate an error. This can be used instead of first calling + * @ref glfwJoystickPresent. + * + * @param[in] jid The [joystick](@ref joysticks) to query. + * @param[out] count Where to store the number of hat states in the returned + * array. This is set to zero if the joystick is not present or an error + * occurred. + * @return An array of hat states, or `NULL` if the joystick is not present + * or an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified joystick is + * disconnected, this function is called again for that joystick or the library + * is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref joystick_hat + * + * @since Added in version 3.3. * * @ingroup input */ -GLFWAPI const unsigned char* glfwGetJoystickButtons(int joy, int* count); +GLFWAPI const unsigned char* glfwGetJoystickHats(int jid, int* count); /*! @brief Returns the name of the specified joystick. * @@ -3015,44 +4739,301 @@ GLFWAPI const unsigned char* glfwGetJoystickButtons(int joy, int* count); * The returned string is allocated and freed by GLFW. You should not free it * yourself. * - * @param[in] joy The [joystick](@ref joysticks) to query. + * If the specified joystick is not present this function will return `NULL` + * but will not generate an error. This can be used instead of first calling + * @ref glfwJoystickPresent. + * + * @param[in] jid The [joystick](@ref joysticks) to query. * @return The UTF-8 encoded name of the joystick, or `NULL` if the joystick - * is not present. + * is not present or an [error](@ref error_handling) occurred. * - * @par Pointer Lifetime - * The returned string is allocated and freed by GLFW. You should not free it - * yourself. It is valid until the specified joystick is disconnected, this - * function is called again for that joystick or the library is terminated. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. * - * @par Thread Safety - * This function may only be called from the main thread. + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified joystick is + * disconnected or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref joystick_name * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. + * + * @ingroup input + */ +GLFWAPI const char* glfwGetJoystickName(int jid); + +/*! @brief Returns the SDL comaptible GUID of the specified joystick. + * + * This function returns the SDL compatible GUID, as a UTF-8 encoded + * hexadecimal string, of the specified joystick. The returned string is + * allocated and freed by GLFW. You should not free it yourself. + * + * The GUID is what connects a joystick to a gamepad mapping. A connected + * joystick will always have a GUID even if there is no gamepad mapping + * assigned to it. + * + * If the specified joystick is not present this function will return `NULL` + * but will not generate an error. This can be used instead of first calling + * @ref glfwJoystickPresent. + * + * The GUID uses the format introduced in SDL 2.0.5. This GUID tries to + * uniquely identify the make and model of a joystick but does not identify + * a specific unit, e.g. all wired Xbox 360 controllers will have the same + * GUID on that platform. The GUID for a unit may vary between platforms + * depending on what hardware information the platform specific APIs provide. + * + * @param[in] jid The [joystick](@ref joysticks) to query. + * @return The UTF-8 encoded GUID of the joystick, or `NULL` if the joystick + * is not present or an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified joystick is + * disconnected or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref gamepad + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI const char* glfwGetJoystickGUID(int jid); + +/*! @brief Sets the user pointer of the specified joystick. + * + * This function sets the user-defined pointer of the specified joystick. The + * current value is retained until the joystick is disconnected. The initial + * value is `NULL`. + * + * This function may be called from the joystick callback, even for a joystick + * that is being disconnected. + * + * @param[in] jid The joystick whose pointer to set. + * @param[in] pointer The new value. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref joystick_userptr + * @sa @ref glfwGetJoystickUserPointer + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI void glfwSetJoystickUserPointer(int jid, void* pointer); + +/*! @brief Returns the user pointer of the specified joystick. + * + * This function returns the current value of the user-defined pointer of the + * specified joystick. The initial value is `NULL`. + * + * This function may be called from the joystick callback, even for a joystick + * that is being disconnected. + * + * @param[in] jid The joystick whose pointer to return. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref joystick_userptr + * @sa @ref glfwSetJoystickUserPointer + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI void* glfwGetJoystickUserPointer(int jid); + +/*! @brief Returns whether the specified joystick has a gamepad mapping. + * + * This function returns whether the specified joystick is both present and has + * a gamepad mapping. + * + * If the specified joystick is present but does not have a gamepad mapping + * this function will return `GLFW_FALSE` but will not generate an error. Call + * @ref glfwJoystickPresent to check if a joystick is present regardless of + * whether it has a mapping. + * + * @param[in] jid The [joystick](@ref joysticks) to query. + * @return `GLFW_TRUE` if a joystick is both present and has a gamepad mapping, + * or `GLFW_FALSE` otherwise. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref gamepad + * @sa @ref glfwGetGamepadState + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI int glfwJoystickIsGamepad(int jid); + +/*! @brief Sets the joystick configuration callback. + * + * This function sets the joystick configuration callback, or removes the + * currently set callback. This is called when a joystick is connected to or + * disconnected from the system. + * + * For joystick connection and disconnection events to be delivered on all + * platforms, you need to call one of the [event processing](@ref events) + * functions. Joystick disconnection may also be detected and the callback + * called by joystick functions. The function will then return whatever it + * returns if the joystick is not present. + * + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref joystick_event + * + * @since Added in version 3.2. + * + * @ingroup input + */ +GLFWAPI GLFWjoystickfun glfwSetJoystickCallback(GLFWjoystickfun cbfun); + +/*! @brief Adds the specified SDL_GameControllerDB gamepad mappings. + * + * This function parses the specified ASCII encoded string and updates the + * internal list with any gamepad mappings it finds. This string may + * contain either a single gamepad mapping or many mappings separated by + * newlines. The parser supports the full format of the `gamecontrollerdb.txt` + * source file including empty lines and comments. + * + * See @ref gamepad_mapping for a description of the format. + * + * If there is already a gamepad mapping for a given GUID in the internal list, + * it will be replaced by the one passed to this function. If the library is + * terminated and re-initialized the internal list will revert to the built-in + * default. + * + * @param[in] string The string containing the gamepad mappings. + * @return `GLFW_TRUE` if successful, or `GLFW_FALSE` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_VALUE. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref gamepad + * @sa @ref glfwJoystickIsGamepad + * @sa @ref glfwGetGamepadName + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI int glfwUpdateGamepadMappings(const char* string); + +/*! @brief Returns the human-readable gamepad name for the specified joystick. + * + * This function returns the human-readable name of the gamepad from the + * gamepad mapping assigned to the specified joystick. + * + * If the specified joystick is not present or does not have a gamepad mapping + * this function will return `NULL` but will not generate an error. Call + * @ref glfwJoystickPresent to check whether it is present regardless of + * whether it has a mapping. + * + * @param[in] jid The [joystick](@ref joysticks) to query. + * @return The UTF-8 encoded name of the gamepad, or `NULL` if the + * joystick is not present, does not have a mapping or an + * [error](@ref error_handling) occurred. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified joystick is + * disconnected, the gamepad mappings are updated or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref gamepad + * @sa @ref glfwJoystickIsGamepad + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI const char* glfwGetGamepadName(int jid); + +/*! @brief Retrieves the state of the specified joystick remapped as a gamepad. + * + * This function retrives the state of the specified joystick remapped to + * an Xbox-like gamepad. + * + * If the specified joystick is not present or does not have a gamepad mapping + * this function will return `GLFW_FALSE` but will not generate an error. Call + * @ref glfwJoystickPresent to check whether it is present regardless of + * whether it has a mapping. + * + * The Guide button may not be available for input as it is often hooked by the + * system or the Steam client. + * + * Not all devices have all the buttons or axes provided by @ref + * GLFWgamepadstate. Unavailable buttons and axes will always report + * `GLFW_RELEASE` and 0.0 respectively. + * + * @param[in] jid The [joystick](@ref joysticks) to query. + * @param[out] state The gamepad input state of the joystick. + * @return `GLFW_TRUE` if successful, or `GLFW_FALSE` if no joystick is + * connected, it has no gamepad mapping or an [error](@ref error_handling) + * occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref gamepad + * @sa @ref glfwUpdateGamepadMappings + * @sa @ref glfwJoystickIsGamepad + * + * @since Added in version 3.3. * * @ingroup input */ -GLFWAPI const char* glfwGetJoystickName(int joy); +GLFWAPI int glfwGetGamepadState(int jid, GLFWgamepadstate* state); /*! @brief Sets the clipboard to the specified string. * * This function sets the system clipboard to the specified, UTF-8 encoded * string. * - * @param[in] window The window that will own the clipboard contents. + * @param[in] window Deprecated. Any valid window or `NULL`. * @param[in] string A UTF-8 encoded string. * - * @par Pointer Lifetime - * The specified string is copied before this function returns. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. * - * @par Thread Safety - * This function may only be called from the main thread. + * @pointer_lifetime The specified string is copied before this function + * returns. + * + * @thread_safety This function must only be called from the main thread. * * @sa @ref clipboard - * @sa glfwGetClipboardString + * @sa @ref glfwGetClipboardString * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup input */ @@ -3061,25 +5042,28 @@ GLFWAPI void glfwSetClipboardString(GLFWwindow* window, const char* string); /*! @brief Returns the contents of the clipboard as a string. * * This function returns the contents of the system clipboard, if it contains - * or is convertible to a UTF-8 encoded string. + * or is convertible to a UTF-8 encoded string. If the clipboard is empty or + * if its contents cannot be converted, `NULL` is returned and a @ref + * GLFW_FORMAT_UNAVAILABLE error is generated. * - * @param[in] window The window that will request the clipboard contents. + * @param[in] window Deprecated. Any valid window or `NULL`. * @return The contents of the clipboard as a UTF-8 encoded string, or `NULL` * if an [error](@ref error_handling) occurred. * - * @par Pointer Lifetime - * The returned string is allocated and freed by GLFW. You should not free it - * yourself. It is valid until the next call to @ref + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the next call to @ref * glfwGetClipboardString or @ref glfwSetClipboardString, or until the library * is terminated. * - * @par Thread Safety - * This function may only be called from the main thread. + * @thread_safety This function must only be called from the main thread. * * @sa @ref clipboard - * @sa glfwSetClipboardString + * @sa @ref glfwSetClipboardString * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup input */ @@ -3098,12 +5082,15 @@ GLFWAPI const char* glfwGetClipboardString(GLFWwindow* window); * @return The current value, in seconds, or zero if an * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Reading and + * writing of the internal timer offset is not atomic, so it needs to be + * externally synchronized with calls to @ref glfwSetTime. * * @sa @ref time * - * @since Added in GLFW 1.0. + * @since Added in version 1.0. * * @ingroup input */ @@ -3117,44 +5104,100 @@ GLFWAPI double glfwGetTime(void); * * @param[in] time The new value, in seconds. * - * @remarks The upper limit of the timer is calculated as + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_VALUE. + * + * @remark The upper limit of the timer is calculated as * floor((264 - 1) / 109) and is due to implementations * storing nanoseconds in 64 bits. The limit may be increased in the future. * - * @par Thread Safety - * This function may only be called from the main thread. + * @thread_safety This function may be called from any thread. Reading and + * writing of the internal timer offset is not atomic, so it needs to be + * externally synchronized with calls to @ref glfwGetTime. * * @sa @ref time * - * @since Added in GLFW 2.2. + * @since Added in version 2.2. * * @ingroup input */ GLFWAPI void glfwSetTime(double time); +/*! @brief Returns the current value of the raw timer. + * + * This function returns the current value of the raw timer, measured in + * 1 / frequency seconds. To get the frequency, call @ref + * glfwGetTimerFrequency. + * + * @return The value of the timer, or zero if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref time + * @sa @ref glfwGetTimerFrequency + * + * @since Added in version 3.2. + * + * @ingroup input + */ +GLFWAPI uint64_t glfwGetTimerValue(void); + +/*! @brief Returns the frequency, in Hz, of the raw timer. + * + * This function returns the frequency, in Hz, of the raw timer. + * + * @return The frequency of the timer, in Hz, or zero if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref time + * @sa @ref glfwGetTimerValue + * + * @since Added in version 3.2. + * + * @ingroup input + */ +GLFWAPI uint64_t glfwGetTimerFrequency(void); + /*! @brief Makes the context of the specified window current for the calling * thread. * * This function makes the OpenGL or OpenGL ES context of the specified window - * current on the calling thread. A context can only be made current on + * current on the calling thread. A context must only be made current on * a single thread at a time and each thread can have only a single current * context at a time. * + * When moving a context between threads, you must make it non-current on the + * old thread before making it current on the new one. + * * By default, making a context non-current implicitly forces a pipeline flush. * On machines that support `GL_KHR_context_flush_control`, you can control * whether a context performs this flush by setting the - * [GLFW_CONTEXT_RELEASE_BEHAVIOR](@ref window_hints_ctx) window hint. + * [GLFW_CONTEXT_RELEASE_BEHAVIOR](@ref GLFW_CONTEXT_RELEASE_BEHAVIOR_hint) + * hint. + * + * The specified window must have an OpenGL or OpenGL ES context. Specifying + * a window without a context will generate a @ref GLFW_NO_WINDOW_CONTEXT + * error. * * @param[in] window The window whose context to make current, or `NULL` to * detach the current context. * - * @par Thread Safety - * This function may be called from any thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_WINDOW_CONTEXT and @ref GLFW_PLATFORM_ERROR. + * + * @thread_safety This function may be called from any thread. * * @sa @ref context_current - * @sa glfwGetCurrentContext + * @sa @ref glfwGetCurrentContext * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup context */ @@ -3168,13 +5211,14 @@ GLFWAPI void glfwMakeContextCurrent(GLFWwindow* window); * @return The window whose context is current, or `NULL` if no window's * context is current. * - * @par Thread Safety - * This function may be called from any thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. * * @sa @ref context_current - * @sa glfwMakeContextCurrent + * @sa @ref glfwMakeContextCurrent * - * @since Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup context */ @@ -3182,22 +5226,33 @@ GLFWAPI GLFWwindow* glfwGetCurrentContext(void); /*! @brief Swaps the front and back buffers of the specified window. * - * This function swaps the front and back buffers of the specified window. If - * the swap interval is greater than zero, the GPU driver waits the specified - * number of screen updates before swapping the buffers. + * This function swaps the front and back buffers of the specified window when + * rendering with OpenGL or OpenGL ES. If the swap interval is greater than + * zero, the GPU driver waits the specified number of screen updates before + * swapping the buffers. + * + * The specified window must have an OpenGL or OpenGL ES context. Specifying + * a window without a context will generate a @ref GLFW_NO_WINDOW_CONTEXT + * error. + * + * This function does not apply to Vulkan. If you are rendering with Vulkan, + * see `vkQueuePresentKHR` instead. * * @param[in] window The window whose buffers to swap. * - * @par Thread Safety - * This function may be called from any thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_WINDOW_CONTEXT and @ref GLFW_PLATFORM_ERROR. * - * @sa @ref buffer_swap - * @sa glfwSwapInterval + * @remark __EGL:__ The context of the specified window must be current on the + * calling thread. * - * @since Added in GLFW 1.0. + * @thread_safety This function may be called from any thread. * - * @par - * __GLFW 3:__ Added window handle parameter. + * @sa @ref buffer_swap + * @sa @ref glfwSwapInterval + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. * * @ingroup window */ @@ -3205,41 +5260,45 @@ GLFWAPI void glfwSwapBuffers(GLFWwindow* window); /*! @brief Sets the swap interval for the current context. * - * This function sets the swap interval for the current context, i.e. the - * number of screen updates to wait from the time @ref glfwSwapBuffers was - * called before swapping the buffers and returning. This is sometimes called - * _vertical synchronization_, _vertical retrace synchronization_ or just - * _vsync_. + * This function sets the swap interval for the current OpenGL or OpenGL ES + * context, i.e. the number of screen updates to wait from the time @ref + * glfwSwapBuffers was called before swapping the buffers and returning. This + * is sometimes called _vertical synchronization_, _vertical retrace + * synchronization_ or just _vsync_. * - * Contexts that support either of the `WGL_EXT_swap_control_tear` and - * `GLX_EXT_swap_control_tear` extensions also accept negative swap intervals, - * which allow the driver to swap even if a frame arrives a little bit late. - * You can check for the presence of these extensions using @ref - * glfwExtensionSupported. For more information about swap tearing, see the - * extension specifications. + * A context that supports either of the `WGL_EXT_swap_control_tear` and + * `GLX_EXT_swap_control_tear` extensions also accepts _negative_ swap + * intervals, which allows the driver to swap immediately even if a frame + * arrives a little bit late. You can check for these extensions with @ref + * glfwExtensionSupported. * * A context must be current on the calling thread. Calling this function * without a current context will cause a @ref GLFW_NO_CURRENT_CONTEXT error. * + * This function does not apply to Vulkan. If you are rendering with Vulkan, + * see the present mode of your swapchain instead. + * * @param[in] interval The minimum number of screen updates to wait for * until the buffers are swapped by @ref glfwSwapBuffers. * - * @remarks This function is not called during context creation, leaving the + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_CURRENT_CONTEXT and @ref GLFW_PLATFORM_ERROR. + * + * @remark This function is not called during context creation, leaving the * swap interval set to whatever is the default on that platform. This is done * because some swap interval extensions used by GLFW do not allow the swap * interval to be reset to zero once it has been set to a non-zero value. * - * @remarks Some GPU drivers do not honor the requested swap interval, either + * @remark Some GPU drivers do not honor the requested swap interval, either * because of a user setting that overrides the application's request or due to * bugs in the driver. * - * @par Thread Safety - * This function may be called from any thread. + * @thread_safety This function may be called from any thread. * * @sa @ref buffer_swap - * @sa glfwSwapBuffers + * @sa @ref glfwSwapBuffers * - * @since Added in GLFW 1.0. + * @since Added in version 1.0. * * @ingroup context */ @@ -3248,9 +5307,9 @@ GLFWAPI void glfwSwapInterval(int interval); /*! @brief Returns whether the specified extension is available. * * This function returns whether the specified - * [client API extension](@ref context_glext) is supported by the current - * OpenGL or OpenGL ES context. It searches both for OpenGL and OpenGL ES - * extension and platform-specific context creation API extensions. + * [API extension](@ref context_glext) is supported by the current OpenGL or + * OpenGL ES context. It searches both for client API extension and context + * creation API extensions. * * A context must be current on the calling thread. Calling this function * without a current context will cause a @ref GLFW_NO_CURRENT_CONTEXT error. @@ -3260,16 +5319,24 @@ GLFWAPI void glfwSwapInterval(int interval); * frequently. The extension strings will not change during the lifetime of * a context, so there is no danger in doing this. * + * This function does not apply to Vulkan. If you are using Vulkan, see @ref + * glfwGetRequiredInstanceExtensions, `vkEnumerateInstanceExtensionProperties` + * and `vkEnumerateDeviceExtensionProperties` instead. + * * @param[in] extension The ASCII encoded name of the extension. - * @return `GL_TRUE` if the extension is available, or `GL_FALSE` otherwise. + * @return `GLFW_TRUE` if the extension is available, or `GLFW_FALSE` + * otherwise. * - * @par Thread Safety - * This function may be called from any thread. + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_CURRENT_CONTEXT, @ref GLFW_INVALID_VALUE and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function may be called from any thread. * * @sa @ref context_glext - * @sa glfwGetProcAddress + * @sa @ref glfwGetProcAddress * - * @since Added in GLFW 1.0. + * @since Added in version 1.0. * * @ingroup context */ @@ -3278,40 +5345,263 @@ GLFWAPI int glfwExtensionSupported(const char* extension); /*! @brief Returns the address of the specified function for the current * context. * - * This function returns the address of the specified + * This function returns the address of the specified OpenGL or OpenGL ES * [core or extension function](@ref context_glext), if it is supported * by the current context. * * A context must be current on the calling thread. Calling this function * without a current context will cause a @ref GLFW_NO_CURRENT_CONTEXT error. * + * This function does not apply to Vulkan. If you are rendering with Vulkan, + * see @ref glfwGetInstanceProcAddress, `vkGetInstanceProcAddr` and + * `vkGetDeviceProcAddr` instead. + * * @param[in] procname The ASCII encoded name of the function. - * @return The address of the function, or `NULL` if the function is - * unavailable or an [error](@ref error_handling) occurred. + * @return The address of the function, or `NULL` if an + * [error](@ref error_handling) occurred. * - * @remarks The addresses of a given function is not guaranteed to be the same + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_CURRENT_CONTEXT and @ref GLFW_PLATFORM_ERROR. + * + * @remark The address of a given function is not guaranteed to be the same * between contexts. * - * @remarks This function may return a non-`NULL` address despite the + * @remark This function may return a non-`NULL` address despite the * associated version or extension not being available. Always check the - * context version or extension string presence first. + * context version or extension string first. * - * @par Pointer Lifetime - * The returned function pointer is valid until the context is destroyed or the - * library is terminated. + * @pointer_lifetime The returned function pointer is valid until the context + * is destroyed or the library is terminated. * - * @par Thread Safety - * This function may be called from any thread. + * @thread_safety This function may be called from any thread. * * @sa @ref context_glext - * @sa glfwExtensionSupported + * @sa @ref glfwExtensionSupported * - * @since Added in GLFW 1.0. + * @since Added in version 1.0. * * @ingroup context */ GLFWAPI GLFWglproc glfwGetProcAddress(const char* procname); +/*! @brief Returns whether the Vulkan loader and an ICD have been found. + * + * This function returns whether the Vulkan loader and any minimally functional + * ICD have been found. + * + * The availability of a Vulkan loader and even an ICD does not by itself + * guarantee that surface creation or even instance creation is possible. + * For example, on Fermi systems Nvidia will install an ICD that provides no + * actual Vulkan support. Call @ref glfwGetRequiredInstanceExtensions to check + * whether the extensions necessary for Vulkan surface creation are available + * and @ref glfwGetPhysicalDevicePresentationSupport to check whether a queue + * family of a physical device supports image presentation. + * + * @return `GLFW_TRUE` if Vulkan is minimally available, or `GLFW_FALSE` + * otherwise. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref vulkan_support + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +GLFWAPI int glfwVulkanSupported(void); + +/*! @brief Returns the Vulkan instance extensions required by GLFW. + * + * This function returns an array of names of Vulkan instance extensions required + * by GLFW for creating Vulkan surfaces for GLFW windows. If successful, the + * list will always contains `VK_KHR_surface`, so if you don't require any + * additional extensions you can pass this list directly to the + * `VkInstanceCreateInfo` struct. + * + * If Vulkan is not available on the machine, this function returns `NULL` and + * generates a @ref GLFW_API_UNAVAILABLE error. Call @ref glfwVulkanSupported + * to check whether Vulkan is at least minimally available. + * + * If Vulkan is available but no set of extensions allowing window surface + * creation was found, this function returns `NULL`. You may still use Vulkan + * for off-screen rendering and compute work. + * + * @param[out] count Where to store the number of extensions in the returned + * array. This is set to zero if an error occurred. + * @return An array of ASCII encoded extension names, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_API_UNAVAILABLE. + * + * @remark Additional extensions may be required by future versions of GLFW. + * You should check if any extensions you wish to enable are already in the + * returned array, as it is an error to specify an extension more than once in + * the `VkInstanceCreateInfo` struct. + * + * @remark @macos This function currently only supports the + * `VK_MVK_macos_surface` extension from MoltenVK. + * + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is guaranteed to be valid only until the + * library is terminated. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref vulkan_ext + * @sa @ref glfwCreateWindowSurface + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +GLFWAPI const char** glfwGetRequiredInstanceExtensions(uint32_t* count); + +#if defined(VK_VERSION_1_0) + +/*! @brief Returns the address of the specified Vulkan instance function. + * + * This function returns the address of the specified Vulkan core or extension + * function for the specified instance. If instance is set to `NULL` it can + * return any function exported from the Vulkan loader, including at least the + * following functions: + * + * - `vkEnumerateInstanceExtensionProperties` + * - `vkEnumerateInstanceLayerProperties` + * - `vkCreateInstance` + * - `vkGetInstanceProcAddr` + * + * If Vulkan is not available on the machine, this function returns `NULL` and + * generates a @ref GLFW_API_UNAVAILABLE error. Call @ref glfwVulkanSupported + * to check whether Vulkan is at least minimally available. + * + * This function is equivalent to calling `vkGetInstanceProcAddr` with + * a platform-specific query of the Vulkan loader as a fallback. + * + * @param[in] instance The Vulkan instance to query, or `NULL` to retrieve + * functions related to instance creation. + * @param[in] procname The ASCII encoded name of the function. + * @return The address of the function, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_API_UNAVAILABLE. + * + * @pointer_lifetime The returned function pointer is valid until the library + * is terminated. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref vulkan_proc + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +GLFWAPI GLFWvkproc glfwGetInstanceProcAddress(VkInstance instance, const char* procname); + +/*! @brief Returns whether the specified queue family can present images. + * + * This function returns whether the specified queue family of the specified + * physical device supports presentation to the platform GLFW was built for. + * + * If Vulkan or the required window surface creation instance extensions are + * not available on the machine, or if the specified instance was not created + * with the required extensions, this function returns `GLFW_FALSE` and + * generates a @ref GLFW_API_UNAVAILABLE error. Call @ref glfwVulkanSupported + * to check whether Vulkan is at least minimally available and @ref + * glfwGetRequiredInstanceExtensions to check what instance extensions are + * required. + * + * @param[in] instance The instance that the physical device belongs to. + * @param[in] device The physical device that the queue family belongs to. + * @param[in] queuefamily The index of the queue family to query. + * @return `GLFW_TRUE` if the queue family supports presentation, or + * `GLFW_FALSE` otherwise. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_API_UNAVAILABLE and @ref GLFW_PLATFORM_ERROR. + * + * @remark @macos This function currently always returns `GLFW_TRUE`, as the + * `VK_MVK_macos_surface` extension does not provide + * a `vkGetPhysicalDevice*PresentationSupport` type function. + * + * @thread_safety This function may be called from any thread. For + * synchronization details of Vulkan objects, see the Vulkan specification. + * + * @sa @ref vulkan_present + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +GLFWAPI int glfwGetPhysicalDevicePresentationSupport(VkInstance instance, VkPhysicalDevice device, uint32_t queuefamily); + +/*! @brief Creates a Vulkan surface for the specified window. + * + * This function creates a Vulkan surface for the specified window. + * + * If the Vulkan loader or at least one minimally functional ICD were not found, + * this function returns `VK_ERROR_INITIALIZATION_FAILED` and generates a @ref + * GLFW_API_UNAVAILABLE error. Call @ref glfwVulkanSupported to check whether + * Vulkan is at least minimally available. + * + * If the required window surface creation instance extensions are not + * available or if the specified instance was not created with these extensions + * enabled, this function returns `VK_ERROR_EXTENSION_NOT_PRESENT` and + * generates a @ref GLFW_API_UNAVAILABLE error. Call @ref + * glfwGetRequiredInstanceExtensions to check what instance extensions are + * required. + * + * The window surface cannot be shared with another API so the window must + * have been created with the [client api hint](@ref GLFW_CLIENT_API_attrib) + * set to `GLFW_NO_API` otherwise it generates a @ref GLFW_INVALID_VALUE error + * and returns `VK_ERROR_NATIVE_WINDOW_IN_USE_KHR`. + * + * The window surface must be destroyed before the specified Vulkan instance. + * It is the responsibility of the caller to destroy the window surface. GLFW + * does not destroy it for you. Call `vkDestroySurfaceKHR` to destroy the + * surface. + * + * @param[in] instance The Vulkan instance to create the surface in. + * @param[in] window The window to create the surface for. + * @param[in] allocator The allocator to use, or `NULL` to use the default + * allocator. + * @param[out] surface Where to store the handle of the surface. This is set + * to `VK_NULL_HANDLE` if an error occurred. + * @return `VK_SUCCESS` if successful, or a Vulkan error code if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_API_UNAVAILABLE, @ref GLFW_PLATFORM_ERROR and @ref GLFW_INVALID_VALUE + * + * @remark If an error occurs before the creation call is made, GLFW returns + * the Vulkan error code most appropriate for the error. Appropriate use of + * @ref glfwVulkanSupported and @ref glfwGetRequiredInstanceExtensions should + * eliminate almost all occurrences of these errors. + * + * @remark @macos This function currently only supports the + * `VK_MVK_macos_surface` extension from MoltenVK. + * + * @remark @macos This function creates and sets a `CAMetalLayer` instance for + * the window content view, which is required for MoltenVK to function. + * + * @thread_safety This function may be called from any thread. For + * synchronization details of Vulkan objects, see the Vulkan specification. + * + * @sa @ref vulkan_surface + * @sa @ref glfwGetRequiredInstanceExtensions + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +GLFWAPI VkResult glfwCreateWindowSurface(VkInstance instance, GLFWwindow* window, const VkAllocationCallbacks* allocator, VkSurfaceKHR* surface); + +#endif /*VK_VERSION_1_0*/ + /************************************************************************* * Global definition cleanup @@ -3329,6 +5619,13 @@ GLFWAPI GLFWglproc glfwGetProcAddress(const char* procname); #undef GLFW_CALLBACK_DEFINED #endif +/* Some OpenGL related headers need GLAPIENTRY, but it is unconditionally + * defined by some gl.h variants (OpenBSD) so define it after if needed. + */ +#ifndef GLAPIENTRY + #define GLAPIENTRY APIENTRY +#endif + /* -------------------- END SYSTEM/COMPILER SPECIFIC --------------------- */ diff --git a/external/include/GLFW/glfw3native.h b/external/include/GLFW/glfw3native.h index b3ce7482d..267e75ca9 100644 --- a/external/include/GLFW/glfw3native.h +++ b/external/include/GLFW/glfw3native.h @@ -1,9 +1,9 @@ /************************************************************************* - * GLFW 3.1 - www.glfw.org + * GLFW 3.3 - www.glfw.org * A library for OpenGL, window and input *------------------------------------------------------------------------ * Copyright (c) 2002-2006 Marcus Geelnard - * Copyright (c) 2006-2010 Camilla Berglund + * Copyright (c) 2006-2018 Camilla Löwy * * This software is provided 'as-is', without any express or implied * warranty. In no event will the authors be held liable for any damages @@ -38,26 +38,37 @@ extern "C" { * Doxygen documentation *************************************************************************/ +/*! @file glfw3native.h + * @brief The header of the native access functions. + * + * This is the header file of the native access functions. See @ref native for + * more information. + */ /*! @defgroup native Native access + * @brief Functions related to accessing native handles. * * **By using the native access functions you assert that you know what you're * doing and how to fix problems caused by using them. If you don't, you * shouldn't be using them.** * - * Before the inclusion of @ref glfw3native.h, you must define exactly one - * window system API macro and exactly one context creation API macro. Failure - * to do this will cause a compile-time error. + * Before the inclusion of @ref glfw3native.h, you may define zero or more + * window system API macro and zero or more context creation API macros. + * + * The chosen backends must match those the library was compiled for. Failure + * to do this will cause a link-time error. * * The available window API macros are: * * `GLFW_EXPOSE_NATIVE_WIN32` * * `GLFW_EXPOSE_NATIVE_COCOA` * * `GLFW_EXPOSE_NATIVE_X11` + * * `GLFW_EXPOSE_NATIVE_WAYLAND` * * The available context API macros are: * * `GLFW_EXPOSE_NATIVE_WGL` * * `GLFW_EXPOSE_NATIVE_NSGL` * * `GLFW_EXPOSE_NATIVE_GLX` * * `GLFW_EXPOSE_NATIVE_EGL` + * * `GLFW_EXPOSE_NATIVE_OSMESA` * * These macros select which of the native access functions that are declared * and which platform-specific headers to include. It is then up your (by @@ -70,36 +81,43 @@ extern "C" { * System headers and types *************************************************************************/ -#if defined(GLFW_EXPOSE_NATIVE_WIN32) +#if defined(GLFW_EXPOSE_NATIVE_WIN32) || defined(GLFW_EXPOSE_NATIVE_WGL) // This is a workaround for the fact that glfw3.h needs to export APIENTRY (for // example to allow applications to correctly declare a GL_ARB_debug_output // callback) but windows.h assumes no one will define APIENTRY before it does - #undef APIENTRY + #if defined(GLFW_APIENTRY_DEFINED) + #undef APIENTRY + #undef GLFW_APIENTRY_DEFINED + #endif #include -#elif defined(GLFW_EXPOSE_NATIVE_COCOA) - #include +#elif defined(GLFW_EXPOSE_NATIVE_COCOA) || defined(GLFW_EXPOSE_NATIVE_NSGL) #if defined(__OBJC__) #import #else + #include typedef void* id; #endif -#elif defined(GLFW_EXPOSE_NATIVE_X11) +#elif defined(GLFW_EXPOSE_NATIVE_X11) || defined(GLFW_EXPOSE_NATIVE_GLX) #include #include -#else - #error "No window API selected" +#elif defined(GLFW_EXPOSE_NATIVE_WAYLAND) + #include #endif #if defined(GLFW_EXPOSE_NATIVE_WGL) /* WGL is declared by windows.h */ -#elif defined(GLFW_EXPOSE_NATIVE_NSGL) +#endif +#if defined(GLFW_EXPOSE_NATIVE_NSGL) /* NSGL is declared by Cocoa.h */ -#elif defined(GLFW_EXPOSE_NATIVE_GLX) +#endif +#if defined(GLFW_EXPOSE_NATIVE_GLX) #include -#elif defined(GLFW_EXPOSE_NATIVE_EGL) +#endif +#if defined(GLFW_EXPOSE_NATIVE_EGL) #include -#else - #error "No context API selected" +#endif +#if defined(GLFW_EXPOSE_NATIVE_OSMESA) + #include #endif @@ -114,11 +132,10 @@ extern "C" { * of the specified monitor, or `NULL` if an [error](@ref error_handling) * occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * - * @par History - * Added in GLFW 3.1. + * @since Added in version 3.1. * * @ingroup native */ @@ -130,11 +147,10 @@ GLFWAPI const char* glfwGetWin32Adapter(GLFWmonitor* monitor); * `\\.\DISPLAY1\Monitor0`) of the specified monitor, or `NULL` if an * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * - * @par History - * Added in GLFW 3.1. + * @since Added in version 3.1. * * @ingroup native */ @@ -145,11 +161,10 @@ GLFWAPI const char* glfwGetWin32Monitor(GLFWmonitor* monitor); * @return The `HWND` of the specified window, or `NULL` if an * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * - * @par History - * Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup native */ @@ -162,11 +177,10 @@ GLFWAPI HWND glfwGetWin32Window(GLFWwindow* window); * @return The `HGLRC` of the specified window, or `NULL` if an * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * - * @par History - * Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup native */ @@ -179,11 +193,10 @@ GLFWAPI HGLRC glfwGetWGLContext(GLFWwindow* window); * @return The `CGDirectDisplayID` of the specified monitor, or * `kCGNullDirectDisplay` if an [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * - * @par History - * Added in GLFW 3.1. + * @since Added in version 3.1. * * @ingroup native */ @@ -194,11 +207,10 @@ GLFWAPI CGDirectDisplayID glfwGetCocoaMonitor(GLFWmonitor* monitor); * @return The `NSWindow` of the specified window, or `nil` if an * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * - * @par History - * Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup native */ @@ -211,11 +223,10 @@ GLFWAPI id glfwGetCocoaWindow(GLFWwindow* window); * @return The `NSOpenGLContext` of the specified window, or `nil` if an * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * - * @par History - * Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup native */ @@ -228,11 +239,10 @@ GLFWAPI id glfwGetNSGLContext(GLFWwindow* window); * @return The `Display` used by GLFW, or `NULL` if an * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * - * @par History - * Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup native */ @@ -243,11 +253,10 @@ GLFWAPI Display* glfwGetX11Display(void); * @return The `RRCrtc` of the specified monitor, or `None` if an * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * - * @par History - * Added in GLFW 3.1. + * @since Added in version 3.1. * * @ingroup native */ @@ -258,11 +267,10 @@ GLFWAPI RRCrtc glfwGetX11Adapter(GLFWmonitor* monitor); * @return The `RROutput` of the specified monitor, or `None` if an * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * - * @par History - * Added in GLFW 3.1. + * @since Added in version 3.1. * * @ingroup native */ @@ -273,15 +281,64 @@ GLFWAPI RROutput glfwGetX11Monitor(GLFWmonitor* monitor); * @return The `Window` of the specified window, or `None` if an * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * - * @par History - * Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup native */ GLFWAPI Window glfwGetX11Window(GLFWwindow* window); + +/*! @brief Sets the current primary selection to the specified string. + * + * @param[in] string A UTF-8 encoded string. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The specified string is copied before this function + * returns. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref clipboard + * @sa glfwGetX11SelectionString + * @sa glfwSetClipboardString + * + * @since Added in version 3.3. + * + * @ingroup native + */ +GLFWAPI void glfwSetX11SelectionString(const char* string); + +/*! @brief Returns the contents of the current primary selection as a string. + * + * If the selection is empty or if its contents cannot be converted, `NULL` + * is returned and a @ref GLFW_FORMAT_UNAVAILABLE error is generated. + * + * @return The contents of the selection as a UTF-8 encoded string, or `NULL` + * if an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the next call to @ref + * glfwGetX11SelectionString or @ref glfwSetX11SelectionString, or until the + * library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref clipboard + * @sa glfwSetX11SelectionString + * @sa glfwGetClipboardString + * + * @since Added in version 3.3. + * + * @ingroup native + */ +GLFWAPI const char* glfwGetX11SelectionString(void); #endif #if defined(GLFW_EXPOSE_NATIVE_GLX) @@ -290,15 +347,72 @@ GLFWAPI Window glfwGetX11Window(GLFWwindow* window); * @return The `GLXContext` of the specified window, or `NULL` if an * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * - * @par History - * Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup native */ GLFWAPI GLXContext glfwGetGLXContext(GLFWwindow* window); + +/*! @brief Returns the `GLXWindow` of the specified window. + * + * @return The `GLXWindow` of the specified window, or `None` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.2. + * + * @ingroup native + */ +GLFWAPI GLXWindow glfwGetGLXWindow(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_WAYLAND) +/*! @brief Returns the `struct wl_display*` used by GLFW. + * + * @return The `struct wl_display*` used by GLFW, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.2. + * + * @ingroup native + */ +GLFWAPI struct wl_display* glfwGetWaylandDisplay(void); + +/*! @brief Returns the `struct wl_output*` of the specified monitor. + * + * @return The `struct wl_output*` of the specified monitor, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.2. + * + * @ingroup native + */ +GLFWAPI struct wl_output* glfwGetWaylandMonitor(GLFWmonitor* monitor); + +/*! @brief Returns the main `struct wl_surface*` of the specified window. + * + * @return The main `struct wl_surface*` of the specified window, or `NULL` if + * an [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.2. + * + * @ingroup native + */ +GLFWAPI struct wl_surface* glfwGetWaylandWindow(GLFWwindow* window); #endif #if defined(GLFW_EXPOSE_NATIVE_EGL) @@ -307,11 +421,10 @@ GLFWAPI GLXContext glfwGetGLXContext(GLFWwindow* window); * @return The `EGLDisplay` used by GLFW, or `EGL_NO_DISPLAY` if an * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * - * @par History - * Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup native */ @@ -322,11 +435,10 @@ GLFWAPI EGLDisplay glfwGetEGLDisplay(void); * @return The `EGLContext` of the specified window, or `EGL_NO_CONTEXT` if an * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * - * @par History - * Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup native */ @@ -337,17 +449,74 @@ GLFWAPI EGLContext glfwGetEGLContext(GLFWwindow* window); * @return The `EGLSurface` of the specified window, or `EGL_NO_SURFACE` if an * [error](@ref error_handling) occurred. * - * @par Thread Safety - * This function may be called from any thread. Access is not synchronized. + * @thread_safety This function may be called from any thread. Access is not + * synchronized. * - * @par History - * Added in GLFW 3.0. + * @since Added in version 3.0. * * @ingroup native */ GLFWAPI EGLSurface glfwGetEGLSurface(GLFWwindow* window); #endif +#if defined(GLFW_EXPOSE_NATIVE_OSMESA) +/*! @brief Retrieves the color buffer associated with the specified window. + * + * @param[in] window The window whose color buffer to retrieve. + * @param[out] width Where to store the width of the color buffer, or `NULL`. + * @param[out] height Where to store the height of the color buffer, or `NULL`. + * @param[out] format Where to store the OSMesa pixel format of the color + * buffer, or `NULL`. + * @param[out] buffer Where to store the address of the color buffer, or + * `NULL`. + * @return `GLFW_TRUE` if successful, or `GLFW_FALSE` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.3. + * + * @ingroup native + */ +GLFWAPI int glfwGetOSMesaColorBuffer(GLFWwindow* window, int* width, int* height, int* format, void** buffer); + +/*! @brief Retrieves the depth buffer associated with the specified window. + * + * @param[in] window The window whose depth buffer to retrieve. + * @param[out] width Where to store the width of the depth buffer, or `NULL`. + * @param[out] height Where to store the height of the depth buffer, or `NULL`. + * @param[out] bytesPerValue Where to store the number of bytes per depth + * buffer element, or `NULL`. + * @param[out] buffer Where to store the address of the depth buffer, or + * `NULL`. + * @return `GLFW_TRUE` if successful, or `GLFW_FALSE` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.3. + * + * @ingroup native + */ +GLFWAPI int glfwGetOSMesaDepthBuffer(GLFWwindow* window, int* width, int* height, int* bytesPerValue, void** buffer); + +/*! @brief Returns the `OSMesaContext` of the specified window. + * + * @return The `OSMesaContext` of the specified window, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.3. + * + * @ingroup native + */ +GLFWAPI OSMesaContext glfwGetOSMesaContext(GLFWwindow* window); +#endif + #ifdef __cplusplus } #endif diff --git a/external/include/json.hpp b/external/include/json.hpp new file mode 100644 index 000000000..8b72ea653 --- /dev/null +++ b/external/include/json.hpp @@ -0,0 +1,24765 @@ +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + +/****************************************************************************\ + * Note on documentation: The source files contain links to the online * + * documentation of the public API at https://json.nlohmann.me. This URL * + * contains the most recent documentation and should also be applicable to * + * previous versions; documentation for deprecated functions is not * + * removed, but marked deprecated. See "Generate documentation" section in * + * file docs/README.md. * +\****************************************************************************/ + +#ifndef INCLUDE_NLOHMANN_JSON_HPP_ +#define INCLUDE_NLOHMANN_JSON_HPP_ + +#include // all_of, find, for_each +#include // nullptr_t, ptrdiff_t, size_t +#include // hash, less +#include // initializer_list +#ifndef JSON_NO_IO + #include // istream, ostream +#endif // JSON_NO_IO +#include // random_access_iterator_tag +#include // unique_ptr +#include // string, stoi, to_string +#include // declval, forward, move, pair, swap +#include // vector + +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + + + +#include + +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + + + +// This file contains all macro definitions affecting or depending on the ABI + +#ifndef JSON_SKIP_LIBRARY_VERSION_CHECK + #if defined(NLOHMANN_JSON_VERSION_MAJOR) && defined(NLOHMANN_JSON_VERSION_MINOR) && defined(NLOHMANN_JSON_VERSION_PATCH) + #if NLOHMANN_JSON_VERSION_MAJOR != 3 || NLOHMANN_JSON_VERSION_MINOR != 11 || NLOHMANN_JSON_VERSION_PATCH != 3 + #warning "Already included a different version of the library!" + #endif + #endif +#endif + +#define NLOHMANN_JSON_VERSION_MAJOR 3 // NOLINT(modernize-macro-to-enum) +#define NLOHMANN_JSON_VERSION_MINOR 11 // NOLINT(modernize-macro-to-enum) +#define NLOHMANN_JSON_VERSION_PATCH 3 // NOLINT(modernize-macro-to-enum) + +#ifndef JSON_DIAGNOSTICS + #define JSON_DIAGNOSTICS 0 +#endif + +#ifndef JSON_USE_LEGACY_DISCARDED_VALUE_COMPARISON + #define JSON_USE_LEGACY_DISCARDED_VALUE_COMPARISON 0 +#endif + +#if JSON_DIAGNOSTICS + #define NLOHMANN_JSON_ABI_TAG_DIAGNOSTICS _diag +#else + #define NLOHMANN_JSON_ABI_TAG_DIAGNOSTICS +#endif + +#if JSON_USE_LEGACY_DISCARDED_VALUE_COMPARISON + #define NLOHMANN_JSON_ABI_TAG_LEGACY_DISCARDED_VALUE_COMPARISON _ldvcmp +#else + #define NLOHMANN_JSON_ABI_TAG_LEGACY_DISCARDED_VALUE_COMPARISON +#endif + +#ifndef NLOHMANN_JSON_NAMESPACE_NO_VERSION + #define NLOHMANN_JSON_NAMESPACE_NO_VERSION 0 +#endif + +// Construct the namespace ABI tags component +#define NLOHMANN_JSON_ABI_TAGS_CONCAT_EX(a, b) json_abi ## a ## b +#define NLOHMANN_JSON_ABI_TAGS_CONCAT(a, b) \ + NLOHMANN_JSON_ABI_TAGS_CONCAT_EX(a, b) + +#define NLOHMANN_JSON_ABI_TAGS \ + NLOHMANN_JSON_ABI_TAGS_CONCAT( \ + NLOHMANN_JSON_ABI_TAG_DIAGNOSTICS, \ + NLOHMANN_JSON_ABI_TAG_LEGACY_DISCARDED_VALUE_COMPARISON) + +// Construct the namespace version component +#define NLOHMANN_JSON_NAMESPACE_VERSION_CONCAT_EX(major, minor, patch) \ + _v ## major ## _ ## minor ## _ ## patch +#define NLOHMANN_JSON_NAMESPACE_VERSION_CONCAT(major, minor, patch) \ + NLOHMANN_JSON_NAMESPACE_VERSION_CONCAT_EX(major, minor, patch) + +#if NLOHMANN_JSON_NAMESPACE_NO_VERSION +#define NLOHMANN_JSON_NAMESPACE_VERSION +#else +#define NLOHMANN_JSON_NAMESPACE_VERSION \ + NLOHMANN_JSON_NAMESPACE_VERSION_CONCAT(NLOHMANN_JSON_VERSION_MAJOR, \ + NLOHMANN_JSON_VERSION_MINOR, \ + NLOHMANN_JSON_VERSION_PATCH) +#endif + +// Combine namespace components +#define NLOHMANN_JSON_NAMESPACE_CONCAT_EX(a, b) a ## b +#define NLOHMANN_JSON_NAMESPACE_CONCAT(a, b) \ + NLOHMANN_JSON_NAMESPACE_CONCAT_EX(a, b) + +#ifndef NLOHMANN_JSON_NAMESPACE +#define NLOHMANN_JSON_NAMESPACE \ + nlohmann::NLOHMANN_JSON_NAMESPACE_CONCAT( \ + NLOHMANN_JSON_ABI_TAGS, \ + NLOHMANN_JSON_NAMESPACE_VERSION) +#endif + +#ifndef NLOHMANN_JSON_NAMESPACE_BEGIN +#define NLOHMANN_JSON_NAMESPACE_BEGIN \ + namespace nlohmann \ + { \ + inline namespace NLOHMANN_JSON_NAMESPACE_CONCAT( \ + NLOHMANN_JSON_ABI_TAGS, \ + NLOHMANN_JSON_NAMESPACE_VERSION) \ + { +#endif + +#ifndef NLOHMANN_JSON_NAMESPACE_END +#define NLOHMANN_JSON_NAMESPACE_END \ + } /* namespace (inline namespace) NOLINT(readability/namespace) */ \ + } // namespace nlohmann +#endif + +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + + + +#include // transform +#include // array +#include // forward_list +#include // inserter, front_inserter, end +#include // map +#include // string +#include // tuple, make_tuple +#include // is_arithmetic, is_same, is_enum, underlying_type, is_convertible +#include // unordered_map +#include // pair, declval +#include // valarray + +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + + + +#include // nullptr_t +#include // exception +#if JSON_DIAGNOSTICS + #include // accumulate +#endif +#include // runtime_error +#include // to_string +#include // vector + +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + + + +#include // array +#include // size_t +#include // uint8_t +#include // string + +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + + + +#include // declval, pair +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + + + +#include + +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + + + +// #include + + +NLOHMANN_JSON_NAMESPACE_BEGIN +namespace detail +{ + +template struct make_void +{ + using type = void; +}; +template using void_t = typename make_void::type; + +} // namespace detail +NLOHMANN_JSON_NAMESPACE_END + + +NLOHMANN_JSON_NAMESPACE_BEGIN +namespace detail +{ + +// https://en.cppreference.com/w/cpp/experimental/is_detected +struct nonesuch +{ + nonesuch() = delete; + ~nonesuch() = delete; + nonesuch(nonesuch const&) = delete; + nonesuch(nonesuch const&&) = delete; + void operator=(nonesuch const&) = delete; + void operator=(nonesuch&&) = delete; +}; + +template class Op, + class... Args> +struct detector +{ + using value_t = std::false_type; + using type = Default; +}; + +template class Op, class... Args> +struct detector>, Op, Args...> +{ + using value_t = std::true_type; + using type = Op; +}; + +template class Op, class... Args> +using is_detected = typename detector::value_t; + +template class Op, class... Args> +struct is_detected_lazy : is_detected { }; + +template class Op, class... Args> +using detected_t = typename detector::type; + +template class Op, class... Args> +using detected_or = detector; + +template class Op, class... Args> +using detected_or_t = typename detected_or::type; + +template class Op, class... Args> +using is_detected_exact = std::is_same>; + +template class Op, class... Args> +using is_detected_convertible = + std::is_convertible, To>; + +} // namespace detail +NLOHMANN_JSON_NAMESPACE_END + +// #include + + +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-FileCopyrightText: 2016-2021 Evan Nemerson +// SPDX-License-Identifier: MIT + +/* Hedley - https://nemequ.github.io/hedley + * Created by Evan Nemerson + */ + +#if !defined(JSON_HEDLEY_VERSION) || (JSON_HEDLEY_VERSION < 15) +#if defined(JSON_HEDLEY_VERSION) + #undef JSON_HEDLEY_VERSION +#endif +#define JSON_HEDLEY_VERSION 15 + +#if defined(JSON_HEDLEY_STRINGIFY_EX) + #undef JSON_HEDLEY_STRINGIFY_EX +#endif +#define JSON_HEDLEY_STRINGIFY_EX(x) #x + +#if defined(JSON_HEDLEY_STRINGIFY) + #undef JSON_HEDLEY_STRINGIFY +#endif +#define JSON_HEDLEY_STRINGIFY(x) JSON_HEDLEY_STRINGIFY_EX(x) + +#if defined(JSON_HEDLEY_CONCAT_EX) + #undef JSON_HEDLEY_CONCAT_EX +#endif +#define JSON_HEDLEY_CONCAT_EX(a,b) a##b + +#if defined(JSON_HEDLEY_CONCAT) + #undef JSON_HEDLEY_CONCAT +#endif +#define JSON_HEDLEY_CONCAT(a,b) JSON_HEDLEY_CONCAT_EX(a,b) + +#if defined(JSON_HEDLEY_CONCAT3_EX) + #undef JSON_HEDLEY_CONCAT3_EX +#endif +#define JSON_HEDLEY_CONCAT3_EX(a,b,c) a##b##c + +#if defined(JSON_HEDLEY_CONCAT3) + #undef JSON_HEDLEY_CONCAT3 +#endif +#define JSON_HEDLEY_CONCAT3(a,b,c) JSON_HEDLEY_CONCAT3_EX(a,b,c) + +#if defined(JSON_HEDLEY_VERSION_ENCODE) + #undef JSON_HEDLEY_VERSION_ENCODE +#endif +#define JSON_HEDLEY_VERSION_ENCODE(major,minor,revision) (((major) * 1000000) + ((minor) * 1000) + (revision)) + +#if defined(JSON_HEDLEY_VERSION_DECODE_MAJOR) + #undef JSON_HEDLEY_VERSION_DECODE_MAJOR +#endif +#define JSON_HEDLEY_VERSION_DECODE_MAJOR(version) ((version) / 1000000) + +#if defined(JSON_HEDLEY_VERSION_DECODE_MINOR) + #undef JSON_HEDLEY_VERSION_DECODE_MINOR +#endif +#define JSON_HEDLEY_VERSION_DECODE_MINOR(version) (((version) % 1000000) / 1000) + +#if defined(JSON_HEDLEY_VERSION_DECODE_REVISION) + #undef JSON_HEDLEY_VERSION_DECODE_REVISION +#endif +#define JSON_HEDLEY_VERSION_DECODE_REVISION(version) ((version) % 1000) + +#if defined(JSON_HEDLEY_GNUC_VERSION) + #undef JSON_HEDLEY_GNUC_VERSION +#endif +#if defined(__GNUC__) && defined(__GNUC_PATCHLEVEL__) + #define JSON_HEDLEY_GNUC_VERSION JSON_HEDLEY_VERSION_ENCODE(__GNUC__, __GNUC_MINOR__, __GNUC_PATCHLEVEL__) +#elif defined(__GNUC__) + #define JSON_HEDLEY_GNUC_VERSION JSON_HEDLEY_VERSION_ENCODE(__GNUC__, __GNUC_MINOR__, 0) +#endif + +#if defined(JSON_HEDLEY_GNUC_VERSION_CHECK) + #undef JSON_HEDLEY_GNUC_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_GNUC_VERSION) + #define JSON_HEDLEY_GNUC_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_GNUC_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_GNUC_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_MSVC_VERSION) + #undef JSON_HEDLEY_MSVC_VERSION +#endif +#if defined(_MSC_FULL_VER) && (_MSC_FULL_VER >= 140000000) && !defined(__ICL) + #define JSON_HEDLEY_MSVC_VERSION JSON_HEDLEY_VERSION_ENCODE(_MSC_FULL_VER / 10000000, (_MSC_FULL_VER % 10000000) / 100000, (_MSC_FULL_VER % 100000) / 100) +#elif defined(_MSC_FULL_VER) && !defined(__ICL) + #define JSON_HEDLEY_MSVC_VERSION JSON_HEDLEY_VERSION_ENCODE(_MSC_FULL_VER / 1000000, (_MSC_FULL_VER % 1000000) / 10000, (_MSC_FULL_VER % 10000) / 10) +#elif defined(_MSC_VER) && !defined(__ICL) + #define JSON_HEDLEY_MSVC_VERSION JSON_HEDLEY_VERSION_ENCODE(_MSC_VER / 100, _MSC_VER % 100, 0) +#endif + +#if defined(JSON_HEDLEY_MSVC_VERSION_CHECK) + #undef JSON_HEDLEY_MSVC_VERSION_CHECK +#endif +#if !defined(JSON_HEDLEY_MSVC_VERSION) + #define JSON_HEDLEY_MSVC_VERSION_CHECK(major,minor,patch) (0) +#elif defined(_MSC_VER) && (_MSC_VER >= 1400) + #define JSON_HEDLEY_MSVC_VERSION_CHECK(major,minor,patch) (_MSC_FULL_VER >= ((major * 10000000) + (minor * 100000) + (patch))) +#elif defined(_MSC_VER) && (_MSC_VER >= 1200) + #define JSON_HEDLEY_MSVC_VERSION_CHECK(major,minor,patch) (_MSC_FULL_VER >= ((major * 1000000) + (minor * 10000) + (patch))) +#else + #define JSON_HEDLEY_MSVC_VERSION_CHECK(major,minor,patch) (_MSC_VER >= ((major * 100) + (minor))) +#endif + +#if defined(JSON_HEDLEY_INTEL_VERSION) + #undef JSON_HEDLEY_INTEL_VERSION +#endif +#if defined(__INTEL_COMPILER) && defined(__INTEL_COMPILER_UPDATE) && !defined(__ICL) + #define JSON_HEDLEY_INTEL_VERSION JSON_HEDLEY_VERSION_ENCODE(__INTEL_COMPILER / 100, __INTEL_COMPILER % 100, __INTEL_COMPILER_UPDATE) +#elif defined(__INTEL_COMPILER) && !defined(__ICL) + #define JSON_HEDLEY_INTEL_VERSION JSON_HEDLEY_VERSION_ENCODE(__INTEL_COMPILER / 100, __INTEL_COMPILER % 100, 0) +#endif + +#if defined(JSON_HEDLEY_INTEL_VERSION_CHECK) + #undef JSON_HEDLEY_INTEL_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_INTEL_VERSION) + #define JSON_HEDLEY_INTEL_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_INTEL_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_INTEL_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_INTEL_CL_VERSION) + #undef JSON_HEDLEY_INTEL_CL_VERSION +#endif +#if defined(__INTEL_COMPILER) && defined(__INTEL_COMPILER_UPDATE) && defined(__ICL) + #define JSON_HEDLEY_INTEL_CL_VERSION JSON_HEDLEY_VERSION_ENCODE(__INTEL_COMPILER, __INTEL_COMPILER_UPDATE, 0) +#endif + +#if defined(JSON_HEDLEY_INTEL_CL_VERSION_CHECK) + #undef JSON_HEDLEY_INTEL_CL_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_INTEL_CL_VERSION) + #define JSON_HEDLEY_INTEL_CL_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_INTEL_CL_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_INTEL_CL_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_PGI_VERSION) + #undef JSON_HEDLEY_PGI_VERSION +#endif +#if defined(__PGI) && defined(__PGIC__) && defined(__PGIC_MINOR__) && defined(__PGIC_PATCHLEVEL__) + #define JSON_HEDLEY_PGI_VERSION JSON_HEDLEY_VERSION_ENCODE(__PGIC__, __PGIC_MINOR__, __PGIC_PATCHLEVEL__) +#endif + +#if defined(JSON_HEDLEY_PGI_VERSION_CHECK) + #undef JSON_HEDLEY_PGI_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_PGI_VERSION) + #define JSON_HEDLEY_PGI_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_PGI_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_PGI_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_SUNPRO_VERSION) + #undef JSON_HEDLEY_SUNPRO_VERSION +#endif +#if defined(__SUNPRO_C) && (__SUNPRO_C > 0x1000) + #define JSON_HEDLEY_SUNPRO_VERSION JSON_HEDLEY_VERSION_ENCODE((((__SUNPRO_C >> 16) & 0xf) * 10) + ((__SUNPRO_C >> 12) & 0xf), (((__SUNPRO_C >> 8) & 0xf) * 10) + ((__SUNPRO_C >> 4) & 0xf), (__SUNPRO_C & 0xf) * 10) +#elif defined(__SUNPRO_C) + #define JSON_HEDLEY_SUNPRO_VERSION JSON_HEDLEY_VERSION_ENCODE((__SUNPRO_C >> 8) & 0xf, (__SUNPRO_C >> 4) & 0xf, (__SUNPRO_C) & 0xf) +#elif defined(__SUNPRO_CC) && (__SUNPRO_CC > 0x1000) + #define JSON_HEDLEY_SUNPRO_VERSION JSON_HEDLEY_VERSION_ENCODE((((__SUNPRO_CC >> 16) & 0xf) * 10) + ((__SUNPRO_CC >> 12) & 0xf), (((__SUNPRO_CC >> 8) & 0xf) * 10) + ((__SUNPRO_CC >> 4) & 0xf), (__SUNPRO_CC & 0xf) * 10) +#elif defined(__SUNPRO_CC) + #define JSON_HEDLEY_SUNPRO_VERSION JSON_HEDLEY_VERSION_ENCODE((__SUNPRO_CC >> 8) & 0xf, (__SUNPRO_CC >> 4) & 0xf, (__SUNPRO_CC) & 0xf) +#endif + +#if defined(JSON_HEDLEY_SUNPRO_VERSION_CHECK) + #undef JSON_HEDLEY_SUNPRO_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_SUNPRO_VERSION) + #define JSON_HEDLEY_SUNPRO_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_SUNPRO_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_SUNPRO_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_EMSCRIPTEN_VERSION) + #undef JSON_HEDLEY_EMSCRIPTEN_VERSION +#endif +#if defined(__EMSCRIPTEN__) + #define JSON_HEDLEY_EMSCRIPTEN_VERSION JSON_HEDLEY_VERSION_ENCODE(__EMSCRIPTEN_major__, __EMSCRIPTEN_minor__, __EMSCRIPTEN_tiny__) +#endif + +#if defined(JSON_HEDLEY_EMSCRIPTEN_VERSION_CHECK) + #undef JSON_HEDLEY_EMSCRIPTEN_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_EMSCRIPTEN_VERSION) + #define JSON_HEDLEY_EMSCRIPTEN_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_EMSCRIPTEN_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_EMSCRIPTEN_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_ARM_VERSION) + #undef JSON_HEDLEY_ARM_VERSION +#endif +#if defined(__CC_ARM) && defined(__ARMCOMPILER_VERSION) + #define JSON_HEDLEY_ARM_VERSION JSON_HEDLEY_VERSION_ENCODE(__ARMCOMPILER_VERSION / 1000000, (__ARMCOMPILER_VERSION % 1000000) / 10000, (__ARMCOMPILER_VERSION % 10000) / 100) +#elif defined(__CC_ARM) && defined(__ARMCC_VERSION) + #define JSON_HEDLEY_ARM_VERSION JSON_HEDLEY_VERSION_ENCODE(__ARMCC_VERSION / 1000000, (__ARMCC_VERSION % 1000000) / 10000, (__ARMCC_VERSION % 10000) / 100) +#endif + +#if defined(JSON_HEDLEY_ARM_VERSION_CHECK) + #undef JSON_HEDLEY_ARM_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_ARM_VERSION) + #define JSON_HEDLEY_ARM_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_ARM_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_ARM_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_IBM_VERSION) + #undef JSON_HEDLEY_IBM_VERSION +#endif +#if defined(__ibmxl__) + #define JSON_HEDLEY_IBM_VERSION JSON_HEDLEY_VERSION_ENCODE(__ibmxl_version__, __ibmxl_release__, __ibmxl_modification__) +#elif defined(__xlC__) && defined(__xlC_ver__) + #define JSON_HEDLEY_IBM_VERSION JSON_HEDLEY_VERSION_ENCODE(__xlC__ >> 8, __xlC__ & 0xff, (__xlC_ver__ >> 8) & 0xff) +#elif defined(__xlC__) + #define JSON_HEDLEY_IBM_VERSION JSON_HEDLEY_VERSION_ENCODE(__xlC__ >> 8, __xlC__ & 0xff, 0) +#endif + +#if defined(JSON_HEDLEY_IBM_VERSION_CHECK) + #undef JSON_HEDLEY_IBM_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_IBM_VERSION) + #define JSON_HEDLEY_IBM_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_IBM_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_IBM_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_TI_VERSION) + #undef JSON_HEDLEY_TI_VERSION +#endif +#if \ + defined(__TI_COMPILER_VERSION__) && \ + ( \ + defined(__TMS470__) || defined(__TI_ARM__) || \ + defined(__MSP430__) || \ + defined(__TMS320C2000__) \ + ) +#if (__TI_COMPILER_VERSION__ >= 16000000) + #define JSON_HEDLEY_TI_VERSION JSON_HEDLEY_VERSION_ENCODE(__TI_COMPILER_VERSION__ / 1000000, (__TI_COMPILER_VERSION__ % 1000000) / 1000, (__TI_COMPILER_VERSION__ % 1000)) +#endif +#endif + +#if defined(JSON_HEDLEY_TI_VERSION_CHECK) + #undef JSON_HEDLEY_TI_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_TI_VERSION) + #define JSON_HEDLEY_TI_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_TI_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_TI_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_TI_CL2000_VERSION) + #undef JSON_HEDLEY_TI_CL2000_VERSION +#endif +#if defined(__TI_COMPILER_VERSION__) && defined(__TMS320C2000__) + #define JSON_HEDLEY_TI_CL2000_VERSION JSON_HEDLEY_VERSION_ENCODE(__TI_COMPILER_VERSION__ / 1000000, (__TI_COMPILER_VERSION__ % 1000000) / 1000, (__TI_COMPILER_VERSION__ % 1000)) +#endif + +#if defined(JSON_HEDLEY_TI_CL2000_VERSION_CHECK) + #undef JSON_HEDLEY_TI_CL2000_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_TI_CL2000_VERSION) + #define JSON_HEDLEY_TI_CL2000_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_TI_CL2000_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_TI_CL2000_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_TI_CL430_VERSION) + #undef JSON_HEDLEY_TI_CL430_VERSION +#endif +#if defined(__TI_COMPILER_VERSION__) && defined(__MSP430__) + #define JSON_HEDLEY_TI_CL430_VERSION JSON_HEDLEY_VERSION_ENCODE(__TI_COMPILER_VERSION__ / 1000000, (__TI_COMPILER_VERSION__ % 1000000) / 1000, (__TI_COMPILER_VERSION__ % 1000)) +#endif + +#if defined(JSON_HEDLEY_TI_CL430_VERSION_CHECK) + #undef JSON_HEDLEY_TI_CL430_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_TI_CL430_VERSION) + #define JSON_HEDLEY_TI_CL430_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_TI_CL430_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_TI_CL430_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_TI_ARMCL_VERSION) + #undef JSON_HEDLEY_TI_ARMCL_VERSION +#endif +#if defined(__TI_COMPILER_VERSION__) && (defined(__TMS470__) || defined(__TI_ARM__)) + #define JSON_HEDLEY_TI_ARMCL_VERSION JSON_HEDLEY_VERSION_ENCODE(__TI_COMPILER_VERSION__ / 1000000, (__TI_COMPILER_VERSION__ % 1000000) / 1000, (__TI_COMPILER_VERSION__ % 1000)) +#endif + +#if defined(JSON_HEDLEY_TI_ARMCL_VERSION_CHECK) + #undef JSON_HEDLEY_TI_ARMCL_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_TI_ARMCL_VERSION) + #define JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_TI_ARMCL_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_TI_CL6X_VERSION) + #undef JSON_HEDLEY_TI_CL6X_VERSION +#endif +#if defined(__TI_COMPILER_VERSION__) && defined(__TMS320C6X__) + #define JSON_HEDLEY_TI_CL6X_VERSION JSON_HEDLEY_VERSION_ENCODE(__TI_COMPILER_VERSION__ / 1000000, (__TI_COMPILER_VERSION__ % 1000000) / 1000, (__TI_COMPILER_VERSION__ % 1000)) +#endif + +#if defined(JSON_HEDLEY_TI_CL6X_VERSION_CHECK) + #undef JSON_HEDLEY_TI_CL6X_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_TI_CL6X_VERSION) + #define JSON_HEDLEY_TI_CL6X_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_TI_CL6X_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_TI_CL6X_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_TI_CL7X_VERSION) + #undef JSON_HEDLEY_TI_CL7X_VERSION +#endif +#if defined(__TI_COMPILER_VERSION__) && defined(__C7000__) + #define JSON_HEDLEY_TI_CL7X_VERSION JSON_HEDLEY_VERSION_ENCODE(__TI_COMPILER_VERSION__ / 1000000, (__TI_COMPILER_VERSION__ % 1000000) / 1000, (__TI_COMPILER_VERSION__ % 1000)) +#endif + +#if defined(JSON_HEDLEY_TI_CL7X_VERSION_CHECK) + #undef JSON_HEDLEY_TI_CL7X_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_TI_CL7X_VERSION) + #define JSON_HEDLEY_TI_CL7X_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_TI_CL7X_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_TI_CL7X_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_TI_CLPRU_VERSION) + #undef JSON_HEDLEY_TI_CLPRU_VERSION +#endif +#if defined(__TI_COMPILER_VERSION__) && defined(__PRU__) + #define JSON_HEDLEY_TI_CLPRU_VERSION JSON_HEDLEY_VERSION_ENCODE(__TI_COMPILER_VERSION__ / 1000000, (__TI_COMPILER_VERSION__ % 1000000) / 1000, (__TI_COMPILER_VERSION__ % 1000)) +#endif + +#if defined(JSON_HEDLEY_TI_CLPRU_VERSION_CHECK) + #undef JSON_HEDLEY_TI_CLPRU_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_TI_CLPRU_VERSION) + #define JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_TI_CLPRU_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_CRAY_VERSION) + #undef JSON_HEDLEY_CRAY_VERSION +#endif +#if defined(_CRAYC) + #if defined(_RELEASE_PATCHLEVEL) + #define JSON_HEDLEY_CRAY_VERSION JSON_HEDLEY_VERSION_ENCODE(_RELEASE_MAJOR, _RELEASE_MINOR, _RELEASE_PATCHLEVEL) + #else + #define JSON_HEDLEY_CRAY_VERSION JSON_HEDLEY_VERSION_ENCODE(_RELEASE_MAJOR, _RELEASE_MINOR, 0) + #endif +#endif + +#if defined(JSON_HEDLEY_CRAY_VERSION_CHECK) + #undef JSON_HEDLEY_CRAY_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_CRAY_VERSION) + #define JSON_HEDLEY_CRAY_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_CRAY_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_CRAY_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_IAR_VERSION) + #undef JSON_HEDLEY_IAR_VERSION +#endif +#if defined(__IAR_SYSTEMS_ICC__) + #if __VER__ > 1000 + #define JSON_HEDLEY_IAR_VERSION JSON_HEDLEY_VERSION_ENCODE((__VER__ / 1000000), ((__VER__ / 1000) % 1000), (__VER__ % 1000)) + #else + #define JSON_HEDLEY_IAR_VERSION JSON_HEDLEY_VERSION_ENCODE(__VER__ / 100, __VER__ % 100, 0) + #endif +#endif + +#if defined(JSON_HEDLEY_IAR_VERSION_CHECK) + #undef JSON_HEDLEY_IAR_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_IAR_VERSION) + #define JSON_HEDLEY_IAR_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_IAR_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_IAR_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_TINYC_VERSION) + #undef JSON_HEDLEY_TINYC_VERSION +#endif +#if defined(__TINYC__) + #define JSON_HEDLEY_TINYC_VERSION JSON_HEDLEY_VERSION_ENCODE(__TINYC__ / 1000, (__TINYC__ / 100) % 10, __TINYC__ % 100) +#endif + +#if defined(JSON_HEDLEY_TINYC_VERSION_CHECK) + #undef JSON_HEDLEY_TINYC_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_TINYC_VERSION) + #define JSON_HEDLEY_TINYC_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_TINYC_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_TINYC_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_DMC_VERSION) + #undef JSON_HEDLEY_DMC_VERSION +#endif +#if defined(__DMC__) + #define JSON_HEDLEY_DMC_VERSION JSON_HEDLEY_VERSION_ENCODE(__DMC__ >> 8, (__DMC__ >> 4) & 0xf, __DMC__ & 0xf) +#endif + +#if defined(JSON_HEDLEY_DMC_VERSION_CHECK) + #undef JSON_HEDLEY_DMC_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_DMC_VERSION) + #define JSON_HEDLEY_DMC_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_DMC_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_DMC_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_COMPCERT_VERSION) + #undef JSON_HEDLEY_COMPCERT_VERSION +#endif +#if defined(__COMPCERT_VERSION__) + #define JSON_HEDLEY_COMPCERT_VERSION JSON_HEDLEY_VERSION_ENCODE(__COMPCERT_VERSION__ / 10000, (__COMPCERT_VERSION__ / 100) % 100, __COMPCERT_VERSION__ % 100) +#endif + +#if defined(JSON_HEDLEY_COMPCERT_VERSION_CHECK) + #undef JSON_HEDLEY_COMPCERT_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_COMPCERT_VERSION) + #define JSON_HEDLEY_COMPCERT_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_COMPCERT_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_COMPCERT_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_PELLES_VERSION) + #undef JSON_HEDLEY_PELLES_VERSION +#endif +#if defined(__POCC__) + #define JSON_HEDLEY_PELLES_VERSION JSON_HEDLEY_VERSION_ENCODE(__POCC__ / 100, __POCC__ % 100, 0) +#endif + +#if defined(JSON_HEDLEY_PELLES_VERSION_CHECK) + #undef JSON_HEDLEY_PELLES_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_PELLES_VERSION) + #define JSON_HEDLEY_PELLES_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_PELLES_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_PELLES_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_MCST_LCC_VERSION) + #undef JSON_HEDLEY_MCST_LCC_VERSION +#endif +#if defined(__LCC__) && defined(__LCC_MINOR__) + #define JSON_HEDLEY_MCST_LCC_VERSION JSON_HEDLEY_VERSION_ENCODE(__LCC__ / 100, __LCC__ % 100, __LCC_MINOR__) +#endif + +#if defined(JSON_HEDLEY_MCST_LCC_VERSION_CHECK) + #undef JSON_HEDLEY_MCST_LCC_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_MCST_LCC_VERSION) + #define JSON_HEDLEY_MCST_LCC_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_MCST_LCC_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_MCST_LCC_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_GCC_VERSION) + #undef JSON_HEDLEY_GCC_VERSION +#endif +#if \ + defined(JSON_HEDLEY_GNUC_VERSION) && \ + !defined(__clang__) && \ + !defined(JSON_HEDLEY_INTEL_VERSION) && \ + !defined(JSON_HEDLEY_PGI_VERSION) && \ + !defined(JSON_HEDLEY_ARM_VERSION) && \ + !defined(JSON_HEDLEY_CRAY_VERSION) && \ + !defined(JSON_HEDLEY_TI_VERSION) && \ + !defined(JSON_HEDLEY_TI_ARMCL_VERSION) && \ + !defined(JSON_HEDLEY_TI_CL430_VERSION) && \ + !defined(JSON_HEDLEY_TI_CL2000_VERSION) && \ + !defined(JSON_HEDLEY_TI_CL6X_VERSION) && \ + !defined(JSON_HEDLEY_TI_CL7X_VERSION) && \ + !defined(JSON_HEDLEY_TI_CLPRU_VERSION) && \ + !defined(__COMPCERT__) && \ + !defined(JSON_HEDLEY_MCST_LCC_VERSION) + #define JSON_HEDLEY_GCC_VERSION JSON_HEDLEY_GNUC_VERSION +#endif + +#if defined(JSON_HEDLEY_GCC_VERSION_CHECK) + #undef JSON_HEDLEY_GCC_VERSION_CHECK +#endif +#if defined(JSON_HEDLEY_GCC_VERSION) + #define JSON_HEDLEY_GCC_VERSION_CHECK(major,minor,patch) (JSON_HEDLEY_GCC_VERSION >= JSON_HEDLEY_VERSION_ENCODE(major, minor, patch)) +#else + #define JSON_HEDLEY_GCC_VERSION_CHECK(major,minor,patch) (0) +#endif + +#if defined(JSON_HEDLEY_HAS_ATTRIBUTE) + #undef JSON_HEDLEY_HAS_ATTRIBUTE +#endif +#if \ + defined(__has_attribute) && \ + ( \ + (!defined(JSON_HEDLEY_IAR_VERSION) || JSON_HEDLEY_IAR_VERSION_CHECK(8,5,9)) \ + ) +# define JSON_HEDLEY_HAS_ATTRIBUTE(attribute) __has_attribute(attribute) +#else +# define JSON_HEDLEY_HAS_ATTRIBUTE(attribute) (0) +#endif + +#if defined(JSON_HEDLEY_GNUC_HAS_ATTRIBUTE) + #undef JSON_HEDLEY_GNUC_HAS_ATTRIBUTE +#endif +#if defined(__has_attribute) + #define JSON_HEDLEY_GNUC_HAS_ATTRIBUTE(attribute,major,minor,patch) JSON_HEDLEY_HAS_ATTRIBUTE(attribute) +#else + #define JSON_HEDLEY_GNUC_HAS_ATTRIBUTE(attribute,major,minor,patch) JSON_HEDLEY_GNUC_VERSION_CHECK(major,minor,patch) +#endif + +#if defined(JSON_HEDLEY_GCC_HAS_ATTRIBUTE) + #undef JSON_HEDLEY_GCC_HAS_ATTRIBUTE +#endif +#if defined(__has_attribute) + #define JSON_HEDLEY_GCC_HAS_ATTRIBUTE(attribute,major,minor,patch) JSON_HEDLEY_HAS_ATTRIBUTE(attribute) +#else + #define JSON_HEDLEY_GCC_HAS_ATTRIBUTE(attribute,major,minor,patch) JSON_HEDLEY_GCC_VERSION_CHECK(major,minor,patch) +#endif + +#if defined(JSON_HEDLEY_HAS_CPP_ATTRIBUTE) + #undef JSON_HEDLEY_HAS_CPP_ATTRIBUTE +#endif +#if \ + defined(__has_cpp_attribute) && \ + defined(__cplusplus) && \ + (!defined(JSON_HEDLEY_SUNPRO_VERSION) || JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,15,0)) + #define JSON_HEDLEY_HAS_CPP_ATTRIBUTE(attribute) __has_cpp_attribute(attribute) +#else + #define JSON_HEDLEY_HAS_CPP_ATTRIBUTE(attribute) (0) +#endif + +#if defined(JSON_HEDLEY_HAS_CPP_ATTRIBUTE_NS) + #undef JSON_HEDLEY_HAS_CPP_ATTRIBUTE_NS +#endif +#if !defined(__cplusplus) || !defined(__has_cpp_attribute) + #define JSON_HEDLEY_HAS_CPP_ATTRIBUTE_NS(ns,attribute) (0) +#elif \ + !defined(JSON_HEDLEY_PGI_VERSION) && \ + !defined(JSON_HEDLEY_IAR_VERSION) && \ + (!defined(JSON_HEDLEY_SUNPRO_VERSION) || JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,15,0)) && \ + (!defined(JSON_HEDLEY_MSVC_VERSION) || JSON_HEDLEY_MSVC_VERSION_CHECK(19,20,0)) + #define JSON_HEDLEY_HAS_CPP_ATTRIBUTE_NS(ns,attribute) JSON_HEDLEY_HAS_CPP_ATTRIBUTE(ns::attribute) +#else + #define JSON_HEDLEY_HAS_CPP_ATTRIBUTE_NS(ns,attribute) (0) +#endif + +#if defined(JSON_HEDLEY_GNUC_HAS_CPP_ATTRIBUTE) + #undef JSON_HEDLEY_GNUC_HAS_CPP_ATTRIBUTE +#endif +#if defined(__has_cpp_attribute) && defined(__cplusplus) + #define JSON_HEDLEY_GNUC_HAS_CPP_ATTRIBUTE(attribute,major,minor,patch) __has_cpp_attribute(attribute) +#else + #define JSON_HEDLEY_GNUC_HAS_CPP_ATTRIBUTE(attribute,major,minor,patch) JSON_HEDLEY_GNUC_VERSION_CHECK(major,minor,patch) +#endif + +#if defined(JSON_HEDLEY_GCC_HAS_CPP_ATTRIBUTE) + #undef JSON_HEDLEY_GCC_HAS_CPP_ATTRIBUTE +#endif +#if defined(__has_cpp_attribute) && defined(__cplusplus) + #define JSON_HEDLEY_GCC_HAS_CPP_ATTRIBUTE(attribute,major,minor,patch) __has_cpp_attribute(attribute) +#else + #define JSON_HEDLEY_GCC_HAS_CPP_ATTRIBUTE(attribute,major,minor,patch) JSON_HEDLEY_GCC_VERSION_CHECK(major,minor,patch) +#endif + +#if defined(JSON_HEDLEY_HAS_BUILTIN) + #undef JSON_HEDLEY_HAS_BUILTIN +#endif +#if defined(__has_builtin) + #define JSON_HEDLEY_HAS_BUILTIN(builtin) __has_builtin(builtin) +#else + #define JSON_HEDLEY_HAS_BUILTIN(builtin) (0) +#endif + +#if defined(JSON_HEDLEY_GNUC_HAS_BUILTIN) + #undef JSON_HEDLEY_GNUC_HAS_BUILTIN +#endif +#if defined(__has_builtin) + #define JSON_HEDLEY_GNUC_HAS_BUILTIN(builtin,major,minor,patch) __has_builtin(builtin) +#else + #define JSON_HEDLEY_GNUC_HAS_BUILTIN(builtin,major,minor,patch) JSON_HEDLEY_GNUC_VERSION_CHECK(major,minor,patch) +#endif + +#if defined(JSON_HEDLEY_GCC_HAS_BUILTIN) + #undef JSON_HEDLEY_GCC_HAS_BUILTIN +#endif +#if defined(__has_builtin) + #define JSON_HEDLEY_GCC_HAS_BUILTIN(builtin,major,minor,patch) __has_builtin(builtin) +#else + #define JSON_HEDLEY_GCC_HAS_BUILTIN(builtin,major,minor,patch) JSON_HEDLEY_GCC_VERSION_CHECK(major,minor,patch) +#endif + +#if defined(JSON_HEDLEY_HAS_FEATURE) + #undef JSON_HEDLEY_HAS_FEATURE +#endif +#if defined(__has_feature) + #define JSON_HEDLEY_HAS_FEATURE(feature) __has_feature(feature) +#else + #define JSON_HEDLEY_HAS_FEATURE(feature) (0) +#endif + +#if defined(JSON_HEDLEY_GNUC_HAS_FEATURE) + #undef JSON_HEDLEY_GNUC_HAS_FEATURE +#endif +#if defined(__has_feature) + #define JSON_HEDLEY_GNUC_HAS_FEATURE(feature,major,minor,patch) __has_feature(feature) +#else + #define JSON_HEDLEY_GNUC_HAS_FEATURE(feature,major,minor,patch) JSON_HEDLEY_GNUC_VERSION_CHECK(major,minor,patch) +#endif + +#if defined(JSON_HEDLEY_GCC_HAS_FEATURE) + #undef JSON_HEDLEY_GCC_HAS_FEATURE +#endif +#if defined(__has_feature) + #define JSON_HEDLEY_GCC_HAS_FEATURE(feature,major,minor,patch) __has_feature(feature) +#else + #define JSON_HEDLEY_GCC_HAS_FEATURE(feature,major,minor,patch) JSON_HEDLEY_GCC_VERSION_CHECK(major,minor,patch) +#endif + +#if defined(JSON_HEDLEY_HAS_EXTENSION) + #undef JSON_HEDLEY_HAS_EXTENSION +#endif +#if defined(__has_extension) + #define JSON_HEDLEY_HAS_EXTENSION(extension) __has_extension(extension) +#else + #define JSON_HEDLEY_HAS_EXTENSION(extension) (0) +#endif + +#if defined(JSON_HEDLEY_GNUC_HAS_EXTENSION) + #undef JSON_HEDLEY_GNUC_HAS_EXTENSION +#endif +#if defined(__has_extension) + #define JSON_HEDLEY_GNUC_HAS_EXTENSION(extension,major,minor,patch) __has_extension(extension) +#else + #define JSON_HEDLEY_GNUC_HAS_EXTENSION(extension,major,minor,patch) JSON_HEDLEY_GNUC_VERSION_CHECK(major,minor,patch) +#endif + +#if defined(JSON_HEDLEY_GCC_HAS_EXTENSION) + #undef JSON_HEDLEY_GCC_HAS_EXTENSION +#endif +#if defined(__has_extension) + #define JSON_HEDLEY_GCC_HAS_EXTENSION(extension,major,minor,patch) __has_extension(extension) +#else + #define JSON_HEDLEY_GCC_HAS_EXTENSION(extension,major,minor,patch) JSON_HEDLEY_GCC_VERSION_CHECK(major,minor,patch) +#endif + +#if defined(JSON_HEDLEY_HAS_DECLSPEC_ATTRIBUTE) + #undef JSON_HEDLEY_HAS_DECLSPEC_ATTRIBUTE +#endif +#if defined(__has_declspec_attribute) + #define JSON_HEDLEY_HAS_DECLSPEC_ATTRIBUTE(attribute) __has_declspec_attribute(attribute) +#else + #define JSON_HEDLEY_HAS_DECLSPEC_ATTRIBUTE(attribute) (0) +#endif + +#if defined(JSON_HEDLEY_GNUC_HAS_DECLSPEC_ATTRIBUTE) + #undef JSON_HEDLEY_GNUC_HAS_DECLSPEC_ATTRIBUTE +#endif +#if defined(__has_declspec_attribute) + #define JSON_HEDLEY_GNUC_HAS_DECLSPEC_ATTRIBUTE(attribute,major,minor,patch) __has_declspec_attribute(attribute) +#else + #define JSON_HEDLEY_GNUC_HAS_DECLSPEC_ATTRIBUTE(attribute,major,minor,patch) JSON_HEDLEY_GNUC_VERSION_CHECK(major,minor,patch) +#endif + +#if defined(JSON_HEDLEY_GCC_HAS_DECLSPEC_ATTRIBUTE) + #undef JSON_HEDLEY_GCC_HAS_DECLSPEC_ATTRIBUTE +#endif +#if defined(__has_declspec_attribute) + #define JSON_HEDLEY_GCC_HAS_DECLSPEC_ATTRIBUTE(attribute,major,minor,patch) __has_declspec_attribute(attribute) +#else + #define JSON_HEDLEY_GCC_HAS_DECLSPEC_ATTRIBUTE(attribute,major,minor,patch) JSON_HEDLEY_GCC_VERSION_CHECK(major,minor,patch) +#endif + +#if defined(JSON_HEDLEY_HAS_WARNING) + #undef JSON_HEDLEY_HAS_WARNING +#endif +#if defined(__has_warning) + #define JSON_HEDLEY_HAS_WARNING(warning) __has_warning(warning) +#else + #define JSON_HEDLEY_HAS_WARNING(warning) (0) +#endif + +#if defined(JSON_HEDLEY_GNUC_HAS_WARNING) + #undef JSON_HEDLEY_GNUC_HAS_WARNING +#endif +#if defined(__has_warning) + #define JSON_HEDLEY_GNUC_HAS_WARNING(warning,major,minor,patch) __has_warning(warning) +#else + #define JSON_HEDLEY_GNUC_HAS_WARNING(warning,major,minor,patch) JSON_HEDLEY_GNUC_VERSION_CHECK(major,minor,patch) +#endif + +#if defined(JSON_HEDLEY_GCC_HAS_WARNING) + #undef JSON_HEDLEY_GCC_HAS_WARNING +#endif +#if defined(__has_warning) + #define JSON_HEDLEY_GCC_HAS_WARNING(warning,major,minor,patch) __has_warning(warning) +#else + #define JSON_HEDLEY_GCC_HAS_WARNING(warning,major,minor,patch) JSON_HEDLEY_GCC_VERSION_CHECK(major,minor,patch) +#endif + +#if \ + (defined(__STDC_VERSION__) && (__STDC_VERSION__ >= 199901L)) || \ + defined(__clang__) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(3,0,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_IAR_VERSION_CHECK(8,0,0) || \ + JSON_HEDLEY_PGI_VERSION_CHECK(18,4,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(4,1,0) || \ + JSON_HEDLEY_TI_VERSION_CHECK(15,12,0) || \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(4,7,0) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(2,0,1) || \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,1,0) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,0,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,1,0) || \ + JSON_HEDLEY_CRAY_VERSION_CHECK(5,0,0) || \ + JSON_HEDLEY_TINYC_VERSION_CHECK(0,9,17) || \ + JSON_HEDLEY_SUNPRO_VERSION_CHECK(8,0,0) || \ + (JSON_HEDLEY_IBM_VERSION_CHECK(10,1,0) && defined(__C99_PRAGMA_OPERATOR)) + #define JSON_HEDLEY_PRAGMA(value) _Pragma(#value) +#elif JSON_HEDLEY_MSVC_VERSION_CHECK(15,0,0) + #define JSON_HEDLEY_PRAGMA(value) __pragma(value) +#else + #define JSON_HEDLEY_PRAGMA(value) +#endif + +#if defined(JSON_HEDLEY_DIAGNOSTIC_PUSH) + #undef JSON_HEDLEY_DIAGNOSTIC_PUSH +#endif +#if defined(JSON_HEDLEY_DIAGNOSTIC_POP) + #undef JSON_HEDLEY_DIAGNOSTIC_POP +#endif +#if defined(__clang__) + #define JSON_HEDLEY_DIAGNOSTIC_PUSH _Pragma("clang diagnostic push") + #define JSON_HEDLEY_DIAGNOSTIC_POP _Pragma("clang diagnostic pop") +#elif JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) + #define JSON_HEDLEY_DIAGNOSTIC_PUSH _Pragma("warning(push)") + #define JSON_HEDLEY_DIAGNOSTIC_POP _Pragma("warning(pop)") +#elif JSON_HEDLEY_GCC_VERSION_CHECK(4,6,0) + #define JSON_HEDLEY_DIAGNOSTIC_PUSH _Pragma("GCC diagnostic push") + #define JSON_HEDLEY_DIAGNOSTIC_POP _Pragma("GCC diagnostic pop") +#elif \ + JSON_HEDLEY_MSVC_VERSION_CHECK(15,0,0) || \ + JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) + #define JSON_HEDLEY_DIAGNOSTIC_PUSH __pragma(warning(push)) + #define JSON_HEDLEY_DIAGNOSTIC_POP __pragma(warning(pop)) +#elif JSON_HEDLEY_ARM_VERSION_CHECK(5,6,0) + #define JSON_HEDLEY_DIAGNOSTIC_PUSH _Pragma("push") + #define JSON_HEDLEY_DIAGNOSTIC_POP _Pragma("pop") +#elif \ + JSON_HEDLEY_TI_VERSION_CHECK(15,12,0) || \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(5,2,0) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,4,0) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(8,1,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,1,0) + #define JSON_HEDLEY_DIAGNOSTIC_PUSH _Pragma("diag_push") + #define JSON_HEDLEY_DIAGNOSTIC_POP _Pragma("diag_pop") +#elif JSON_HEDLEY_PELLES_VERSION_CHECK(2,90,0) + #define JSON_HEDLEY_DIAGNOSTIC_PUSH _Pragma("warning(push)") + #define JSON_HEDLEY_DIAGNOSTIC_POP _Pragma("warning(pop)") +#else + #define JSON_HEDLEY_DIAGNOSTIC_PUSH + #define JSON_HEDLEY_DIAGNOSTIC_POP +#endif + +/* JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_ is for + HEDLEY INTERNAL USE ONLY. API subject to change without notice. */ +#if defined(JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_) + #undef JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_ +#endif +#if defined(__cplusplus) +# if JSON_HEDLEY_HAS_WARNING("-Wc++98-compat") +# if JSON_HEDLEY_HAS_WARNING("-Wc++17-extensions") +# if JSON_HEDLEY_HAS_WARNING("-Wc++1z-extensions") +# define JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_(xpr) \ + JSON_HEDLEY_DIAGNOSTIC_PUSH \ + _Pragma("clang diagnostic ignored \"-Wc++98-compat\"") \ + _Pragma("clang diagnostic ignored \"-Wc++17-extensions\"") \ + _Pragma("clang diagnostic ignored \"-Wc++1z-extensions\"") \ + xpr \ + JSON_HEDLEY_DIAGNOSTIC_POP +# else +# define JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_(xpr) \ + JSON_HEDLEY_DIAGNOSTIC_PUSH \ + _Pragma("clang diagnostic ignored \"-Wc++98-compat\"") \ + _Pragma("clang diagnostic ignored \"-Wc++17-extensions\"") \ + xpr \ + JSON_HEDLEY_DIAGNOSTIC_POP +# endif +# else +# define JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_(xpr) \ + JSON_HEDLEY_DIAGNOSTIC_PUSH \ + _Pragma("clang diagnostic ignored \"-Wc++98-compat\"") \ + xpr \ + JSON_HEDLEY_DIAGNOSTIC_POP +# endif +# endif +#endif +#if !defined(JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_(x) x +#endif + +#if defined(JSON_HEDLEY_CONST_CAST) + #undef JSON_HEDLEY_CONST_CAST +#endif +#if defined(__cplusplus) +# define JSON_HEDLEY_CONST_CAST(T, expr) (const_cast(expr)) +#elif \ + JSON_HEDLEY_HAS_WARNING("-Wcast-qual") || \ + JSON_HEDLEY_GCC_VERSION_CHECK(4,6,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) +# define JSON_HEDLEY_CONST_CAST(T, expr) (__extension__ ({ \ + JSON_HEDLEY_DIAGNOSTIC_PUSH \ + JSON_HEDLEY_DIAGNOSTIC_DISABLE_CAST_QUAL \ + ((T) (expr)); \ + JSON_HEDLEY_DIAGNOSTIC_POP \ + })) +#else +# define JSON_HEDLEY_CONST_CAST(T, expr) ((T) (expr)) +#endif + +#if defined(JSON_HEDLEY_REINTERPRET_CAST) + #undef JSON_HEDLEY_REINTERPRET_CAST +#endif +#if defined(__cplusplus) + #define JSON_HEDLEY_REINTERPRET_CAST(T, expr) (reinterpret_cast(expr)) +#else + #define JSON_HEDLEY_REINTERPRET_CAST(T, expr) ((T) (expr)) +#endif + +#if defined(JSON_HEDLEY_STATIC_CAST) + #undef JSON_HEDLEY_STATIC_CAST +#endif +#if defined(__cplusplus) + #define JSON_HEDLEY_STATIC_CAST(T, expr) (static_cast(expr)) +#else + #define JSON_HEDLEY_STATIC_CAST(T, expr) ((T) (expr)) +#endif + +#if defined(JSON_HEDLEY_CPP_CAST) + #undef JSON_HEDLEY_CPP_CAST +#endif +#if defined(__cplusplus) +# if JSON_HEDLEY_HAS_WARNING("-Wold-style-cast") +# define JSON_HEDLEY_CPP_CAST(T, expr) \ + JSON_HEDLEY_DIAGNOSTIC_PUSH \ + _Pragma("clang diagnostic ignored \"-Wold-style-cast\"") \ + ((T) (expr)) \ + JSON_HEDLEY_DIAGNOSTIC_POP +# elif JSON_HEDLEY_IAR_VERSION_CHECK(8,3,0) +# define JSON_HEDLEY_CPP_CAST(T, expr) \ + JSON_HEDLEY_DIAGNOSTIC_PUSH \ + _Pragma("diag_suppress=Pe137") \ + JSON_HEDLEY_DIAGNOSTIC_POP +# else +# define JSON_HEDLEY_CPP_CAST(T, expr) ((T) (expr)) +# endif +#else +# define JSON_HEDLEY_CPP_CAST(T, expr) (expr) +#endif + +#if defined(JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED) + #undef JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED +#endif +#if JSON_HEDLEY_HAS_WARNING("-Wdeprecated-declarations") + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED _Pragma("clang diagnostic ignored \"-Wdeprecated-declarations\"") +#elif JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED _Pragma("warning(disable:1478 1786)") +#elif JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED __pragma(warning(disable:1478 1786)) +#elif JSON_HEDLEY_PGI_VERSION_CHECK(20,7,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED _Pragma("diag_suppress 1215,1216,1444,1445") +#elif JSON_HEDLEY_PGI_VERSION_CHECK(17,10,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED _Pragma("diag_suppress 1215,1444") +#elif JSON_HEDLEY_GCC_VERSION_CHECK(4,3,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED _Pragma("GCC diagnostic ignored \"-Wdeprecated-declarations\"") +#elif JSON_HEDLEY_MSVC_VERSION_CHECK(15,0,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED __pragma(warning(disable:4996)) +#elif JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED _Pragma("diag_suppress 1215,1444") +#elif \ + JSON_HEDLEY_TI_VERSION_CHECK(15,12,0) || \ + (JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(4,8,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(5,2,0) || \ + (JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,4,0) || \ + (JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,3,0) || \ + (JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,2,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,5,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,1,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED _Pragma("diag_suppress 1291,1718") +#elif JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,13,0) && !defined(__cplusplus) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED _Pragma("error_messages(off,E_DEPRECATED_ATT,E_DEPRECATED_ATT_MESS)") +#elif JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,13,0) && defined(__cplusplus) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED _Pragma("error_messages(off,symdeprecated,symdeprecated2)") +#elif JSON_HEDLEY_IAR_VERSION_CHECK(8,0,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED _Pragma("diag_suppress=Pe1444,Pe1215") +#elif JSON_HEDLEY_PELLES_VERSION_CHECK(2,90,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED _Pragma("warn(disable:2241)") +#else + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_DEPRECATED +#endif + +#if defined(JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_PRAGMAS) + #undef JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_PRAGMAS +#endif +#if JSON_HEDLEY_HAS_WARNING("-Wunknown-pragmas") + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_PRAGMAS _Pragma("clang diagnostic ignored \"-Wunknown-pragmas\"") +#elif JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_PRAGMAS _Pragma("warning(disable:161)") +#elif JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_PRAGMAS __pragma(warning(disable:161)) +#elif JSON_HEDLEY_PGI_VERSION_CHECK(17,10,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_PRAGMAS _Pragma("diag_suppress 1675") +#elif JSON_HEDLEY_GCC_VERSION_CHECK(4,3,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_PRAGMAS _Pragma("GCC diagnostic ignored \"-Wunknown-pragmas\"") +#elif JSON_HEDLEY_MSVC_VERSION_CHECK(15,0,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_PRAGMAS __pragma(warning(disable:4068)) +#elif \ + JSON_HEDLEY_TI_VERSION_CHECK(16,9,0) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(8,0,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,3,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_PRAGMAS _Pragma("diag_suppress 163") +#elif JSON_HEDLEY_TI_CL6X_VERSION_CHECK(8,0,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_PRAGMAS _Pragma("diag_suppress 163") +#elif JSON_HEDLEY_IAR_VERSION_CHECK(8,0,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_PRAGMAS _Pragma("diag_suppress=Pe161") +#elif JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_PRAGMAS _Pragma("diag_suppress 161") +#else + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_PRAGMAS +#endif + +#if defined(JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_CPP_ATTRIBUTES) + #undef JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_CPP_ATTRIBUTES +#endif +#if JSON_HEDLEY_HAS_WARNING("-Wunknown-attributes") + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_CPP_ATTRIBUTES _Pragma("clang diagnostic ignored \"-Wunknown-attributes\"") +#elif JSON_HEDLEY_GCC_VERSION_CHECK(4,6,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_CPP_ATTRIBUTES _Pragma("GCC diagnostic ignored \"-Wdeprecated-declarations\"") +#elif JSON_HEDLEY_INTEL_VERSION_CHECK(17,0,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_CPP_ATTRIBUTES _Pragma("warning(disable:1292)") +#elif JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_CPP_ATTRIBUTES __pragma(warning(disable:1292)) +#elif JSON_HEDLEY_MSVC_VERSION_CHECK(19,0,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_CPP_ATTRIBUTES __pragma(warning(disable:5030)) +#elif JSON_HEDLEY_PGI_VERSION_CHECK(20,7,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_CPP_ATTRIBUTES _Pragma("diag_suppress 1097,1098") +#elif JSON_HEDLEY_PGI_VERSION_CHECK(17,10,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_CPP_ATTRIBUTES _Pragma("diag_suppress 1097") +#elif JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,14,0) && defined(__cplusplus) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_CPP_ATTRIBUTES _Pragma("error_messages(off,attrskipunsup)") +#elif \ + JSON_HEDLEY_TI_VERSION_CHECK(18,1,0) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(8,3,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_CPP_ATTRIBUTES _Pragma("diag_suppress 1173") +#elif JSON_HEDLEY_IAR_VERSION_CHECK(8,0,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_CPP_ATTRIBUTES _Pragma("diag_suppress=Pe1097") +#elif JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_CPP_ATTRIBUTES _Pragma("diag_suppress 1097") +#else + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_CPP_ATTRIBUTES +#endif + +#if defined(JSON_HEDLEY_DIAGNOSTIC_DISABLE_CAST_QUAL) + #undef JSON_HEDLEY_DIAGNOSTIC_DISABLE_CAST_QUAL +#endif +#if JSON_HEDLEY_HAS_WARNING("-Wcast-qual") + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_CAST_QUAL _Pragma("clang diagnostic ignored \"-Wcast-qual\"") +#elif JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_CAST_QUAL _Pragma("warning(disable:2203 2331)") +#elif JSON_HEDLEY_GCC_VERSION_CHECK(3,0,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_CAST_QUAL _Pragma("GCC diagnostic ignored \"-Wcast-qual\"") +#else + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_CAST_QUAL +#endif + +#if defined(JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNUSED_FUNCTION) + #undef JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNUSED_FUNCTION +#endif +#if JSON_HEDLEY_HAS_WARNING("-Wunused-function") + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNUSED_FUNCTION _Pragma("clang diagnostic ignored \"-Wunused-function\"") +#elif JSON_HEDLEY_GCC_VERSION_CHECK(3,4,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNUSED_FUNCTION _Pragma("GCC diagnostic ignored \"-Wunused-function\"") +#elif JSON_HEDLEY_MSVC_VERSION_CHECK(1,0,0) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNUSED_FUNCTION __pragma(warning(disable:4505)) +#elif JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNUSED_FUNCTION _Pragma("diag_suppress 3142") +#else + #define JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNUSED_FUNCTION +#endif + +#if defined(JSON_HEDLEY_DEPRECATED) + #undef JSON_HEDLEY_DEPRECATED +#endif +#if defined(JSON_HEDLEY_DEPRECATED_FOR) + #undef JSON_HEDLEY_DEPRECATED_FOR +#endif +#if \ + JSON_HEDLEY_MSVC_VERSION_CHECK(14,0,0) || \ + JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) + #define JSON_HEDLEY_DEPRECATED(since) __declspec(deprecated("Since " # since)) + #define JSON_HEDLEY_DEPRECATED_FOR(since, replacement) __declspec(deprecated("Since " #since "; use " #replacement)) +#elif \ + (JSON_HEDLEY_HAS_EXTENSION(attribute_deprecated_with_message) && !defined(JSON_HEDLEY_IAR_VERSION)) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(4,5,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(5,6,0) || \ + JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,13,0) || \ + JSON_HEDLEY_PGI_VERSION_CHECK(17,10,0) || \ + JSON_HEDLEY_TI_VERSION_CHECK(18,1,0) || \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(18,1,0) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(8,3,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,3,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_DEPRECATED(since) __attribute__((__deprecated__("Since " #since))) + #define JSON_HEDLEY_DEPRECATED_FOR(since, replacement) __attribute__((__deprecated__("Since " #since "; use " #replacement))) +#elif defined(__cplusplus) && (__cplusplus >= 201402L) + #define JSON_HEDLEY_DEPRECATED(since) JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_([[deprecated("Since " #since)]]) + #define JSON_HEDLEY_DEPRECATED_FOR(since, replacement) JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_([[deprecated("Since " #since "; use " #replacement)]]) +#elif \ + JSON_HEDLEY_HAS_ATTRIBUTE(deprecated) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(3,1,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(4,1,0) || \ + JSON_HEDLEY_TI_VERSION_CHECK(15,12,0) || \ + (JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(4,8,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(5,2,0) || \ + (JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,4,0) || \ + (JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,3,0) || \ + (JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,2,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,5,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,1,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) || \ + JSON_HEDLEY_IAR_VERSION_CHECK(8,10,0) + #define JSON_HEDLEY_DEPRECATED(since) __attribute__((__deprecated__)) + #define JSON_HEDLEY_DEPRECATED_FOR(since, replacement) __attribute__((__deprecated__)) +#elif \ + JSON_HEDLEY_MSVC_VERSION_CHECK(13,10,0) || \ + JSON_HEDLEY_PELLES_VERSION_CHECK(6,50,0) || \ + JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) + #define JSON_HEDLEY_DEPRECATED(since) __declspec(deprecated) + #define JSON_HEDLEY_DEPRECATED_FOR(since, replacement) __declspec(deprecated) +#elif JSON_HEDLEY_IAR_VERSION_CHECK(8,0,0) + #define JSON_HEDLEY_DEPRECATED(since) _Pragma("deprecated") + #define JSON_HEDLEY_DEPRECATED_FOR(since, replacement) _Pragma("deprecated") +#else + #define JSON_HEDLEY_DEPRECATED(since) + #define JSON_HEDLEY_DEPRECATED_FOR(since, replacement) +#endif + +#if defined(JSON_HEDLEY_UNAVAILABLE) + #undef JSON_HEDLEY_UNAVAILABLE +#endif +#if \ + JSON_HEDLEY_HAS_ATTRIBUTE(warning) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(4,3,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_UNAVAILABLE(available_since) __attribute__((__warning__("Not available until " #available_since))) +#else + #define JSON_HEDLEY_UNAVAILABLE(available_since) +#endif + +#if defined(JSON_HEDLEY_WARN_UNUSED_RESULT) + #undef JSON_HEDLEY_WARN_UNUSED_RESULT +#endif +#if defined(JSON_HEDLEY_WARN_UNUSED_RESULT_MSG) + #undef JSON_HEDLEY_WARN_UNUSED_RESULT_MSG +#endif +#if \ + JSON_HEDLEY_HAS_ATTRIBUTE(warn_unused_result) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(3,4,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_TI_VERSION_CHECK(15,12,0) || \ + (JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(4,8,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(5,2,0) || \ + (JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,4,0) || \ + (JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,3,0) || \ + (JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,2,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,5,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,1,0) || \ + (JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,15,0) && defined(__cplusplus)) || \ + JSON_HEDLEY_PGI_VERSION_CHECK(17,10,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_WARN_UNUSED_RESULT __attribute__((__warn_unused_result__)) + #define JSON_HEDLEY_WARN_UNUSED_RESULT_MSG(msg) __attribute__((__warn_unused_result__)) +#elif (JSON_HEDLEY_HAS_CPP_ATTRIBUTE(nodiscard) >= 201907L) + #define JSON_HEDLEY_WARN_UNUSED_RESULT JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_([[nodiscard]]) + #define JSON_HEDLEY_WARN_UNUSED_RESULT_MSG(msg) JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_([[nodiscard(msg)]]) +#elif JSON_HEDLEY_HAS_CPP_ATTRIBUTE(nodiscard) + #define JSON_HEDLEY_WARN_UNUSED_RESULT JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_([[nodiscard]]) + #define JSON_HEDLEY_WARN_UNUSED_RESULT_MSG(msg) JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_([[nodiscard]]) +#elif defined(_Check_return_) /* SAL */ + #define JSON_HEDLEY_WARN_UNUSED_RESULT _Check_return_ + #define JSON_HEDLEY_WARN_UNUSED_RESULT_MSG(msg) _Check_return_ +#else + #define JSON_HEDLEY_WARN_UNUSED_RESULT + #define JSON_HEDLEY_WARN_UNUSED_RESULT_MSG(msg) +#endif + +#if defined(JSON_HEDLEY_SENTINEL) + #undef JSON_HEDLEY_SENTINEL +#endif +#if \ + JSON_HEDLEY_HAS_ATTRIBUTE(sentinel) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(4,0,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(5,4,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_SENTINEL(position) __attribute__((__sentinel__(position))) +#else + #define JSON_HEDLEY_SENTINEL(position) +#endif + +#if defined(JSON_HEDLEY_NO_RETURN) + #undef JSON_HEDLEY_NO_RETURN +#endif +#if JSON_HEDLEY_IAR_VERSION_CHECK(8,0,0) + #define JSON_HEDLEY_NO_RETURN __noreturn +#elif \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_NO_RETURN __attribute__((__noreturn__)) +#elif defined(__STDC_VERSION__) && __STDC_VERSION__ >= 201112L + #define JSON_HEDLEY_NO_RETURN _Noreturn +#elif defined(__cplusplus) && (__cplusplus >= 201103L) + #define JSON_HEDLEY_NO_RETURN JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_([[noreturn]]) +#elif \ + JSON_HEDLEY_HAS_ATTRIBUTE(noreturn) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(3,2,0) || \ + JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,11,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(4,1,0) || \ + JSON_HEDLEY_IBM_VERSION_CHECK(10,1,0) || \ + JSON_HEDLEY_TI_VERSION_CHECK(15,12,0) || \ + (JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(4,8,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(5,2,0) || \ + (JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,4,0) || \ + (JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,3,0) || \ + (JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,2,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,5,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,1,0) || \ + JSON_HEDLEY_IAR_VERSION_CHECK(8,10,0) + #define JSON_HEDLEY_NO_RETURN __attribute__((__noreturn__)) +#elif JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,10,0) + #define JSON_HEDLEY_NO_RETURN _Pragma("does_not_return") +#elif \ + JSON_HEDLEY_MSVC_VERSION_CHECK(13,10,0) || \ + JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) + #define JSON_HEDLEY_NO_RETURN __declspec(noreturn) +#elif JSON_HEDLEY_TI_CL6X_VERSION_CHECK(6,0,0) && defined(__cplusplus) + #define JSON_HEDLEY_NO_RETURN _Pragma("FUNC_NEVER_RETURNS;") +#elif JSON_HEDLEY_COMPCERT_VERSION_CHECK(3,2,0) + #define JSON_HEDLEY_NO_RETURN __attribute((noreturn)) +#elif JSON_HEDLEY_PELLES_VERSION_CHECK(9,0,0) + #define JSON_HEDLEY_NO_RETURN __declspec(noreturn) +#else + #define JSON_HEDLEY_NO_RETURN +#endif + +#if defined(JSON_HEDLEY_NO_ESCAPE) + #undef JSON_HEDLEY_NO_ESCAPE +#endif +#if JSON_HEDLEY_HAS_ATTRIBUTE(noescape) + #define JSON_HEDLEY_NO_ESCAPE __attribute__((__noescape__)) +#else + #define JSON_HEDLEY_NO_ESCAPE +#endif + +#if defined(JSON_HEDLEY_UNREACHABLE) + #undef JSON_HEDLEY_UNREACHABLE +#endif +#if defined(JSON_HEDLEY_UNREACHABLE_RETURN) + #undef JSON_HEDLEY_UNREACHABLE_RETURN +#endif +#if defined(JSON_HEDLEY_ASSUME) + #undef JSON_HEDLEY_ASSUME +#endif +#if \ + JSON_HEDLEY_MSVC_VERSION_CHECK(13,10,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) + #define JSON_HEDLEY_ASSUME(expr) __assume(expr) +#elif JSON_HEDLEY_HAS_BUILTIN(__builtin_assume) + #define JSON_HEDLEY_ASSUME(expr) __builtin_assume(expr) +#elif \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,2,0) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(4,0,0) + #if defined(__cplusplus) + #define JSON_HEDLEY_ASSUME(expr) std::_nassert(expr) + #else + #define JSON_HEDLEY_ASSUME(expr) _nassert(expr) + #endif +#endif +#if \ + (JSON_HEDLEY_HAS_BUILTIN(__builtin_unreachable) && (!defined(JSON_HEDLEY_ARM_VERSION))) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(4,5,0) || \ + JSON_HEDLEY_PGI_VERSION_CHECK(18,10,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_IBM_VERSION_CHECK(13,1,5) || \ + JSON_HEDLEY_CRAY_VERSION_CHECK(10,0,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_UNREACHABLE() __builtin_unreachable() +#elif defined(JSON_HEDLEY_ASSUME) + #define JSON_HEDLEY_UNREACHABLE() JSON_HEDLEY_ASSUME(0) +#endif +#if !defined(JSON_HEDLEY_ASSUME) + #if defined(JSON_HEDLEY_UNREACHABLE) + #define JSON_HEDLEY_ASSUME(expr) JSON_HEDLEY_STATIC_CAST(void, ((expr) ? 1 : (JSON_HEDLEY_UNREACHABLE(), 1))) + #else + #define JSON_HEDLEY_ASSUME(expr) JSON_HEDLEY_STATIC_CAST(void, expr) + #endif +#endif +#if defined(JSON_HEDLEY_UNREACHABLE) + #if \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,2,0) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(4,0,0) + #define JSON_HEDLEY_UNREACHABLE_RETURN(value) return (JSON_HEDLEY_STATIC_CAST(void, JSON_HEDLEY_ASSUME(0)), (value)) + #else + #define JSON_HEDLEY_UNREACHABLE_RETURN(value) JSON_HEDLEY_UNREACHABLE() + #endif +#else + #define JSON_HEDLEY_UNREACHABLE_RETURN(value) return (value) +#endif +#if !defined(JSON_HEDLEY_UNREACHABLE) + #define JSON_HEDLEY_UNREACHABLE() JSON_HEDLEY_ASSUME(0) +#endif + +JSON_HEDLEY_DIAGNOSTIC_PUSH +#if JSON_HEDLEY_HAS_WARNING("-Wpedantic") + #pragma clang diagnostic ignored "-Wpedantic" +#endif +#if JSON_HEDLEY_HAS_WARNING("-Wc++98-compat-pedantic") && defined(__cplusplus) + #pragma clang diagnostic ignored "-Wc++98-compat-pedantic" +#endif +#if JSON_HEDLEY_GCC_HAS_WARNING("-Wvariadic-macros",4,0,0) + #if defined(__clang__) + #pragma clang diagnostic ignored "-Wvariadic-macros" + #elif defined(JSON_HEDLEY_GCC_VERSION) + #pragma GCC diagnostic ignored "-Wvariadic-macros" + #endif +#endif +#if defined(JSON_HEDLEY_NON_NULL) + #undef JSON_HEDLEY_NON_NULL +#endif +#if \ + JSON_HEDLEY_HAS_ATTRIBUTE(nonnull) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(3,3,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(4,1,0) + #define JSON_HEDLEY_NON_NULL(...) __attribute__((__nonnull__(__VA_ARGS__))) +#else + #define JSON_HEDLEY_NON_NULL(...) +#endif +JSON_HEDLEY_DIAGNOSTIC_POP + +#if defined(JSON_HEDLEY_PRINTF_FORMAT) + #undef JSON_HEDLEY_PRINTF_FORMAT +#endif +#if defined(__MINGW32__) && JSON_HEDLEY_GCC_HAS_ATTRIBUTE(format,4,4,0) && !defined(__USE_MINGW_ANSI_STDIO) + #define JSON_HEDLEY_PRINTF_FORMAT(string_idx,first_to_check) __attribute__((__format__(ms_printf, string_idx, first_to_check))) +#elif defined(__MINGW32__) && JSON_HEDLEY_GCC_HAS_ATTRIBUTE(format,4,4,0) && defined(__USE_MINGW_ANSI_STDIO) + #define JSON_HEDLEY_PRINTF_FORMAT(string_idx,first_to_check) __attribute__((__format__(gnu_printf, string_idx, first_to_check))) +#elif \ + JSON_HEDLEY_HAS_ATTRIBUTE(format) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(3,1,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(5,6,0) || \ + JSON_HEDLEY_IBM_VERSION_CHECK(10,1,0) || \ + JSON_HEDLEY_TI_VERSION_CHECK(15,12,0) || \ + (JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(4,8,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(5,2,0) || \ + (JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,4,0) || \ + (JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,3,0) || \ + (JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,2,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,5,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,1,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_PRINTF_FORMAT(string_idx,first_to_check) __attribute__((__format__(__printf__, string_idx, first_to_check))) +#elif JSON_HEDLEY_PELLES_VERSION_CHECK(6,0,0) + #define JSON_HEDLEY_PRINTF_FORMAT(string_idx,first_to_check) __declspec(vaformat(printf,string_idx,first_to_check)) +#else + #define JSON_HEDLEY_PRINTF_FORMAT(string_idx,first_to_check) +#endif + +#if defined(JSON_HEDLEY_CONSTEXPR) + #undef JSON_HEDLEY_CONSTEXPR +#endif +#if defined(__cplusplus) + #if __cplusplus >= 201103L + #define JSON_HEDLEY_CONSTEXPR JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_(constexpr) + #endif +#endif +#if !defined(JSON_HEDLEY_CONSTEXPR) + #define JSON_HEDLEY_CONSTEXPR +#endif + +#if defined(JSON_HEDLEY_PREDICT) + #undef JSON_HEDLEY_PREDICT +#endif +#if defined(JSON_HEDLEY_LIKELY) + #undef JSON_HEDLEY_LIKELY +#endif +#if defined(JSON_HEDLEY_UNLIKELY) + #undef JSON_HEDLEY_UNLIKELY +#endif +#if defined(JSON_HEDLEY_UNPREDICTABLE) + #undef JSON_HEDLEY_UNPREDICTABLE +#endif +#if JSON_HEDLEY_HAS_BUILTIN(__builtin_unpredictable) + #define JSON_HEDLEY_UNPREDICTABLE(expr) __builtin_unpredictable((expr)) +#endif +#if \ + (JSON_HEDLEY_HAS_BUILTIN(__builtin_expect_with_probability) && !defined(JSON_HEDLEY_PGI_VERSION)) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(9,0,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) +# define JSON_HEDLEY_PREDICT(expr, value, probability) __builtin_expect_with_probability( (expr), (value), (probability)) +# define JSON_HEDLEY_PREDICT_TRUE(expr, probability) __builtin_expect_with_probability(!!(expr), 1 , (probability)) +# define JSON_HEDLEY_PREDICT_FALSE(expr, probability) __builtin_expect_with_probability(!!(expr), 0 , (probability)) +# define JSON_HEDLEY_LIKELY(expr) __builtin_expect (!!(expr), 1 ) +# define JSON_HEDLEY_UNLIKELY(expr) __builtin_expect (!!(expr), 0 ) +#elif \ + (JSON_HEDLEY_HAS_BUILTIN(__builtin_expect) && !defined(JSON_HEDLEY_INTEL_CL_VERSION)) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(3,0,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + (JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,15,0) && defined(__cplusplus)) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(4,1,0) || \ + JSON_HEDLEY_IBM_VERSION_CHECK(10,1,0) || \ + JSON_HEDLEY_TI_VERSION_CHECK(15,12,0) || \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(4,7,0) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(3,1,0) || \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,1,0) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(6,1,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,1,0) || \ + JSON_HEDLEY_TINYC_VERSION_CHECK(0,9,27) || \ + JSON_HEDLEY_CRAY_VERSION_CHECK(8,1,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) +# define JSON_HEDLEY_PREDICT(expr, expected, probability) \ + (((probability) >= 0.9) ? __builtin_expect((expr), (expected)) : (JSON_HEDLEY_STATIC_CAST(void, expected), (expr))) +# define JSON_HEDLEY_PREDICT_TRUE(expr, probability) \ + (__extension__ ({ \ + double hedley_probability_ = (probability); \ + ((hedley_probability_ >= 0.9) ? __builtin_expect(!!(expr), 1) : ((hedley_probability_ <= 0.1) ? __builtin_expect(!!(expr), 0) : !!(expr))); \ + })) +# define JSON_HEDLEY_PREDICT_FALSE(expr, probability) \ + (__extension__ ({ \ + double hedley_probability_ = (probability); \ + ((hedley_probability_ >= 0.9) ? __builtin_expect(!!(expr), 0) : ((hedley_probability_ <= 0.1) ? __builtin_expect(!!(expr), 1) : !!(expr))); \ + })) +# define JSON_HEDLEY_LIKELY(expr) __builtin_expect(!!(expr), 1) +# define JSON_HEDLEY_UNLIKELY(expr) __builtin_expect(!!(expr), 0) +#else +# define JSON_HEDLEY_PREDICT(expr, expected, probability) (JSON_HEDLEY_STATIC_CAST(void, expected), (expr)) +# define JSON_HEDLEY_PREDICT_TRUE(expr, probability) (!!(expr)) +# define JSON_HEDLEY_PREDICT_FALSE(expr, probability) (!!(expr)) +# define JSON_HEDLEY_LIKELY(expr) (!!(expr)) +# define JSON_HEDLEY_UNLIKELY(expr) (!!(expr)) +#endif +#if !defined(JSON_HEDLEY_UNPREDICTABLE) + #define JSON_HEDLEY_UNPREDICTABLE(expr) JSON_HEDLEY_PREDICT(expr, 1, 0.5) +#endif + +#if defined(JSON_HEDLEY_MALLOC) + #undef JSON_HEDLEY_MALLOC +#endif +#if \ + JSON_HEDLEY_HAS_ATTRIBUTE(malloc) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(3,1,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,11,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(4,1,0) || \ + JSON_HEDLEY_IBM_VERSION_CHECK(12,1,0) || \ + JSON_HEDLEY_TI_VERSION_CHECK(15,12,0) || \ + (JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(4,8,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(5,2,0) || \ + (JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,4,0) || \ + (JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,3,0) || \ + (JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,2,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,5,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,1,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_MALLOC __attribute__((__malloc__)) +#elif JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,10,0) + #define JSON_HEDLEY_MALLOC _Pragma("returns_new_memory") +#elif \ + JSON_HEDLEY_MSVC_VERSION_CHECK(14,0,0) || \ + JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) + #define JSON_HEDLEY_MALLOC __declspec(restrict) +#else + #define JSON_HEDLEY_MALLOC +#endif + +#if defined(JSON_HEDLEY_PURE) + #undef JSON_HEDLEY_PURE +#endif +#if \ + JSON_HEDLEY_HAS_ATTRIBUTE(pure) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(2,96,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,11,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(4,1,0) || \ + JSON_HEDLEY_IBM_VERSION_CHECK(10,1,0) || \ + JSON_HEDLEY_TI_VERSION_CHECK(15,12,0) || \ + (JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(4,8,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(5,2,0) || \ + (JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,4,0) || \ + (JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,3,0) || \ + (JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,2,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,5,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,1,0) || \ + JSON_HEDLEY_PGI_VERSION_CHECK(17,10,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) +# define JSON_HEDLEY_PURE __attribute__((__pure__)) +#elif JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,10,0) +# define JSON_HEDLEY_PURE _Pragma("does_not_write_global_data") +#elif defined(__cplusplus) && \ + ( \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(2,0,1) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(4,0,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) \ + ) +# define JSON_HEDLEY_PURE _Pragma("FUNC_IS_PURE;") +#else +# define JSON_HEDLEY_PURE +#endif + +#if defined(JSON_HEDLEY_CONST) + #undef JSON_HEDLEY_CONST +#endif +#if \ + JSON_HEDLEY_HAS_ATTRIBUTE(const) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(2,5,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,11,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(4,1,0) || \ + JSON_HEDLEY_IBM_VERSION_CHECK(10,1,0) || \ + JSON_HEDLEY_TI_VERSION_CHECK(15,12,0) || \ + (JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(4,8,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(5,2,0) || \ + (JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,4,0) || \ + (JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,3,0) || \ + (JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,2,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,5,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,1,0) || \ + JSON_HEDLEY_PGI_VERSION_CHECK(17,10,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_CONST __attribute__((__const__)) +#elif \ + JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,10,0) + #define JSON_HEDLEY_CONST _Pragma("no_side_effect") +#else + #define JSON_HEDLEY_CONST JSON_HEDLEY_PURE +#endif + +#if defined(JSON_HEDLEY_RESTRICT) + #undef JSON_HEDLEY_RESTRICT +#endif +#if defined(__STDC_VERSION__) && (__STDC_VERSION__ >= 199901L) && !defined(__cplusplus) + #define JSON_HEDLEY_RESTRICT restrict +#elif \ + JSON_HEDLEY_GCC_VERSION_CHECK(3,1,0) || \ + JSON_HEDLEY_MSVC_VERSION_CHECK(14,0,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(4,1,0) || \ + JSON_HEDLEY_IBM_VERSION_CHECK(10,1,0) || \ + JSON_HEDLEY_PGI_VERSION_CHECK(17,10,0) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,3,0) || \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,2,4) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(8,1,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + (JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,14,0) && defined(__cplusplus)) || \ + JSON_HEDLEY_IAR_VERSION_CHECK(8,0,0) || \ + defined(__clang__) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_RESTRICT __restrict +#elif JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,3,0) && !defined(__cplusplus) + #define JSON_HEDLEY_RESTRICT _Restrict +#else + #define JSON_HEDLEY_RESTRICT +#endif + +#if defined(JSON_HEDLEY_INLINE) + #undef JSON_HEDLEY_INLINE +#endif +#if \ + (defined(__STDC_VERSION__) && (__STDC_VERSION__ >= 199901L)) || \ + (defined(__cplusplus) && (__cplusplus >= 199711L)) + #define JSON_HEDLEY_INLINE inline +#elif \ + defined(JSON_HEDLEY_GCC_VERSION) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(6,2,0) + #define JSON_HEDLEY_INLINE __inline__ +#elif \ + JSON_HEDLEY_MSVC_VERSION_CHECK(12,0,0) || \ + JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(4,1,0) || \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(5,1,0) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(3,1,0) || \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,2,0) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(8,0,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,1,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_INLINE __inline +#else + #define JSON_HEDLEY_INLINE +#endif + +#if defined(JSON_HEDLEY_ALWAYS_INLINE) + #undef JSON_HEDLEY_ALWAYS_INLINE +#endif +#if \ + JSON_HEDLEY_HAS_ATTRIBUTE(always_inline) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(4,0,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,11,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(4,1,0) || \ + JSON_HEDLEY_IBM_VERSION_CHECK(10,1,0) || \ + JSON_HEDLEY_TI_VERSION_CHECK(15,12,0) || \ + (JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(4,8,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(5,2,0) || \ + (JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,4,0) || \ + (JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,3,0) || \ + (JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,2,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,5,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,1,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) || \ + JSON_HEDLEY_IAR_VERSION_CHECK(8,10,0) +# define JSON_HEDLEY_ALWAYS_INLINE __attribute__((__always_inline__)) JSON_HEDLEY_INLINE +#elif \ + JSON_HEDLEY_MSVC_VERSION_CHECK(12,0,0) || \ + JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) +# define JSON_HEDLEY_ALWAYS_INLINE __forceinline +#elif defined(__cplusplus) && \ + ( \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(5,2,0) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,3,0) || \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,4,0) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(6,1,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,1,0) \ + ) +# define JSON_HEDLEY_ALWAYS_INLINE _Pragma("FUNC_ALWAYS_INLINE;") +#elif JSON_HEDLEY_IAR_VERSION_CHECK(8,0,0) +# define JSON_HEDLEY_ALWAYS_INLINE _Pragma("inline=forced") +#else +# define JSON_HEDLEY_ALWAYS_INLINE JSON_HEDLEY_INLINE +#endif + +#if defined(JSON_HEDLEY_NEVER_INLINE) + #undef JSON_HEDLEY_NEVER_INLINE +#endif +#if \ + JSON_HEDLEY_HAS_ATTRIBUTE(noinline) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(4,0,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,11,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(4,1,0) || \ + JSON_HEDLEY_IBM_VERSION_CHECK(10,1,0) || \ + JSON_HEDLEY_TI_VERSION_CHECK(15,12,0) || \ + (JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(4,8,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_ARMCL_VERSION_CHECK(5,2,0) || \ + (JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL2000_VERSION_CHECK(6,4,0) || \ + (JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,0,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(4,3,0) || \ + (JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,2,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,5,0) || \ + JSON_HEDLEY_TI_CL7X_VERSION_CHECK(1,2,0) || \ + JSON_HEDLEY_TI_CLPRU_VERSION_CHECK(2,1,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) || \ + JSON_HEDLEY_IAR_VERSION_CHECK(8,10,0) + #define JSON_HEDLEY_NEVER_INLINE __attribute__((__noinline__)) +#elif \ + JSON_HEDLEY_MSVC_VERSION_CHECK(13,10,0) || \ + JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) + #define JSON_HEDLEY_NEVER_INLINE __declspec(noinline) +#elif JSON_HEDLEY_PGI_VERSION_CHECK(10,2,0) + #define JSON_HEDLEY_NEVER_INLINE _Pragma("noinline") +#elif JSON_HEDLEY_TI_CL6X_VERSION_CHECK(6,0,0) && defined(__cplusplus) + #define JSON_HEDLEY_NEVER_INLINE _Pragma("FUNC_CANNOT_INLINE;") +#elif JSON_HEDLEY_IAR_VERSION_CHECK(8,0,0) + #define JSON_HEDLEY_NEVER_INLINE _Pragma("inline=never") +#elif JSON_HEDLEY_COMPCERT_VERSION_CHECK(3,2,0) + #define JSON_HEDLEY_NEVER_INLINE __attribute((noinline)) +#elif JSON_HEDLEY_PELLES_VERSION_CHECK(9,0,0) + #define JSON_HEDLEY_NEVER_INLINE __declspec(noinline) +#else + #define JSON_HEDLEY_NEVER_INLINE +#endif + +#if defined(JSON_HEDLEY_PRIVATE) + #undef JSON_HEDLEY_PRIVATE +#endif +#if defined(JSON_HEDLEY_PUBLIC) + #undef JSON_HEDLEY_PUBLIC +#endif +#if defined(JSON_HEDLEY_IMPORT) + #undef JSON_HEDLEY_IMPORT +#endif +#if defined(_WIN32) || defined(__CYGWIN__) +# define JSON_HEDLEY_PRIVATE +# define JSON_HEDLEY_PUBLIC __declspec(dllexport) +# define JSON_HEDLEY_IMPORT __declspec(dllimport) +#else +# if \ + JSON_HEDLEY_HAS_ATTRIBUTE(visibility) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(3,3,0) || \ + JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,11,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(4,1,0) || \ + JSON_HEDLEY_IBM_VERSION_CHECK(13,1,0) || \ + ( \ + defined(__TI_EABI__) && \ + ( \ + (JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,2,0) && defined(__TI_GNU_ATTRIBUTE_SUPPORT__)) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(7,5,0) \ + ) \ + ) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) +# define JSON_HEDLEY_PRIVATE __attribute__((__visibility__("hidden"))) +# define JSON_HEDLEY_PUBLIC __attribute__((__visibility__("default"))) +# else +# define JSON_HEDLEY_PRIVATE +# define JSON_HEDLEY_PUBLIC +# endif +# define JSON_HEDLEY_IMPORT extern +#endif + +#if defined(JSON_HEDLEY_NO_THROW) + #undef JSON_HEDLEY_NO_THROW +#endif +#if \ + JSON_HEDLEY_HAS_ATTRIBUTE(nothrow) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(3,3,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_NO_THROW __attribute__((__nothrow__)) +#elif \ + JSON_HEDLEY_MSVC_VERSION_CHECK(13,1,0) || \ + JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(4,1,0) + #define JSON_HEDLEY_NO_THROW __declspec(nothrow) +#else + #define JSON_HEDLEY_NO_THROW +#endif + +#if defined(JSON_HEDLEY_FALL_THROUGH) + #undef JSON_HEDLEY_FALL_THROUGH +#endif +#if \ + JSON_HEDLEY_HAS_ATTRIBUTE(fallthrough) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(7,0,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_FALL_THROUGH __attribute__((__fallthrough__)) +#elif JSON_HEDLEY_HAS_CPP_ATTRIBUTE_NS(clang,fallthrough) + #define JSON_HEDLEY_FALL_THROUGH JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_([[clang::fallthrough]]) +#elif JSON_HEDLEY_HAS_CPP_ATTRIBUTE(fallthrough) + #define JSON_HEDLEY_FALL_THROUGH JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_([[fallthrough]]) +#elif defined(__fallthrough) /* SAL */ + #define JSON_HEDLEY_FALL_THROUGH __fallthrough +#else + #define JSON_HEDLEY_FALL_THROUGH +#endif + +#if defined(JSON_HEDLEY_RETURNS_NON_NULL) + #undef JSON_HEDLEY_RETURNS_NON_NULL +#endif +#if \ + JSON_HEDLEY_HAS_ATTRIBUTE(returns_nonnull) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(4,9,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_RETURNS_NON_NULL __attribute__((__returns_nonnull__)) +#elif defined(_Ret_notnull_) /* SAL */ + #define JSON_HEDLEY_RETURNS_NON_NULL _Ret_notnull_ +#else + #define JSON_HEDLEY_RETURNS_NON_NULL +#endif + +#if defined(JSON_HEDLEY_ARRAY_PARAM) + #undef JSON_HEDLEY_ARRAY_PARAM +#endif +#if \ + defined(__STDC_VERSION__) && (__STDC_VERSION__ >= 199901L) && \ + !defined(__STDC_NO_VLA__) && \ + !defined(__cplusplus) && \ + !defined(JSON_HEDLEY_PGI_VERSION) && \ + !defined(JSON_HEDLEY_TINYC_VERSION) + #define JSON_HEDLEY_ARRAY_PARAM(name) (name) +#else + #define JSON_HEDLEY_ARRAY_PARAM(name) +#endif + +#if defined(JSON_HEDLEY_IS_CONSTANT) + #undef JSON_HEDLEY_IS_CONSTANT +#endif +#if defined(JSON_HEDLEY_REQUIRE_CONSTEXPR) + #undef JSON_HEDLEY_REQUIRE_CONSTEXPR +#endif +/* JSON_HEDLEY_IS_CONSTEXPR_ is for + HEDLEY INTERNAL USE ONLY. API subject to change without notice. */ +#if defined(JSON_HEDLEY_IS_CONSTEXPR_) + #undef JSON_HEDLEY_IS_CONSTEXPR_ +#endif +#if \ + JSON_HEDLEY_HAS_BUILTIN(__builtin_constant_p) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(3,4,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_TINYC_VERSION_CHECK(0,9,19) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(4,1,0) || \ + JSON_HEDLEY_IBM_VERSION_CHECK(13,1,0) || \ + JSON_HEDLEY_TI_CL6X_VERSION_CHECK(6,1,0) || \ + (JSON_HEDLEY_SUNPRO_VERSION_CHECK(5,10,0) && !defined(__cplusplus)) || \ + JSON_HEDLEY_CRAY_VERSION_CHECK(8,1,0) || \ + JSON_HEDLEY_MCST_LCC_VERSION_CHECK(1,25,10) + #define JSON_HEDLEY_IS_CONSTANT(expr) __builtin_constant_p(expr) +#endif +#if !defined(__cplusplus) +# if \ + JSON_HEDLEY_HAS_BUILTIN(__builtin_types_compatible_p) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(3,4,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + JSON_HEDLEY_IBM_VERSION_CHECK(13,1,0) || \ + JSON_HEDLEY_CRAY_VERSION_CHECK(8,1,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(5,4,0) || \ + JSON_HEDLEY_TINYC_VERSION_CHECK(0,9,24) +#if defined(__INTPTR_TYPE__) + #define JSON_HEDLEY_IS_CONSTEXPR_(expr) __builtin_types_compatible_p(__typeof__((1 ? (void*) ((__INTPTR_TYPE__) ((expr) * 0)) : (int*) 0)), int*) +#else + #include + #define JSON_HEDLEY_IS_CONSTEXPR_(expr) __builtin_types_compatible_p(__typeof__((1 ? (void*) ((intptr_t) ((expr) * 0)) : (int*) 0)), int*) +#endif +# elif \ + ( \ + defined(__STDC_VERSION__) && (__STDC_VERSION__ >= 201112L) && \ + !defined(JSON_HEDLEY_SUNPRO_VERSION) && \ + !defined(JSON_HEDLEY_PGI_VERSION) && \ + !defined(JSON_HEDLEY_IAR_VERSION)) || \ + (JSON_HEDLEY_HAS_EXTENSION(c_generic_selections) && !defined(JSON_HEDLEY_IAR_VERSION)) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(4,9,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(17,0,0) || \ + JSON_HEDLEY_IBM_VERSION_CHECK(12,1,0) || \ + JSON_HEDLEY_ARM_VERSION_CHECK(5,3,0) +#if defined(__INTPTR_TYPE__) + #define JSON_HEDLEY_IS_CONSTEXPR_(expr) _Generic((1 ? (void*) ((__INTPTR_TYPE__) ((expr) * 0)) : (int*) 0), int*: 1, void*: 0) +#else + #include + #define JSON_HEDLEY_IS_CONSTEXPR_(expr) _Generic((1 ? (void*) ((intptr_t) * 0) : (int*) 0), int*: 1, void*: 0) +#endif +# elif \ + defined(JSON_HEDLEY_GCC_VERSION) || \ + defined(JSON_HEDLEY_INTEL_VERSION) || \ + defined(JSON_HEDLEY_TINYC_VERSION) || \ + defined(JSON_HEDLEY_TI_ARMCL_VERSION) || \ + JSON_HEDLEY_TI_CL430_VERSION_CHECK(18,12,0) || \ + defined(JSON_HEDLEY_TI_CL2000_VERSION) || \ + defined(JSON_HEDLEY_TI_CL6X_VERSION) || \ + defined(JSON_HEDLEY_TI_CL7X_VERSION) || \ + defined(JSON_HEDLEY_TI_CLPRU_VERSION) || \ + defined(__clang__) +# define JSON_HEDLEY_IS_CONSTEXPR_(expr) ( \ + sizeof(void) != \ + sizeof(*( \ + 1 ? \ + ((void*) ((expr) * 0L) ) : \ +((struct { char v[sizeof(void) * 2]; } *) 1) \ + ) \ + ) \ + ) +# endif +#endif +#if defined(JSON_HEDLEY_IS_CONSTEXPR_) + #if !defined(JSON_HEDLEY_IS_CONSTANT) + #define JSON_HEDLEY_IS_CONSTANT(expr) JSON_HEDLEY_IS_CONSTEXPR_(expr) + #endif + #define JSON_HEDLEY_REQUIRE_CONSTEXPR(expr) (JSON_HEDLEY_IS_CONSTEXPR_(expr) ? (expr) : (-1)) +#else + #if !defined(JSON_HEDLEY_IS_CONSTANT) + #define JSON_HEDLEY_IS_CONSTANT(expr) (0) + #endif + #define JSON_HEDLEY_REQUIRE_CONSTEXPR(expr) (expr) +#endif + +#if defined(JSON_HEDLEY_BEGIN_C_DECLS) + #undef JSON_HEDLEY_BEGIN_C_DECLS +#endif +#if defined(JSON_HEDLEY_END_C_DECLS) + #undef JSON_HEDLEY_END_C_DECLS +#endif +#if defined(JSON_HEDLEY_C_DECL) + #undef JSON_HEDLEY_C_DECL +#endif +#if defined(__cplusplus) + #define JSON_HEDLEY_BEGIN_C_DECLS extern "C" { + #define JSON_HEDLEY_END_C_DECLS } + #define JSON_HEDLEY_C_DECL extern "C" +#else + #define JSON_HEDLEY_BEGIN_C_DECLS + #define JSON_HEDLEY_END_C_DECLS + #define JSON_HEDLEY_C_DECL +#endif + +#if defined(JSON_HEDLEY_STATIC_ASSERT) + #undef JSON_HEDLEY_STATIC_ASSERT +#endif +#if \ + !defined(__cplusplus) && ( \ + (defined(__STDC_VERSION__) && (__STDC_VERSION__ >= 201112L)) || \ + (JSON_HEDLEY_HAS_FEATURE(c_static_assert) && !defined(JSON_HEDLEY_INTEL_CL_VERSION)) || \ + JSON_HEDLEY_GCC_VERSION_CHECK(6,0,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) || \ + defined(_Static_assert) \ + ) +# define JSON_HEDLEY_STATIC_ASSERT(expr, message) _Static_assert(expr, message) +#elif \ + (defined(__cplusplus) && (__cplusplus >= 201103L)) || \ + JSON_HEDLEY_MSVC_VERSION_CHECK(16,0,0) || \ + JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) +# define JSON_HEDLEY_STATIC_ASSERT(expr, message) JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_(static_assert(expr, message)) +#else +# define JSON_HEDLEY_STATIC_ASSERT(expr, message) +#endif + +#if defined(JSON_HEDLEY_NULL) + #undef JSON_HEDLEY_NULL +#endif +#if defined(__cplusplus) + #if __cplusplus >= 201103L + #define JSON_HEDLEY_NULL JSON_HEDLEY_DIAGNOSTIC_DISABLE_CPP98_COMPAT_WRAP_(nullptr) + #elif defined(NULL) + #define JSON_HEDLEY_NULL NULL + #else + #define JSON_HEDLEY_NULL JSON_HEDLEY_STATIC_CAST(void*, 0) + #endif +#elif defined(NULL) + #define JSON_HEDLEY_NULL NULL +#else + #define JSON_HEDLEY_NULL ((void*) 0) +#endif + +#if defined(JSON_HEDLEY_MESSAGE) + #undef JSON_HEDLEY_MESSAGE +#endif +#if JSON_HEDLEY_HAS_WARNING("-Wunknown-pragmas") +# define JSON_HEDLEY_MESSAGE(msg) \ + JSON_HEDLEY_DIAGNOSTIC_PUSH \ + JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_PRAGMAS \ + JSON_HEDLEY_PRAGMA(message msg) \ + JSON_HEDLEY_DIAGNOSTIC_POP +#elif \ + JSON_HEDLEY_GCC_VERSION_CHECK(4,4,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) +# define JSON_HEDLEY_MESSAGE(msg) JSON_HEDLEY_PRAGMA(message msg) +#elif JSON_HEDLEY_CRAY_VERSION_CHECK(5,0,0) +# define JSON_HEDLEY_MESSAGE(msg) JSON_HEDLEY_PRAGMA(_CRI message msg) +#elif JSON_HEDLEY_IAR_VERSION_CHECK(8,0,0) +# define JSON_HEDLEY_MESSAGE(msg) JSON_HEDLEY_PRAGMA(message(msg)) +#elif JSON_HEDLEY_PELLES_VERSION_CHECK(2,0,0) +# define JSON_HEDLEY_MESSAGE(msg) JSON_HEDLEY_PRAGMA(message(msg)) +#else +# define JSON_HEDLEY_MESSAGE(msg) +#endif + +#if defined(JSON_HEDLEY_WARNING) + #undef JSON_HEDLEY_WARNING +#endif +#if JSON_HEDLEY_HAS_WARNING("-Wunknown-pragmas") +# define JSON_HEDLEY_WARNING(msg) \ + JSON_HEDLEY_DIAGNOSTIC_PUSH \ + JSON_HEDLEY_DIAGNOSTIC_DISABLE_UNKNOWN_PRAGMAS \ + JSON_HEDLEY_PRAGMA(clang warning msg) \ + JSON_HEDLEY_DIAGNOSTIC_POP +#elif \ + JSON_HEDLEY_GCC_VERSION_CHECK(4,8,0) || \ + JSON_HEDLEY_PGI_VERSION_CHECK(18,4,0) || \ + JSON_HEDLEY_INTEL_VERSION_CHECK(13,0,0) +# define JSON_HEDLEY_WARNING(msg) JSON_HEDLEY_PRAGMA(GCC warning msg) +#elif \ + JSON_HEDLEY_MSVC_VERSION_CHECK(15,0,0) || \ + JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) +# define JSON_HEDLEY_WARNING(msg) JSON_HEDLEY_PRAGMA(message(msg)) +#else +# define JSON_HEDLEY_WARNING(msg) JSON_HEDLEY_MESSAGE(msg) +#endif + +#if defined(JSON_HEDLEY_REQUIRE) + #undef JSON_HEDLEY_REQUIRE +#endif +#if defined(JSON_HEDLEY_REQUIRE_MSG) + #undef JSON_HEDLEY_REQUIRE_MSG +#endif +#if JSON_HEDLEY_HAS_ATTRIBUTE(diagnose_if) +# if JSON_HEDLEY_HAS_WARNING("-Wgcc-compat") +# define JSON_HEDLEY_REQUIRE(expr) \ + JSON_HEDLEY_DIAGNOSTIC_PUSH \ + _Pragma("clang diagnostic ignored \"-Wgcc-compat\"") \ + __attribute__((diagnose_if(!(expr), #expr, "error"))) \ + JSON_HEDLEY_DIAGNOSTIC_POP +# define JSON_HEDLEY_REQUIRE_MSG(expr,msg) \ + JSON_HEDLEY_DIAGNOSTIC_PUSH \ + _Pragma("clang diagnostic ignored \"-Wgcc-compat\"") \ + __attribute__((diagnose_if(!(expr), msg, "error"))) \ + JSON_HEDLEY_DIAGNOSTIC_POP +# else +# define JSON_HEDLEY_REQUIRE(expr) __attribute__((diagnose_if(!(expr), #expr, "error"))) +# define JSON_HEDLEY_REQUIRE_MSG(expr,msg) __attribute__((diagnose_if(!(expr), msg, "error"))) +# endif +#else +# define JSON_HEDLEY_REQUIRE(expr) +# define JSON_HEDLEY_REQUIRE_MSG(expr,msg) +#endif + +#if defined(JSON_HEDLEY_FLAGS) + #undef JSON_HEDLEY_FLAGS +#endif +#if JSON_HEDLEY_HAS_ATTRIBUTE(flag_enum) && (!defined(__cplusplus) || JSON_HEDLEY_HAS_WARNING("-Wbitfield-enum-conversion")) + #define JSON_HEDLEY_FLAGS __attribute__((__flag_enum__)) +#else + #define JSON_HEDLEY_FLAGS +#endif + +#if defined(JSON_HEDLEY_FLAGS_CAST) + #undef JSON_HEDLEY_FLAGS_CAST +#endif +#if JSON_HEDLEY_INTEL_VERSION_CHECK(19,0,0) +# define JSON_HEDLEY_FLAGS_CAST(T, expr) (__extension__ ({ \ + JSON_HEDLEY_DIAGNOSTIC_PUSH \ + _Pragma("warning(disable:188)") \ + ((T) (expr)); \ + JSON_HEDLEY_DIAGNOSTIC_POP \ + })) +#else +# define JSON_HEDLEY_FLAGS_CAST(T, expr) JSON_HEDLEY_STATIC_CAST(T, expr) +#endif + +#if defined(JSON_HEDLEY_EMPTY_BASES) + #undef JSON_HEDLEY_EMPTY_BASES +#endif +#if \ + (JSON_HEDLEY_MSVC_VERSION_CHECK(19,0,23918) && !JSON_HEDLEY_MSVC_VERSION_CHECK(20,0,0)) || \ + JSON_HEDLEY_INTEL_CL_VERSION_CHECK(2021,1,0) + #define JSON_HEDLEY_EMPTY_BASES __declspec(empty_bases) +#else + #define JSON_HEDLEY_EMPTY_BASES +#endif + +/* Remaining macros are deprecated. */ + +#if defined(JSON_HEDLEY_GCC_NOT_CLANG_VERSION_CHECK) + #undef JSON_HEDLEY_GCC_NOT_CLANG_VERSION_CHECK +#endif +#if defined(__clang__) + #define JSON_HEDLEY_GCC_NOT_CLANG_VERSION_CHECK(major,minor,patch) (0) +#else + #define JSON_HEDLEY_GCC_NOT_CLANG_VERSION_CHECK(major,minor,patch) JSON_HEDLEY_GCC_VERSION_CHECK(major,minor,patch) +#endif + +#if defined(JSON_HEDLEY_CLANG_HAS_ATTRIBUTE) + #undef JSON_HEDLEY_CLANG_HAS_ATTRIBUTE +#endif +#define JSON_HEDLEY_CLANG_HAS_ATTRIBUTE(attribute) JSON_HEDLEY_HAS_ATTRIBUTE(attribute) + +#if defined(JSON_HEDLEY_CLANG_HAS_CPP_ATTRIBUTE) + #undef JSON_HEDLEY_CLANG_HAS_CPP_ATTRIBUTE +#endif +#define JSON_HEDLEY_CLANG_HAS_CPP_ATTRIBUTE(attribute) JSON_HEDLEY_HAS_CPP_ATTRIBUTE(attribute) + +#if defined(JSON_HEDLEY_CLANG_HAS_BUILTIN) + #undef JSON_HEDLEY_CLANG_HAS_BUILTIN +#endif +#define JSON_HEDLEY_CLANG_HAS_BUILTIN(builtin) JSON_HEDLEY_HAS_BUILTIN(builtin) + +#if defined(JSON_HEDLEY_CLANG_HAS_FEATURE) + #undef JSON_HEDLEY_CLANG_HAS_FEATURE +#endif +#define JSON_HEDLEY_CLANG_HAS_FEATURE(feature) JSON_HEDLEY_HAS_FEATURE(feature) + +#if defined(JSON_HEDLEY_CLANG_HAS_EXTENSION) + #undef JSON_HEDLEY_CLANG_HAS_EXTENSION +#endif +#define JSON_HEDLEY_CLANG_HAS_EXTENSION(extension) JSON_HEDLEY_HAS_EXTENSION(extension) + +#if defined(JSON_HEDLEY_CLANG_HAS_DECLSPEC_DECLSPEC_ATTRIBUTE) + #undef JSON_HEDLEY_CLANG_HAS_DECLSPEC_DECLSPEC_ATTRIBUTE +#endif +#define JSON_HEDLEY_CLANG_HAS_DECLSPEC_ATTRIBUTE(attribute) JSON_HEDLEY_HAS_DECLSPEC_ATTRIBUTE(attribute) + +#if defined(JSON_HEDLEY_CLANG_HAS_WARNING) + #undef JSON_HEDLEY_CLANG_HAS_WARNING +#endif +#define JSON_HEDLEY_CLANG_HAS_WARNING(warning) JSON_HEDLEY_HAS_WARNING(warning) + +#endif /* !defined(JSON_HEDLEY_VERSION) || (JSON_HEDLEY_VERSION < X) */ + + +// This file contains all internal macro definitions (except those affecting ABI) +// You MUST include macro_unscope.hpp at the end of json.hpp to undef all of them + +// #include + + +// exclude unsupported compilers +#if !defined(JSON_SKIP_UNSUPPORTED_COMPILER_CHECK) + #if defined(__clang__) + #if (__clang_major__ * 10000 + __clang_minor__ * 100 + __clang_patchlevel__) < 30400 + #error "unsupported Clang version - see https://github.com/nlohmann/json#supported-compilers" + #endif + #elif defined(__GNUC__) && !(defined(__ICC) || defined(__INTEL_COMPILER)) + #if (__GNUC__ * 10000 + __GNUC_MINOR__ * 100 + __GNUC_PATCHLEVEL__) < 40800 + #error "unsupported GCC version - see https://github.com/nlohmann/json#supported-compilers" + #endif + #endif +#endif + +// C++ language standard detection +// if the user manually specified the used c++ version this is skipped +#if !defined(JSON_HAS_CPP_20) && !defined(JSON_HAS_CPP_17) && !defined(JSON_HAS_CPP_14) && !defined(JSON_HAS_CPP_11) + #if (defined(__cplusplus) && __cplusplus >= 202002L) || (defined(_MSVC_LANG) && _MSVC_LANG >= 202002L) + #define JSON_HAS_CPP_20 + #define JSON_HAS_CPP_17 + #define JSON_HAS_CPP_14 + #elif (defined(__cplusplus) && __cplusplus >= 201703L) || (defined(_HAS_CXX17) && _HAS_CXX17 == 1) // fix for issue #464 + #define JSON_HAS_CPP_17 + #define JSON_HAS_CPP_14 + #elif (defined(__cplusplus) && __cplusplus >= 201402L) || (defined(_HAS_CXX14) && _HAS_CXX14 == 1) + #define JSON_HAS_CPP_14 + #endif + // the cpp 11 flag is always specified because it is the minimal required version + #define JSON_HAS_CPP_11 +#endif + +#ifdef __has_include + #if __has_include() + #include + #endif +#endif + +#if !defined(JSON_HAS_FILESYSTEM) && !defined(JSON_HAS_EXPERIMENTAL_FILESYSTEM) + #ifdef JSON_HAS_CPP_17 + #if defined(__cpp_lib_filesystem) + #define JSON_HAS_FILESYSTEM 1 + #elif defined(__cpp_lib_experimental_filesystem) + #define JSON_HAS_EXPERIMENTAL_FILESYSTEM 1 + #elif !defined(__has_include) + #define JSON_HAS_EXPERIMENTAL_FILESYSTEM 1 + #elif __has_include() + #define JSON_HAS_FILESYSTEM 1 + #elif __has_include() + #define JSON_HAS_EXPERIMENTAL_FILESYSTEM 1 + #endif + + // std::filesystem does not work on MinGW GCC 8: https://sourceforge.net/p/mingw-w64/bugs/737/ + #if defined(__MINGW32__) && defined(__GNUC__) && __GNUC__ == 8 + #undef JSON_HAS_FILESYSTEM + #undef JSON_HAS_EXPERIMENTAL_FILESYSTEM + #endif + + // no filesystem support before GCC 8: https://en.cppreference.com/w/cpp/compiler_support + #if defined(__GNUC__) && !defined(__clang__) && __GNUC__ < 8 + #undef JSON_HAS_FILESYSTEM + #undef JSON_HAS_EXPERIMENTAL_FILESYSTEM + #endif + + // no filesystem support before Clang 7: https://en.cppreference.com/w/cpp/compiler_support + #if defined(__clang_major__) && __clang_major__ < 7 + #undef JSON_HAS_FILESYSTEM + #undef JSON_HAS_EXPERIMENTAL_FILESYSTEM + #endif + + // no filesystem support before MSVC 19.14: https://en.cppreference.com/w/cpp/compiler_support + #if defined(_MSC_VER) && _MSC_VER < 1914 + #undef JSON_HAS_FILESYSTEM + #undef JSON_HAS_EXPERIMENTAL_FILESYSTEM + #endif + + // no filesystem support before iOS 13 + #if defined(__IPHONE_OS_VERSION_MIN_REQUIRED) && __IPHONE_OS_VERSION_MIN_REQUIRED < 130000 + #undef JSON_HAS_FILESYSTEM + #undef JSON_HAS_EXPERIMENTAL_FILESYSTEM + #endif + + // no filesystem support before macOS Catalina + #if defined(__MAC_OS_X_VERSION_MIN_REQUIRED) && __MAC_OS_X_VERSION_MIN_REQUIRED < 101500 + #undef JSON_HAS_FILESYSTEM + #undef JSON_HAS_EXPERIMENTAL_FILESYSTEM + #endif + #endif +#endif + +#ifndef JSON_HAS_EXPERIMENTAL_FILESYSTEM + #define JSON_HAS_EXPERIMENTAL_FILESYSTEM 0 +#endif + +#ifndef JSON_HAS_FILESYSTEM + #define JSON_HAS_FILESYSTEM 0 +#endif + +#ifndef JSON_HAS_THREE_WAY_COMPARISON + #if defined(__cpp_impl_three_way_comparison) && __cpp_impl_three_way_comparison >= 201907L \ + && defined(__cpp_lib_three_way_comparison) && __cpp_lib_three_way_comparison >= 201907L + #define JSON_HAS_THREE_WAY_COMPARISON 1 + #else + #define JSON_HAS_THREE_WAY_COMPARISON 0 + #endif +#endif + +#ifndef JSON_HAS_RANGES + // ranges header shipping in GCC 11.1.0 (released 2021-04-27) has syntax error + #if defined(__GLIBCXX__) && __GLIBCXX__ == 20210427 + #define JSON_HAS_RANGES 0 + #elif defined(__cpp_lib_ranges) + #define JSON_HAS_RANGES 1 + #else + #define JSON_HAS_RANGES 0 + #endif +#endif + +#ifndef JSON_HAS_STATIC_RTTI + #if !defined(_HAS_STATIC_RTTI) || _HAS_STATIC_RTTI != 0 + #define JSON_HAS_STATIC_RTTI 1 + #else + #define JSON_HAS_STATIC_RTTI 0 + #endif +#endif + +#ifdef JSON_HAS_CPP_17 + #define JSON_INLINE_VARIABLE inline +#else + #define JSON_INLINE_VARIABLE +#endif + +#if JSON_HEDLEY_HAS_ATTRIBUTE(no_unique_address) + #define JSON_NO_UNIQUE_ADDRESS [[no_unique_address]] +#else + #define JSON_NO_UNIQUE_ADDRESS +#endif + +// disable documentation warnings on clang +#if defined(__clang__) + #pragma clang diagnostic push + #pragma clang diagnostic ignored "-Wdocumentation" + #pragma clang diagnostic ignored "-Wdocumentation-unknown-command" +#endif + +// allow disabling exceptions +#if (defined(__cpp_exceptions) || defined(__EXCEPTIONS) || defined(_CPPUNWIND)) && !defined(JSON_NOEXCEPTION) + #define JSON_THROW(exception) throw exception + #define JSON_TRY try + #define JSON_CATCH(exception) catch(exception) + #define JSON_INTERNAL_CATCH(exception) catch(exception) +#else + #include + #define JSON_THROW(exception) std::abort() + #define JSON_TRY if(true) + #define JSON_CATCH(exception) if(false) + #define JSON_INTERNAL_CATCH(exception) if(false) +#endif + +// override exception macros +#if defined(JSON_THROW_USER) + #undef JSON_THROW + #define JSON_THROW JSON_THROW_USER +#endif +#if defined(JSON_TRY_USER) + #undef JSON_TRY + #define JSON_TRY JSON_TRY_USER +#endif +#if defined(JSON_CATCH_USER) + #undef JSON_CATCH + #define JSON_CATCH JSON_CATCH_USER + #undef JSON_INTERNAL_CATCH + #define JSON_INTERNAL_CATCH JSON_CATCH_USER +#endif +#if defined(JSON_INTERNAL_CATCH_USER) + #undef JSON_INTERNAL_CATCH + #define JSON_INTERNAL_CATCH JSON_INTERNAL_CATCH_USER +#endif + +// allow overriding assert +#if !defined(JSON_ASSERT) + #include // assert + #define JSON_ASSERT(x) assert(x) +#endif + +// allow to access some private functions (needed by the test suite) +#if defined(JSON_TESTS_PRIVATE) + #define JSON_PRIVATE_UNLESS_TESTED public +#else + #define JSON_PRIVATE_UNLESS_TESTED private +#endif + +/*! +@brief macro to briefly define a mapping between an enum and JSON +@def NLOHMANN_JSON_SERIALIZE_ENUM +@since version 3.4.0 +*/ +#define NLOHMANN_JSON_SERIALIZE_ENUM(ENUM_TYPE, ...) \ + template \ + inline void to_json(BasicJsonType& j, const ENUM_TYPE& e) \ + { \ + static_assert(std::is_enum::value, #ENUM_TYPE " must be an enum!"); \ + static const std::pair m[] = __VA_ARGS__; \ + auto it = std::find_if(std::begin(m), std::end(m), \ + [e](const std::pair& ej_pair) -> bool \ + { \ + return ej_pair.first == e; \ + }); \ + j = ((it != std::end(m)) ? it : std::begin(m))->second; \ + } \ + template \ + inline void from_json(const BasicJsonType& j, ENUM_TYPE& e) \ + { \ + static_assert(std::is_enum::value, #ENUM_TYPE " must be an enum!"); \ + static const std::pair m[] = __VA_ARGS__; \ + auto it = std::find_if(std::begin(m), std::end(m), \ + [&j](const std::pair& ej_pair) -> bool \ + { \ + return ej_pair.second == j; \ + }); \ + e = ((it != std::end(m)) ? it : std::begin(m))->first; \ + } + +// Ugly macros to avoid uglier copy-paste when specializing basic_json. They +// may be removed in the future once the class is split. + +#define NLOHMANN_BASIC_JSON_TPL_DECLARATION \ + template class ObjectType, \ + template class ArrayType, \ + class StringType, class BooleanType, class NumberIntegerType, \ + class NumberUnsignedType, class NumberFloatType, \ + template class AllocatorType, \ + template class JSONSerializer, \ + class BinaryType, \ + class CustomBaseClass> + +#define NLOHMANN_BASIC_JSON_TPL \ + basic_json + +// Macros to simplify conversion from/to types + +#define NLOHMANN_JSON_EXPAND( x ) x +#define NLOHMANN_JSON_GET_MACRO(_1, _2, _3, _4, _5, _6, _7, _8, _9, _10, _11, _12, _13, _14, _15, _16, _17, _18, _19, _20, _21, _22, _23, _24, _25, _26, _27, _28, _29, _30, _31, _32, _33, _34, _35, _36, _37, _38, _39, _40, _41, _42, _43, _44, _45, _46, _47, _48, _49, _50, _51, _52, _53, _54, _55, _56, _57, _58, _59, _60, _61, _62, _63, _64, NAME,...) NAME +#define NLOHMANN_JSON_PASTE(...) NLOHMANN_JSON_EXPAND(NLOHMANN_JSON_GET_MACRO(__VA_ARGS__, \ + NLOHMANN_JSON_PASTE64, \ + NLOHMANN_JSON_PASTE63, \ + NLOHMANN_JSON_PASTE62, \ + NLOHMANN_JSON_PASTE61, \ + NLOHMANN_JSON_PASTE60, \ + NLOHMANN_JSON_PASTE59, \ + NLOHMANN_JSON_PASTE58, \ + NLOHMANN_JSON_PASTE57, \ + NLOHMANN_JSON_PASTE56, \ + NLOHMANN_JSON_PASTE55, \ + NLOHMANN_JSON_PASTE54, \ + NLOHMANN_JSON_PASTE53, \ + NLOHMANN_JSON_PASTE52, \ + NLOHMANN_JSON_PASTE51, \ + NLOHMANN_JSON_PASTE50, \ + NLOHMANN_JSON_PASTE49, \ + NLOHMANN_JSON_PASTE48, \ + NLOHMANN_JSON_PASTE47, \ + NLOHMANN_JSON_PASTE46, \ + NLOHMANN_JSON_PASTE45, \ + NLOHMANN_JSON_PASTE44, \ + NLOHMANN_JSON_PASTE43, \ + NLOHMANN_JSON_PASTE42, \ + NLOHMANN_JSON_PASTE41, \ + NLOHMANN_JSON_PASTE40, \ + NLOHMANN_JSON_PASTE39, \ + NLOHMANN_JSON_PASTE38, \ + NLOHMANN_JSON_PASTE37, \ + NLOHMANN_JSON_PASTE36, \ + NLOHMANN_JSON_PASTE35, \ + NLOHMANN_JSON_PASTE34, \ + NLOHMANN_JSON_PASTE33, \ + NLOHMANN_JSON_PASTE32, \ + NLOHMANN_JSON_PASTE31, \ + NLOHMANN_JSON_PASTE30, \ + NLOHMANN_JSON_PASTE29, \ + NLOHMANN_JSON_PASTE28, \ + NLOHMANN_JSON_PASTE27, \ + NLOHMANN_JSON_PASTE26, \ + NLOHMANN_JSON_PASTE25, \ + NLOHMANN_JSON_PASTE24, \ + NLOHMANN_JSON_PASTE23, \ + NLOHMANN_JSON_PASTE22, \ + NLOHMANN_JSON_PASTE21, \ + NLOHMANN_JSON_PASTE20, \ + NLOHMANN_JSON_PASTE19, \ + NLOHMANN_JSON_PASTE18, \ + NLOHMANN_JSON_PASTE17, \ + NLOHMANN_JSON_PASTE16, \ + NLOHMANN_JSON_PASTE15, \ + NLOHMANN_JSON_PASTE14, \ + NLOHMANN_JSON_PASTE13, \ + NLOHMANN_JSON_PASTE12, \ + NLOHMANN_JSON_PASTE11, \ + NLOHMANN_JSON_PASTE10, \ + NLOHMANN_JSON_PASTE9, \ + NLOHMANN_JSON_PASTE8, \ + NLOHMANN_JSON_PASTE7, \ + NLOHMANN_JSON_PASTE6, \ + NLOHMANN_JSON_PASTE5, \ + NLOHMANN_JSON_PASTE4, \ + NLOHMANN_JSON_PASTE3, \ + NLOHMANN_JSON_PASTE2, \ + NLOHMANN_JSON_PASTE1)(__VA_ARGS__)) +#define NLOHMANN_JSON_PASTE2(func, v1) func(v1) +#define NLOHMANN_JSON_PASTE3(func, v1, v2) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE2(func, v2) +#define NLOHMANN_JSON_PASTE4(func, v1, v2, v3) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE3(func, v2, v3) +#define NLOHMANN_JSON_PASTE5(func, v1, v2, v3, v4) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE4(func, v2, v3, v4) +#define NLOHMANN_JSON_PASTE6(func, v1, v2, v3, v4, v5) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE5(func, v2, v3, v4, v5) +#define NLOHMANN_JSON_PASTE7(func, v1, v2, v3, v4, v5, v6) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE6(func, v2, v3, v4, v5, v6) +#define NLOHMANN_JSON_PASTE8(func, v1, v2, v3, v4, v5, v6, v7) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE7(func, v2, v3, v4, v5, v6, v7) +#define NLOHMANN_JSON_PASTE9(func, v1, v2, v3, v4, v5, v6, v7, v8) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE8(func, v2, v3, v4, v5, v6, v7, v8) +#define NLOHMANN_JSON_PASTE10(func, v1, v2, v3, v4, v5, v6, v7, v8, v9) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE9(func, v2, v3, v4, v5, v6, v7, v8, v9) +#define NLOHMANN_JSON_PASTE11(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE10(func, v2, v3, v4, v5, v6, v7, v8, v9, v10) +#define NLOHMANN_JSON_PASTE12(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE11(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11) +#define NLOHMANN_JSON_PASTE13(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE12(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12) +#define NLOHMANN_JSON_PASTE14(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE13(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13) +#define NLOHMANN_JSON_PASTE15(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE14(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14) +#define NLOHMANN_JSON_PASTE16(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE15(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15) +#define NLOHMANN_JSON_PASTE17(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE16(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16) +#define NLOHMANN_JSON_PASTE18(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE17(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17) +#define NLOHMANN_JSON_PASTE19(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE18(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18) +#define NLOHMANN_JSON_PASTE20(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE19(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19) +#define NLOHMANN_JSON_PASTE21(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE20(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20) +#define NLOHMANN_JSON_PASTE22(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE21(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21) +#define NLOHMANN_JSON_PASTE23(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE22(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22) +#define NLOHMANN_JSON_PASTE24(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE23(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23) +#define NLOHMANN_JSON_PASTE25(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE24(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24) +#define NLOHMANN_JSON_PASTE26(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE25(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25) +#define NLOHMANN_JSON_PASTE27(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE26(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26) +#define NLOHMANN_JSON_PASTE28(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE27(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27) +#define NLOHMANN_JSON_PASTE29(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE28(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28) +#define NLOHMANN_JSON_PASTE30(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE29(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29) +#define NLOHMANN_JSON_PASTE31(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE30(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30) +#define NLOHMANN_JSON_PASTE32(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE31(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31) +#define NLOHMANN_JSON_PASTE33(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE32(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32) +#define NLOHMANN_JSON_PASTE34(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE33(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33) +#define NLOHMANN_JSON_PASTE35(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE34(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34) +#define NLOHMANN_JSON_PASTE36(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE35(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35) +#define NLOHMANN_JSON_PASTE37(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE36(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36) +#define NLOHMANN_JSON_PASTE38(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE37(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37) +#define NLOHMANN_JSON_PASTE39(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE38(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38) +#define NLOHMANN_JSON_PASTE40(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE39(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39) +#define NLOHMANN_JSON_PASTE41(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE40(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40) +#define NLOHMANN_JSON_PASTE42(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE41(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41) +#define NLOHMANN_JSON_PASTE43(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE42(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42) +#define NLOHMANN_JSON_PASTE44(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE43(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43) +#define NLOHMANN_JSON_PASTE45(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE44(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44) +#define NLOHMANN_JSON_PASTE46(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE45(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45) +#define NLOHMANN_JSON_PASTE47(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE46(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46) +#define NLOHMANN_JSON_PASTE48(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE47(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47) +#define NLOHMANN_JSON_PASTE49(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE48(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48) +#define NLOHMANN_JSON_PASTE50(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE49(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49) +#define NLOHMANN_JSON_PASTE51(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE50(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50) +#define NLOHMANN_JSON_PASTE52(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE51(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51) +#define NLOHMANN_JSON_PASTE53(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE52(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52) +#define NLOHMANN_JSON_PASTE54(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE53(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53) +#define NLOHMANN_JSON_PASTE55(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE54(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54) +#define NLOHMANN_JSON_PASTE56(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE55(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55) +#define NLOHMANN_JSON_PASTE57(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE56(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56) +#define NLOHMANN_JSON_PASTE58(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56, v57) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE57(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56, v57) +#define NLOHMANN_JSON_PASTE59(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56, v57, v58) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE58(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56, v57, v58) +#define NLOHMANN_JSON_PASTE60(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56, v57, v58, v59) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE59(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56, v57, v58, v59) +#define NLOHMANN_JSON_PASTE61(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56, v57, v58, v59, v60) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE60(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56, v57, v58, v59, v60) +#define NLOHMANN_JSON_PASTE62(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56, v57, v58, v59, v60, v61) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE61(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56, v57, v58, v59, v60, v61) +#define NLOHMANN_JSON_PASTE63(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56, v57, v58, v59, v60, v61, v62) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE62(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56, v57, v58, v59, v60, v61, v62) +#define NLOHMANN_JSON_PASTE64(func, v1, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56, v57, v58, v59, v60, v61, v62, v63) NLOHMANN_JSON_PASTE2(func, v1) NLOHMANN_JSON_PASTE63(func, v2, v3, v4, v5, v6, v7, v8, v9, v10, v11, v12, v13, v14, v15, v16, v17, v18, v19, v20, v21, v22, v23, v24, v25, v26, v27, v28, v29, v30, v31, v32, v33, v34, v35, v36, v37, v38, v39, v40, v41, v42, v43, v44, v45, v46, v47, v48, v49, v50, v51, v52, v53, v54, v55, v56, v57, v58, v59, v60, v61, v62, v63) + +#define NLOHMANN_JSON_TO(v1) nlohmann_json_j[#v1] = nlohmann_json_t.v1; +#define NLOHMANN_JSON_FROM(v1) nlohmann_json_j.at(#v1).get_to(nlohmann_json_t.v1); +#define NLOHMANN_JSON_FROM_WITH_DEFAULT(v1) nlohmann_json_t.v1 = nlohmann_json_j.value(#v1, nlohmann_json_default_obj.v1); + +/*! +@brief macro +@def NLOHMANN_DEFINE_TYPE_INTRUSIVE +@since version 3.9.0 +*/ +#define NLOHMANN_DEFINE_TYPE_INTRUSIVE(Type, ...) \ + friend void to_json(nlohmann::json& nlohmann_json_j, const Type& nlohmann_json_t) { NLOHMANN_JSON_EXPAND(NLOHMANN_JSON_PASTE(NLOHMANN_JSON_TO, __VA_ARGS__)) } \ + friend void from_json(const nlohmann::json& nlohmann_json_j, Type& nlohmann_json_t) { NLOHMANN_JSON_EXPAND(NLOHMANN_JSON_PASTE(NLOHMANN_JSON_FROM, __VA_ARGS__)) } + +#define NLOHMANN_DEFINE_TYPE_INTRUSIVE_WITH_DEFAULT(Type, ...) \ + friend void to_json(nlohmann::json& nlohmann_json_j, const Type& nlohmann_json_t) { NLOHMANN_JSON_EXPAND(NLOHMANN_JSON_PASTE(NLOHMANN_JSON_TO, __VA_ARGS__)) } \ + friend void from_json(const nlohmann::json& nlohmann_json_j, Type& nlohmann_json_t) { const Type nlohmann_json_default_obj{}; NLOHMANN_JSON_EXPAND(NLOHMANN_JSON_PASTE(NLOHMANN_JSON_FROM_WITH_DEFAULT, __VA_ARGS__)) } + +#define NLOHMANN_DEFINE_TYPE_INTRUSIVE_ONLY_SERIALIZE(Type, ...) \ + friend void to_json(nlohmann::json& nlohmann_json_j, const Type& nlohmann_json_t) { NLOHMANN_JSON_EXPAND(NLOHMANN_JSON_PASTE(NLOHMANN_JSON_TO, __VA_ARGS__)) } + +/*! +@brief macro +@def NLOHMANN_DEFINE_TYPE_NON_INTRUSIVE +@since version 3.9.0 +*/ +#define NLOHMANN_DEFINE_TYPE_NON_INTRUSIVE(Type, ...) \ + inline void to_json(nlohmann::json& nlohmann_json_j, const Type& nlohmann_json_t) { NLOHMANN_JSON_EXPAND(NLOHMANN_JSON_PASTE(NLOHMANN_JSON_TO, __VA_ARGS__)) } \ + inline void from_json(const nlohmann::json& nlohmann_json_j, Type& nlohmann_json_t) { NLOHMANN_JSON_EXPAND(NLOHMANN_JSON_PASTE(NLOHMANN_JSON_FROM, __VA_ARGS__)) } + +#define NLOHMANN_DEFINE_TYPE_NON_INTRUSIVE_ONLY_SERIALIZE(Type, ...) \ + inline void to_json(nlohmann::json& nlohmann_json_j, const Type& nlohmann_json_t) { NLOHMANN_JSON_EXPAND(NLOHMANN_JSON_PASTE(NLOHMANN_JSON_TO, __VA_ARGS__)) } + +#define NLOHMANN_DEFINE_TYPE_NON_INTRUSIVE_WITH_DEFAULT(Type, ...) \ + inline void to_json(nlohmann::json& nlohmann_json_j, const Type& nlohmann_json_t) { NLOHMANN_JSON_EXPAND(NLOHMANN_JSON_PASTE(NLOHMANN_JSON_TO, __VA_ARGS__)) } \ + inline void from_json(const nlohmann::json& nlohmann_json_j, Type& nlohmann_json_t) { const Type nlohmann_json_default_obj{}; NLOHMANN_JSON_EXPAND(NLOHMANN_JSON_PASTE(NLOHMANN_JSON_FROM_WITH_DEFAULT, __VA_ARGS__)) } + +// inspired from https://stackoverflow.com/a/26745591 +// allows to call any std function as if (e.g. with begin): +// using std::begin; begin(x); +// +// it allows using the detected idiom to retrieve the return type +// of such an expression +#define NLOHMANN_CAN_CALL_STD_FUNC_IMPL(std_name) \ + namespace detail { \ + using std::std_name; \ + \ + template \ + using result_of_##std_name = decltype(std_name(std::declval()...)); \ + } \ + \ + namespace detail2 { \ + struct std_name##_tag \ + { \ + }; \ + \ + template \ + std_name##_tag std_name(T&&...); \ + \ + template \ + using result_of_##std_name = decltype(std_name(std::declval()...)); \ + \ + template \ + struct would_call_std_##std_name \ + { \ + static constexpr auto const value = ::nlohmann::detail:: \ + is_detected_exact::value; \ + }; \ + } /* namespace detail2 */ \ + \ + template \ + struct would_call_std_##std_name : detail2::would_call_std_##std_name \ + { \ + } + +#ifndef JSON_USE_IMPLICIT_CONVERSIONS + #define JSON_USE_IMPLICIT_CONVERSIONS 1 +#endif + +#if JSON_USE_IMPLICIT_CONVERSIONS + #define JSON_EXPLICIT +#else + #define JSON_EXPLICIT explicit +#endif + +#ifndef JSON_DISABLE_ENUM_SERIALIZATION + #define JSON_DISABLE_ENUM_SERIALIZATION 0 +#endif + +#ifndef JSON_USE_GLOBAL_UDLS + #define JSON_USE_GLOBAL_UDLS 1 +#endif + +#if JSON_HAS_THREE_WAY_COMPARISON + #include // partial_ordering +#endif + +NLOHMANN_JSON_NAMESPACE_BEGIN +namespace detail +{ + +/////////////////////////// +// JSON type enumeration // +/////////////////////////// + +/*! +@brief the JSON type enumeration + +This enumeration collects the different JSON types. It is internally used to +distinguish the stored values, and the functions @ref basic_json::is_null(), +@ref basic_json::is_object(), @ref basic_json::is_array(), +@ref basic_json::is_string(), @ref basic_json::is_boolean(), +@ref basic_json::is_number() (with @ref basic_json::is_number_integer(), +@ref basic_json::is_number_unsigned(), and @ref basic_json::is_number_float()), +@ref basic_json::is_discarded(), @ref basic_json::is_primitive(), and +@ref basic_json::is_structured() rely on it. + +@note There are three enumeration entries (number_integer, number_unsigned, and +number_float), because the library distinguishes these three types for numbers: +@ref basic_json::number_unsigned_t is used for unsigned integers, +@ref basic_json::number_integer_t is used for signed integers, and +@ref basic_json::number_float_t is used for floating-point numbers or to +approximate integers which do not fit in the limits of their respective type. + +@sa see @ref basic_json::basic_json(const value_t value_type) -- create a JSON +value with the default value for a given type + +@since version 1.0.0 +*/ +enum class value_t : std::uint8_t +{ + null, ///< null value + object, ///< object (unordered set of name/value pairs) + array, ///< array (ordered collection of values) + string, ///< string value + boolean, ///< boolean value + number_integer, ///< number value (signed integer) + number_unsigned, ///< number value (unsigned integer) + number_float, ///< number value (floating-point) + binary, ///< binary array (ordered collection of bytes) + discarded ///< discarded by the parser callback function +}; + +/*! +@brief comparison operator for JSON types + +Returns an ordering that is similar to Python: +- order: null < boolean < number < object < array < string < binary +- furthermore, each type is not smaller than itself +- discarded values are not comparable +- binary is represented as a b"" string in python and directly comparable to a + string; however, making a binary array directly comparable with a string would + be surprising behavior in a JSON file. + +@since version 1.0.0 +*/ +#if JSON_HAS_THREE_WAY_COMPARISON + inline std::partial_ordering operator<=>(const value_t lhs, const value_t rhs) noexcept // *NOPAD* +#else + inline bool operator<(const value_t lhs, const value_t rhs) noexcept +#endif +{ + static constexpr std::array order = {{ + 0 /* null */, 3 /* object */, 4 /* array */, 5 /* string */, + 1 /* boolean */, 2 /* integer */, 2 /* unsigned */, 2 /* float */, + 6 /* binary */ + } + }; + + const auto l_index = static_cast(lhs); + const auto r_index = static_cast(rhs); +#if JSON_HAS_THREE_WAY_COMPARISON + if (l_index < order.size() && r_index < order.size()) + { + return order[l_index] <=> order[r_index]; // *NOPAD* + } + return std::partial_ordering::unordered; +#else + return l_index < order.size() && r_index < order.size() && order[l_index] < order[r_index]; +#endif +} + +// GCC selects the built-in operator< over an operator rewritten from +// a user-defined spaceship operator +// Clang, MSVC, and ICC select the rewritten candidate +// (see GCC bug https://gcc.gnu.org/bugzilla/show_bug.cgi?id=105200) +#if JSON_HAS_THREE_WAY_COMPARISON && defined(__GNUC__) +inline bool operator<(const value_t lhs, const value_t rhs) noexcept +{ + return std::is_lt(lhs <=> rhs); // *NOPAD* +} +#endif + +} // namespace detail +NLOHMANN_JSON_NAMESPACE_END + +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + + + +// #include + + +NLOHMANN_JSON_NAMESPACE_BEGIN +namespace detail +{ + +/*! +@brief replace all occurrences of a substring by another string + +@param[in,out] s the string to manipulate; changed so that all + occurrences of @a f are replaced with @a t +@param[in] f the substring to replace with @a t +@param[in] t the string to replace @a f + +@pre The search string @a f must not be empty. **This precondition is +enforced with an assertion.** + +@since version 2.0.0 +*/ +template +inline void replace_substring(StringType& s, const StringType& f, + const StringType& t) +{ + JSON_ASSERT(!f.empty()); + for (auto pos = s.find(f); // find first occurrence of f + pos != StringType::npos; // make sure f was found + s.replace(pos, f.size(), t), // replace with t, and + pos = s.find(f, pos + t.size())) // find next occurrence of f + {} +} + +/*! + * @brief string escaping as described in RFC 6901 (Sect. 4) + * @param[in] s string to escape + * @return escaped string + * + * Note the order of escaping "~" to "~0" and "/" to "~1" is important. + */ +template +inline StringType escape(StringType s) +{ + replace_substring(s, StringType{"~"}, StringType{"~0"}); + replace_substring(s, StringType{"/"}, StringType{"~1"}); + return s; +} + +/*! + * @brief string unescaping as described in RFC 6901 (Sect. 4) + * @param[in] s string to unescape + * @return unescaped string + * + * Note the order of escaping "~1" to "/" and "~0" to "~" is important. + */ +template +static void unescape(StringType& s) +{ + replace_substring(s, StringType{"~1"}, StringType{"/"}); + replace_substring(s, StringType{"~0"}, StringType{"~"}); +} + +} // namespace detail +NLOHMANN_JSON_NAMESPACE_END + +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + + + +#include // size_t + +// #include + + +NLOHMANN_JSON_NAMESPACE_BEGIN +namespace detail +{ + +/// struct to capture the start position of the current token +struct position_t +{ + /// the total number of characters read + std::size_t chars_read_total = 0; + /// the number of characters read in the current line + std::size_t chars_read_current_line = 0; + /// the number of lines read + std::size_t lines_read = 0; + + /// conversion to size_t to preserve SAX interface + constexpr operator size_t() const + { + return chars_read_total; + } +}; + +} // namespace detail +NLOHMANN_JSON_NAMESPACE_END + +// #include + +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-FileCopyrightText: 2018 The Abseil Authors +// SPDX-License-Identifier: MIT + + + +#include // array +#include // size_t +#include // conditional, enable_if, false_type, integral_constant, is_constructible, is_integral, is_same, remove_cv, remove_reference, true_type +#include // index_sequence, make_index_sequence, index_sequence_for + +// #include + + +NLOHMANN_JSON_NAMESPACE_BEGIN +namespace detail +{ + +template +using uncvref_t = typename std::remove_cv::type>::type; + +#ifdef JSON_HAS_CPP_14 + +// the following utilities are natively available in C++14 +using std::enable_if_t; +using std::index_sequence; +using std::make_index_sequence; +using std::index_sequence_for; + +#else + +// alias templates to reduce boilerplate +template +using enable_if_t = typename std::enable_if::type; + +// The following code is taken from https://github.com/abseil/abseil-cpp/blob/10cb35e459f5ecca5b2ff107635da0bfa41011b4/absl/utility/utility.h +// which is part of Google Abseil (https://github.com/abseil/abseil-cpp), licensed under the Apache License 2.0. + +//// START OF CODE FROM GOOGLE ABSEIL + +// integer_sequence +// +// Class template representing a compile-time integer sequence. An instantiation +// of `integer_sequence` has a sequence of integers encoded in its +// type through its template arguments (which is a common need when +// working with C++11 variadic templates). `absl::integer_sequence` is designed +// to be a drop-in replacement for C++14's `std::integer_sequence`. +// +// Example: +// +// template< class T, T... Ints > +// void user_function(integer_sequence); +// +// int main() +// { +// // user_function's `T` will be deduced to `int` and `Ints...` +// // will be deduced to `0, 1, 2, 3, 4`. +// user_function(make_integer_sequence()); +// } +template +struct integer_sequence +{ + using value_type = T; + static constexpr std::size_t size() noexcept + { + return sizeof...(Ints); + } +}; + +// index_sequence +// +// A helper template for an `integer_sequence` of `size_t`, +// `absl::index_sequence` is designed to be a drop-in replacement for C++14's +// `std::index_sequence`. +template +using index_sequence = integer_sequence; + +namespace utility_internal +{ + +template +struct Extend; + +// Note that SeqSize == sizeof...(Ints). It's passed explicitly for efficiency. +template +struct Extend, SeqSize, 0> +{ + using type = integer_sequence < T, Ints..., (Ints + SeqSize)... >; +}; + +template +struct Extend, SeqSize, 1> +{ + using type = integer_sequence < T, Ints..., (Ints + SeqSize)..., 2 * SeqSize >; +}; + +// Recursion helper for 'make_integer_sequence'. +// 'Gen::type' is an alias for 'integer_sequence'. +template +struct Gen +{ + using type = + typename Extend < typename Gen < T, N / 2 >::type, N / 2, N % 2 >::type; +}; + +template +struct Gen +{ + using type = integer_sequence; +}; + +} // namespace utility_internal + +// Compile-time sequences of integers + +// make_integer_sequence +// +// This template alias is equivalent to +// `integer_sequence`, and is designed to be a drop-in +// replacement for C++14's `std::make_integer_sequence`. +template +using make_integer_sequence = typename utility_internal::Gen::type; + +// make_index_sequence +// +// This template alias is equivalent to `index_sequence<0, 1, ..., N-1>`, +// and is designed to be a drop-in replacement for C++14's +// `std::make_index_sequence`. +template +using make_index_sequence = make_integer_sequence; + +// index_sequence_for +// +// Converts a typename pack into an index sequence of the same length, and +// is designed to be a drop-in replacement for C++14's +// `std::index_sequence_for()` +template +using index_sequence_for = make_index_sequence; + +//// END OF CODE FROM GOOGLE ABSEIL + +#endif + +// dispatch utility (taken from ranges-v3) +template struct priority_tag : priority_tag < N - 1 > {}; +template<> struct priority_tag<0> {}; + +// taken from ranges-v3 +template +struct static_const +{ + static JSON_INLINE_VARIABLE constexpr T value{}; +}; + +#ifndef JSON_HAS_CPP_17 + template + constexpr T static_const::value; +#endif + +template +inline constexpr std::array make_array(Args&& ... args) +{ + return std::array {{static_cast(std::forward(args))...}}; +} + +} // namespace detail +NLOHMANN_JSON_NAMESPACE_END + +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + + + +#include // numeric_limits +#include // false_type, is_constructible, is_integral, is_same, true_type +#include // declval +#include // tuple +#include // char_traits + +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + + + +#include // random_access_iterator_tag + +// #include + +// #include + +// #include + + +NLOHMANN_JSON_NAMESPACE_BEGIN +namespace detail +{ + +template +struct iterator_types {}; + +template +struct iterator_types < + It, + void_t> +{ + using difference_type = typename It::difference_type; + using value_type = typename It::value_type; + using pointer = typename It::pointer; + using reference = typename It::reference; + using iterator_category = typename It::iterator_category; +}; + +// This is required as some compilers implement std::iterator_traits in a way that +// doesn't work with SFINAE. See https://github.com/nlohmann/json/issues/1341. +template +struct iterator_traits +{ +}; + +template +struct iterator_traits < T, enable_if_t < !std::is_pointer::value >> + : iterator_types +{ +}; + +template +struct iterator_traits::value>> +{ + using iterator_category = std::random_access_iterator_tag; + using value_type = T; + using difference_type = ptrdiff_t; + using pointer = T*; + using reference = T&; +}; + +} // namespace detail +NLOHMANN_JSON_NAMESPACE_END + +// #include + +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + + + +// #include + + +NLOHMANN_JSON_NAMESPACE_BEGIN + +NLOHMANN_CAN_CALL_STD_FUNC_IMPL(begin); + +NLOHMANN_JSON_NAMESPACE_END + +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + + + +// #include + + +NLOHMANN_JSON_NAMESPACE_BEGIN + +NLOHMANN_CAN_CALL_STD_FUNC_IMPL(end); + +NLOHMANN_JSON_NAMESPACE_END + +// #include + +// #include + +// #include +// __ _____ _____ _____ +// __| | __| | | | JSON for Modern C++ +// | | |__ | | | | | | version 3.11.3 +// |_____|_____|_____|_|___| https://github.com/nlohmann/json +// +// SPDX-FileCopyrightText: 2013-2023 Niels Lohmann +// SPDX-License-Identifier: MIT + +#ifndef INCLUDE_NLOHMANN_JSON_FWD_HPP_ + #define INCLUDE_NLOHMANN_JSON_FWD_HPP_ + + #include // int64_t, uint64_t + #include // map + #include // allocator + #include // string + #include // vector + + // #include + + + /*! + @brief namespace for Niels Lohmann + @see https://github.com/nlohmann + @since version 1.0.0 + */ + NLOHMANN_JSON_NAMESPACE_BEGIN + + /*! + @brief default JSONSerializer template argument + + This serializer ignores the template arguments and uses ADL + ([argument-dependent lookup](https://en.cppreference.com/w/cpp/language/adl)) + for serialization. + */ + template + struct adl_serializer; + + /// a class to store JSON values + /// @sa https://json.nlohmann.me/api/basic_json/ + template class ObjectType = + std::map, + template class ArrayType = std::vector, + class StringType = std::string, class BooleanType = bool, + class NumberIntegerType = std::int64_t, + class NumberUnsignedType = std::uint64_t, + class NumberFloatType = double, + template class AllocatorType = std::allocator, + template class JSONSerializer = + adl_serializer, + class BinaryType = std::vector, // cppcheck-suppress syntaxError + class CustomBaseClass = void> + class basic_json; + + /// @brief JSON Pointer defines a string syntax for identifying a specific value within a JSON document + /// @sa https://json.nlohmann.me/api/json_pointer/ + template + class json_pointer; + + /*! + @brief default specialization + @sa https://json.nlohmann.me/api/json/ + */ + using json = basic_json<>; + + /// @brief a minimal map-like container that preserves insertion order + /// @sa https://json.nlohmann.me/api/ordered_map/ + template + struct ordered_map; + + /// @brief specialization that maintains the insertion order of object keys + /// @sa https://json.nlohmann.me/api/ordered_json/ + using ordered_json = basic_json; + + NLOHMANN_JSON_NAMESPACE_END + +#endif // INCLUDE_NLOHMANN_JSON_FWD_HPP_ + + +NLOHMANN_JSON_NAMESPACE_BEGIN +/*! +@brief detail namespace with internal helper functions + +This namespace collects functions that should not be exposed, +implementations of some @ref basic_json methods, and meta-programming helpers. + +@since version 2.1.0 +*/ +namespace detail +{ + +///////////// +// helpers // +///////////// + +// Note to maintainers: +// +// Every trait in this file expects a non CV-qualified type. +// The only exceptions are in the 'aliases for detected' section +// (i.e. those of the form: decltype(T::member_function(std::declval()))) +// +// In this case, T has to be properly CV-qualified to constraint the function arguments +// (e.g. to_json(BasicJsonType&, const T&)) + +template struct is_basic_json : std::false_type {}; + +NLOHMANN_BASIC_JSON_TPL_DECLARATION +struct is_basic_json : std::true_type {}; + +// used by exceptions create() member functions +// true_type for pointer to possibly cv-qualified basic_json or std::nullptr_t +// false_type otherwise +template +struct is_basic_json_context : + std::integral_constant < bool, + is_basic_json::type>::type>::value + || std::is_same::value > +{}; + +////////////////////// +// json_ref helpers // +////////////////////// + +template +class json_ref; + +template +struct is_json_ref : std::false_type {}; + +template +struct is_json_ref> : std::true_type {}; + +////////////////////////// +// aliases for detected // +////////////////////////// + +template +using mapped_type_t = typename T::mapped_type; + +template +using key_type_t = typename T::key_type; + +template +using value_type_t = typename T::value_type; + +template +using difference_type_t = typename T::difference_type; + +template +using pointer_t = typename T::pointer; + +template +using reference_t = typename T::reference; + +template +using iterator_category_t = typename T::iterator_category; + +template +using to_json_function = decltype(T::to_json(std::declval()...)); + +template +using from_json_function = decltype(T::from_json(std::declval()...)); + +template +using get_template_function = decltype(std::declval().template get()); + +// trait checking if JSONSerializer::from_json(json const&, udt&) exists +template +struct has_from_json : std::false_type {}; + +// trait checking if j.get is valid +// use this trait instead of std::is_constructible or std::is_convertible, +// both rely on, or make use of implicit conversions, and thus fail when T +// has several constructors/operator= (see https://github.com/nlohmann/json/issues/958) +template +struct is_getable +{ + static constexpr bool value = is_detected::value; +}; + +template +struct has_from_json < BasicJsonType, T, enable_if_t < !is_basic_json::value >> +{ + using serializer = typename BasicJsonType::template json_serializer; + + static constexpr bool value = + is_detected_exact::value; +}; + +// This trait checks if JSONSerializer::from_json(json const&) exists +// this overload is used for non-default-constructible user-defined-types +template +struct has_non_default_from_json : std::false_type {}; + +template +struct has_non_default_from_json < BasicJsonType, T, enable_if_t < !is_basic_json::value >> +{ + using serializer = typename BasicJsonType::template json_serializer; + + static constexpr bool value = + is_detected_exact::value; +}; + +// This trait checks if BasicJsonType::json_serializer::to_json exists +// Do not evaluate the trait when T is a basic_json type, to avoid template instantiation infinite recursion. +template +struct has_to_json : std::false_type {}; + +template +struct has_to_json < BasicJsonType, T, enable_if_t < !is_basic_json::value >> +{ + using serializer = typename BasicJsonType::template json_serializer; + + static constexpr bool value = + is_detected_exact::value; +}; + +template +using detect_key_compare = typename T::key_compare; + +template +struct has_key_compare : std::integral_constant::value> {}; + +// obtains the actual object key comparator +template +struct actual_object_comparator +{ + using object_t = typename BasicJsonType::object_t; + using object_comparator_t = typename BasicJsonType::default_object_comparator_t; + using type = typename std::conditional < has_key_compare::value, + typename object_t::key_compare, object_comparator_t>::type; +}; + +template +using actual_object_comparator_t = typename actual_object_comparator::type; + +///////////////// +// char_traits // +///////////////// + +// Primary template of char_traits calls std char_traits +template +struct char_traits : std::char_traits +{}; + +// Explicitly define char traits for unsigned char since it is not standard +template<> +struct char_traits : std::char_traits +{ + using char_type = unsigned char; + using int_type = uint64_t; + + // Redefine to_int_type function + static int_type to_int_type(char_type c) noexcept + { + return static_cast(c); + } + + static char_type to_char_type(int_type i) noexcept + { + return static_cast(i); + } + + static constexpr int_type eof() noexcept + { + return static_cast(EOF); + } +}; + +// Explicitly define char traits for signed char since it is not standard +template<> +struct char_traits : std::char_traits +{ + using char_type = signed char; + using int_type = uint64_t; + + // Redefine to_int_type function + static int_type to_int_type(char_type c) noexcept + { + return static_cast(c); + } + + static char_type to_char_type(int_type i) noexcept + { + return static_cast(i); + } + + static constexpr int_type eof() noexcept + { + return static_cast(EOF); + } +}; + +/////////////////// +// is_ functions // +/////////////////// + +// https://en.cppreference.com/w/cpp/types/conjunction +template struct conjunction : std::true_type { }; +template struct conjunction : B { }; +template +struct conjunction +: std::conditional(B::value), conjunction, B>::type {}; + +// https://en.cppreference.com/w/cpp/types/negation +template struct negation : std::integral_constant < bool, !B::value > { }; + +// Reimplementation of is_constructible and is_default_constructible, due to them being broken for +// std::pair and std::tuple until LWG 2367 fix (see https://cplusplus.github.io/LWG/lwg-defects.html#2367). +// This causes compile errors in e.g. clang 3.5 or gcc 4.9. +template +struct is_default_constructible : std::is_default_constructible {}; + +template +struct is_default_constructible> + : conjunction, is_default_constructible> {}; + +template +struct is_default_constructible> + : conjunction, is_default_constructible> {}; + +template +struct is_default_constructible> + : conjunction...> {}; + +template +struct is_default_constructible> + : conjunction...> {}; + +template +struct is_constructible : std::is_constructible {}; + +template +struct is_constructible> : is_default_constructible> {}; + +template +struct is_constructible> : is_default_constructible> {}; + +template +struct is_constructible> : is_default_constructible> {}; + +template +struct is_constructible> : is_default_constructible> {}; + +template +struct is_iterator_traits : std::false_type {}; + +template +struct is_iterator_traits> +{ + private: + using traits = iterator_traits; + + public: + static constexpr auto value = + is_detected::value && + is_detected::value && + is_detected::value && + is_detected::value && + is_detected::value; +}; + +template +struct is_range +{ + private: + using t_ref = typename std::add_lvalue_reference::type; + + using iterator = detected_t; + using sentinel = detected_t; + + // to be 100% correct, it should use https://en.cppreference.com/w/cpp/iterator/input_or_output_iterator + // and https://en.cppreference.com/w/cpp/iterator/sentinel_for + // but reimplementing these would be too much work, as a lot of other concepts are used underneath + static constexpr auto is_iterator_begin = + is_iterator_traits>::value; + + public: + static constexpr bool value = !std::is_same::value && !std::is_same::value && is_iterator_begin; +}; + +template +using iterator_t = enable_if_t::value, result_of_begin())>>; + +template +using range_value_t = value_type_t>>; + +// The following implementation of is_complete_type is taken from +// https://blogs.msdn.microsoft.com/vcblog/2015/12/02/partial-support-for-expression-sfinae-in-vs-2015-update-1/ +// and is written by Xiang Fan who agreed to using it in this library. + +template +struct is_complete_type : std::false_type {}; + +template +struct is_complete_type : std::true_type {}; + +template +struct is_compatible_object_type_impl : std::false_type {}; + +template +struct is_compatible_object_type_impl < + BasicJsonType, CompatibleObjectType, + enable_if_t < is_detected::value&& + is_detected::value >> +{ + using object_t = typename BasicJsonType::object_t; + + // macOS's is_constructible does not play well with nonesuch... + static constexpr bool value = + is_constructible::value && + is_constructible::value; +}; + +template +struct is_compatible_object_type + : is_compatible_object_type_impl {}; + +template +struct is_constructible_object_type_impl : std::false_type {}; + +template +struct is_constructible_object_type_impl < + BasicJsonType, ConstructibleObjectType, + enable_if_t < is_detected::value&& + is_detected::value >> +{ + using object_t = typename BasicJsonType::object_t; + + static constexpr bool value = + (is_default_constructible::value && + (std::is_move_assignable::value || + std::is_copy_assignable::value) && + (is_constructible::value && + std::is_same < + typename object_t::mapped_type, + typename ConstructibleObjectType::mapped_type >::value)) || + (has_from_json::value || + has_non_default_from_json < + BasicJsonType, + typename ConstructibleObjectType::mapped_type >::value); +}; + +template +struct is_constructible_object_type + : is_constructible_object_type_impl {}; + +template +struct is_compatible_string_type +{ + static constexpr auto value = + is_constructible::value; +}; + +template +struct is_constructible_string_type +{ + // launder type through decltype() to fix compilation failure on ICPC +#ifdef __INTEL_COMPILER + using laundered_type = decltype(std::declval()); +#else + using laundered_type = ConstructibleStringType; +#endif + + static constexpr auto value = + conjunction < + is_constructible, + is_detected_exact>::value; +}; + +template +struct is_compatible_array_type_impl : std::false_type {}; + +template +struct is_compatible_array_type_impl < + BasicJsonType, CompatibleArrayType, + enable_if_t < + is_detected::value&& + is_iterator_traits>>::value&& +// special case for types like std::filesystem::path whose iterator's value_type are themselves +// c.f. https://github.com/nlohmann/json/pull/3073 + !std::is_same>::value >> +{ + static constexpr bool value = + is_constructible>::value; +}; + +template +struct is_compatible_array_type + : is_compatible_array_type_impl {}; + +template +struct is_constructible_array_type_impl : std::false_type {}; + +template +struct is_constructible_array_type_impl < + BasicJsonType, ConstructibleArrayType, + enable_if_t::value >> + : std::true_type {}; + +template +struct is_constructible_array_type_impl < + BasicJsonType, ConstructibleArrayType, + enable_if_t < !std::is_same::value&& + !is_compatible_string_type::value&& + is_default_constructible::value&& +(std::is_move_assignable::value || + std::is_copy_assignable::value)&& +is_detected::value&& +is_iterator_traits>>::value&& +is_detected::value&& +// special case for types like std::filesystem::path whose iterator's value_type are themselves +// c.f. https://github.com/nlohmann/json/pull/3073 +!std::is_same>::value&& + is_complete_type < + detected_t>::value >> +{ + using value_type = range_value_t; + + static constexpr bool value = + std::is_same::value || + has_from_json::value || + has_non_default_from_json < + BasicJsonType, + value_type >::value; +}; + +template +struct is_constructible_array_type + : is_constructible_array_type_impl {}; + +template +struct is_compatible_integer_type_impl : std::false_type {}; + +template +struct is_compatible_integer_type_impl < + RealIntegerType, CompatibleNumberIntegerType, + enable_if_t < std::is_integral::value&& + std::is_integral::value&& + !std::is_same::value >> +{ + // is there an assert somewhere on overflows? + using RealLimits = std::numeric_limits; + using CompatibleLimits = std::numeric_limits; + + static constexpr auto value = + is_constructible::value && + CompatibleLimits::is_integer && + RealLimits::is_signed == CompatibleLimits::is_signed; +}; + +template +struct is_compatible_integer_type + : is_compatible_integer_type_impl {}; + +template +struct is_compatible_type_impl: std::false_type {}; + +template +struct is_compatible_type_impl < + BasicJsonType, CompatibleType, + enable_if_t::value >> +{ + static constexpr bool value = + has_to_json::value; +}; + +template +struct is_compatible_type + : is_compatible_type_impl {}; + +template +struct is_constructible_tuple : std::false_type {}; + +template +struct is_constructible_tuple> : conjunction...> {}; + +template +struct is_json_iterator_of : std::false_type {}; + +template +struct is_json_iterator_of : std::true_type {}; + +template +struct is_json_iterator_of : std::true_type +{}; + +// checks if a given type T is a template specialization of Primary +template